Difference between revisions of "Internet Detectives Tumblr"
(14 intermediate revisions by the same user not shown) | |||
Line 10: | Line 10: | ||
|status = Online (Deprecated) | |status = Online (Deprecated) | ||
}} | }} | ||
− | <b>Tumblr</b> is a blogging website where users can create their own customized blogs and upload images, videos, and audio files. The [[ | + | <b>Tumblr</b> is a blogging website where users can create their own customized blogs and upload images, videos, and audio files. The [[player]] Eevee created a Tumblr account for the [[Internet Detectives]] and used it as their main method of archiving [[Johnisdead]] for throughout 2015 and 2016. The Tumblr was used in conjunction with the [[Johnisdead Wiki (Fandom)|original Johnisdead Wiki]] and [[Dropbox]]. The Tumblr saw its final large bout of activity in 2019, when it was used to archive canon conversations with characters. Since then, all archival activities have taken place on [[Johnisdead Wiki|this Wiki]]. |
− | < | + | <h2>Users</h2> |
+ | The following [[Players]] had access to the Tumblr account, which granted them the ability to publish posts and answer questions. | ||
+ | <ul><li>Eevee - Blog creator and owner</li> | ||
+ | <li>Thorin - Mod</li> | ||
+ | <li>Wolfcat - Mod</li> | ||
+ | <li>Circlehunter - Mod</li></ul> | ||
<h2>Archive</h2> | <h2>Archive</h2> | ||
Line 18: | Line 23: | ||
<h3>Posts</h3> | <h3>Posts</h3> | ||
− | This section contains all of the blog posts created on the Internet Detectives Tumblr | + | This section contains all of the blog posts created on the Internet Detectives Tumblr as well as the files contained within them. |
− | <div class=" | + | <div class="transcriptTumblr mw-collapsible mw-collapsed" > |
− | <p style=" | + | <p style="display:inline;"> |
− | <b> | + | <b> |
− | <div class=" | + | Internet Detectives Tumblr Posts |
− | + | </b> | |
+ | </p> | ||
+ | <div class="mw-collapsible-content"> | ||
− | + | {{TumblrArchive}} | |
− | + | </div> | |
+ | </div> | ||
− | < | + | <h3>Pages</h3> |
− | + | This section contains all of the pages that were hosted on the Internet Detectives Tumblr. | |
− | |||
− | <b> | + | <div class="transcriptTumblr mw-collapsible mw-collapsed" > |
− | <div class=" | + | <p style="display:inline;"> |
− | + | <b> | |
+ | Internet Detectives Tumblr Pages | ||
+ | </b> | ||
+ | </p> | ||
+ | <div class="mw-collapsible-content"> | ||
− | + | <div class="webArchive"> | |
− | + | <p style="margin-bottom: 0.2em; margin-top: 0.2em;"> | |
− | + | <b>Johnisdead Timeline</b> | |
− | + | </p> | |
− | <div class=" | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | <b> | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | < | + | ((This page simply contained every blog post that was published on the Internet Detectives Tumblr that was tagged "<b>JohnIsDeadTimeline</b>". |
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</poem></div> | </poem></div> | ||
− | <b> | + | <b>Yshdt Timeline</b> |
+ | </p> | ||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | + | ((This link simply redirected players to a Google Doc that archived the events of the [[YSHDT Arc]]. | |
− | + | [https://docs.google.com/document/d/1Af7tdiGQh4Vi-eTOxjKi9HlWcfidNFhQfEFC5iI8LsU/edit https://docs.google.com/document/d/1Af7tdiGQh4Vi-eTOxjKi9HlWcfidNFhQfEFC5iI8LsU/edit] | |
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</poem></div> | </poem></div> | ||
− | <b> | + | <b>ARG Links<br />[https://internetdetectives.tumblr.com/links https://internetdetectives.tumblr.com/links]</b> |
+ | </p> | ||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | <span | + | <span style="font-size:2em; font-weight:bold;color:#fe6299;">ARG Links</span> |
+ | [http://s13.zetaboards.com/WithinHubris/index/ Within Hubris]<ul><li>[http://s13.zetaboards.com/WithinHubris/topic/7326964/ ARG Thread]</li></ul> | ||
− | + | <b>Johnisdead Links:</b> | |
− | / | + | <ul><li>[http://johnisdead.com/ johnisdead.com]</li><li>[http://lunarchildren.com/ lunarchildren.com]</li><li>[http://whatisben.com/ whatisben.com]</li><li>[https://www.youtube.com/channel/UCshnpQJBTZWDAynTWnNLM2g Tyler’s Youtube]</li><li>[https://www.youtube.com/channel/UCgrrgIhl-3DkhgKIHEkB4OQ/ Vincent Adam’s Youtube]</li><li>[https://www.youtube.com/channel/UCT-n6eNjB3rNoDYsKWuP-DA lostmemory423 Youtube]</li></ul> |
− | < | + | <b>YSHDT Links:</b> |
− | |||
− | |||
− | < | + | <ul><li>[http://yshdt.com/ yshdt.com]</li><li>[http://letschasethemouse.blogspot.com/ Doug’s Blog]</li><li>[https://www.youtube.com/channel/UCfjnw6rFLW3-NhEphVdPymw Helper’s Youtube]</li></ul> |
− | |||
− | |||
− | |||
− | |||
− | </ | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | </ | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
<b>Resources:</b> | <b>Resources:</b> | ||
− | [https:// | + | <ul><li>[https://drive.google.com/drive/folders/0B4s-y4xaQqveflJqMFQ1YmZxQlBWU05QVWgyWFVCRW5aWEJlWnpsdTMzYVJLa2ItR2VfZGc Circlehunter’s Timeline (incomplete)]</li><li>[https://www.dropbox.com/sh/lqv9ufbdl0w8xh7/AABKm_Hjiqsz8Zb1Sa0jdru3a?dl=0 Oceanstuck’s Dropbox]</li><li>[http://johnisdead.wikia.com/ Official Johnisdead Wikia]</li><li>[https://www.youtube.com/channel/UC3gtGXxN8u87hgnT6S-5itA Official Johnisdead Youtube]</li></ul> |
− | |||
− | [https://www.dropbox.com/sh/lqv9ufbdl0w8xh7/AABKm_Hjiqsz8Zb1Sa0jdru3a?dl=0 | ||
− | [ | ||
− | [https:// | ||
− | |||
− | |||
− | |||
− | < | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</poem></div> | </poem></div> | ||
− | <b> | + | <b>/Shrine\<br />[https://internetdetectives.tumblr.com/shrine https://internetdetectives.tumblr.com/shrine]</b> |
+ | </p> | ||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | < | + | <span style="font-size:2em; font-weight:bold;color:#fe6299;">/Shrine</span> |
− | |||
− | |||
− | |||
− | |||
− | < | + | <span class="ext-link">[[File:Tumblr_ozlmapy8Ak1uv6z7xo1_500.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/3/31/Tumblr_ozlmapy8Ak1uv6z7xo1_500.jpg|target=_blank]]</span> |
− | |||
− | |||
− | |||
− | |||
− | |||
− | <b> | + | <b>Let us all worship the purpleness of /Patrem\</b> |
− | |||
− | |||
− | |||
− | |||
− | |||
− | < | + | <span class="ext-link">[[File:Tumblr_inline_no1pbzbe401r8au3u_500.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/0/0c/Tumblr_inline_no1pbzbe401r8au3u_500.jpg|target=_blank]]</span> |
− | |||
− | |||
− | |||
− | |||
− | |||
− | <b> | + | <b><i>Love Letters to /Patrem\ :</i></b> |
− | |||
− | |||
− | < | ||
− | + | <ul><li>Roses are Red | |
+ | Violets are Blue | ||
+ | You’re a hideous ghoul | ||
+ | and we’re terrified of you. | ||
+ | <i>-wickedlady4180</i></li> | ||
+ | <li>Dat voice, so sexy. | ||
+ | Dat butt, so smooth. | ||
+ | Dat attitude, so dickish. | ||
+ | Dat responce, so r00d. | ||
+ | <i>-wickedlady4180</i></li> | ||
+ | <li>PLEASE DON’T KILL US PLEASE | ||
+ | ‘CAUSE WE REALLY DON’T WANNA DIE | ||
+ | AND IF YOU DO NOT KILL US WE WILL | ||
+ | BAKE YOU LOTS OF PIES | ||
+ | <i>- Circlehunter</i></li> | ||
+ | <li>Papa. | ||
+ | Just killed a man. | ||
+ | Sent him running to his death. | ||
+ | Someone threw a rock, | ||
+ | and now he’s dead. | ||
− | + | Hello, purple daddy. | |
+ | I hope you’re glad. | ||
+ | You told me not to change time, | ||
+ | but screw that shit! | ||
− | + | PAPA! OOOOHHHHHH. | |
− | </ | + | <i>-wickedlady4180</i></li></ul> |
− | < | + | <span class="ext-link">[[File:Tumblr_inline_noevj5UXmk1r8au3u_500.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/d/da/Tumblr_inline_noevj5UXmk1r8au3u_500.png|target=_blank]]</span> |
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | http://johnisdead. | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | + | /Patrem’s the best father an Internet Detective could have. He transcends time and space, he is immortal, and when he gets angry… <strike>people die.</strike> | |
</poem></div> | </poem></div> | ||
− | <b> | + | <b>FAQ<br />[https://internetdetectives.tumblr.com/faq https://internetdetectives.tumblr.com/faq]</b> |
+ | </p> | ||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | < | + | <span style="font-size:2em; font-weight:bold;color:#fe6299;">FAQ</span> |
− | + | Do you have questions? | |
− | + | Perfect! We’ve got some answers. | |
− | + | If you have any questions not in this FAQ, please feel free to message us. | |
− | + | Q: “<u><i>Who the hell are the Internet Detectives?</i></u>” | |
− | + | A: The Internet Detectives is a Skype group that was created during the month of January 2015. Their purpose is to solve ARGs, draw shitty comics, and partake in other pointless shenanigans. ([http://withinhubris.wikia.com/wiki/The_Internet_Detectives Wiki]) | |
− | + | Q: “<u><i>How can I become an Internet Detective?</i></u>” | |
+ | A: First you have to sing our [http://wickedlady4180.webs.com/yes.mp3 Anthem], and pledge fealty to the group. Then you <i>[http://internetdetectives.tumblr.com/ask message us with your Skype name, so we can add you to the group]</i>. Then you will be subjected to the trials of initiation. <i><b>The Trial of Flame</b></i>: This is where we troll you with links to Vaporwave songs, stupid Tumblr images, and accuse you of being a spy. <i><b>The Trial of Tears</b></i>: This where you watch us fail at humanity. <b><i>The Final Trial</i></b> = Fight or Flight: This is where you decide whether you will run far away from us, or remain one of us … o n e o f u s. | ||
+ | Q: “<u><i>Is this real life?</i></u>” | ||
+ | A: No, unfortunately this is not real life, this is an [https://en.wikipedia.org/wiki/Alternate_reality_game ARG]. However, John is most certainly dead. He will be missed. RIP. | ||
+ | Q: “<u><i>Should I read the Timelines?</i></u>” | ||
+ | A: Yes. In fact, it’s probably the most important thing to do before attempting to play the ARG. There is a ton of information, lore, and characters to learn. We strongly urge you to read both YSHDT and The Dead Arc timelines. | ||
+ | Q: “<u><i>Why are there two Arc Timelines?</i></u>” | ||
+ | A: Yshdt and The Dead Arc are both considered one ARG: John is Dead. However, while the ARG as a whole was conceptualized by the current group of GM’s, the Douglas & Mason storyline of the Yshdt Arc was created by “<i>Dawn of a New Day</i>”. As such, the Yshdt Arc will be considered a stand-alone introduction to the current Dead Arc, and have its own timeline of events. | ||
+ | Q: “<u><i>Will Yshdt ever conclude?</i></u>” | ||
+ | A: Unfortunately Yshdt is on indefinite hiatus. | ||
+ | Q: “<u><i>Is this related to BENDROWNED?</i></u>” | ||
+ | A: Yes. This ARG is related to, and heavily influenced by The Haunted Cartridge & The Moon Children Arc of Jadusable’s infamous Creepy Pasta “<i>BENDROWNED</i>”. However, this ARG is in no way affiliated with Jadusable, or any of his works. | ||
+ | Q: “<u><i>How many characters are there in this ARG?</i></u>” | ||
+ | A: The list of characters related to this ARG can be found HERE. | ||
+ | Q: “<u><i>Who are the Moon Children & Lunar Children?</i></u>” | ||
+ | A: In this ARG, we begin to learn more information about the Moon Children, prior to the earliest mentions in the Jadusable lore. The Moon Children are a long standing group of cultists that worship the Moon Goddess ‘<i>Luna</i>’. It’s learned that in the early 1980’s the cult had a division within its ranks and was split apart into groups: The Lunar Children and The Moon Children. It is the Lunar Children, led by the <i>FATHER</i> /Patrem\, who are the driving force behind the terrible fates of Tyler, John, Jayckup, and Kevin. | ||
+ | (A link to the Jadusable wiki and the original description of the Moon Children can be found [http://jadusable.wikia.com/wiki/Moon_Children HERE].) | ||
</poem></div> | </poem></div> | ||
− | <b> | + | <b>Fuckers<br />[https://internetdetectives.tumblr.com/Meet-The-IDs https://internetdetectives.tumblr.com/Meet-The-IDs]</b> |
+ | </p> | ||
<div class="webArchiveEntry"><poem> | <div class="webArchiveEntry"><poem> | ||
− | < | + | <span class="ext-link">[[File:Tumblr_nqfkukyW8X1rr4wf6o1_500.gif|class=pageImg|link=http://johnisdead.withinhubris.com/images/8/8f/Tumblr_nqfkukyW8X1rr4wf6o1_500.gif|target=_blank]]</span> |
− | |||
− | |||
− | < | + | <span style="font-size:2em; font-weight:bold;color:#fe6299;">The Internet Detectives</span> |
− | + | <b>[http://johnisdead.wikia.com/wiki/Tyler Tyler]</b> | |
− | -Wolfcat | + | <span class="ext-link">[[File:Tylerface.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/2/24/Tylerface.png|target=_blank|50px|50px]]</span> |
− | </ | + | <ul><li>Currently a main character in the Dead Arc. He lost his memory, and thus doesn’t remember being our resident Vaporwave addict. His amnesia is enforced by /Patrem\ so enlightening him is futile, as he’ll just think we’re insane and obviously lying.</li></ul> |
− | + | <b>[http://johnisdead.wikia.com/wiki/John John / Mesic]</b> | |
− | <b>4/ | + | <span class="ext-link">[[File:Tenebrisjohn.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/3/3a/Tenebrisjohn.jpg|target=_blank|50px|50px]]</span> |
− | < | + | <ul><li>Currently a main character in the Dead Arc. Dis’ nigga straight up ded.</li></ul> |
− | < | + | <b>[http://johnisdead.wikia.com/wiki/Jayckup Jayckup]</b> |
− | + | <span class="ext-link">[[File:Jayckup.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/9/96/Jayckup.png|target=_blank|50px|50px]]</span> | |
− | + | <ul><li>Currently a main character in the Dead Arc. Is the acid hitting you yet?</li></ul> | |
+ | <b>[http://johnisdead.wikia.com/wiki/Dawn_of_a_New_Day Dawn / The Sun]</b> | ||
+ | <span class="ext-link">[[File:Sun2.gif|class=pageImg|link=http://johnisdead.withinhubris.com/images/c/c4/Sun2.gif|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Creator of YSHDT (aka - The Man), also played the character “Helper”. Is too cool for us now, and only comes around to call us nerds and fags.</li></ul> | ||
+ | <b>CircleHunter / Captain Desdinova / Wyatt</b> | ||
+ | <span class="ext-link">[[File:Circlehunter.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/a/a6/Circlehunter.jpg|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Long time ID member, owner of the Jadusable wiki. Also played the Character “[http://johnisdead.wikia.com/wiki/Grey_Man Grey Man]” in the YSHDT arc. Refuses to wear clothes on cam, showing us his glorious pectorals at every opportunity.</li></ul> | ||
+ | <b>Spirkiroid</b> | ||
+ | <span class="ext-link">[[File:Spirkiroid.gif|class=pageImg|link=http://johnisdead.withinhubris.com/images/c/c2/Spirkiroid.gif|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Possibly the smartest person here.</li></ul> | ||
+ | <b>Sengi</b> | ||
+ | <span class="ext-link">[[File:Sengi.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/a/ab/Sengi.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>A member of #TeamFlan, Biggest plátano lover in ID. ( ͡° ͜ʖ ͡°)</li></ul> | ||
+ | <b><strike>Stevey</strike> (RIP)</b> | ||
+ | <span class="ext-link">[[File:Stevey.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/0/0f/Stevey.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>He’s not gay, he’s British.</li></ul> | ||
+ | <b>Archery2000</b> | ||
+ | <span class="ext-link">[[File:Archery2000.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/3/3b/Archery2000.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>TeamFlan member, has found many clues in game, and is credited in the timeline several times.</li></ul> | ||
+ | <b>[http://johnisdead.wikia.com/wiki/User:Wickedlady4180 Eve / Wickedlady4180]</b> | ||
+ | <span class="ext-link">[[File:Eevee.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/a/ac/Eevee.jpg|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>The Keeper of the Scrolls of Time. Is loyal to /Patrem\, so therefore is a BITCH and a TRAITOR.</li></ul> | ||
+ | <b>Oceanstuck</b> | ||
+ | <span class="ext-link">[[File:Oceanstuck.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/7/74/Oceanstuck.jpg|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Joined WH at the begining of the ARG. Started the wiki, and maintains the dropbox.</li></ul> | ||
+ | <b>Thorin / ADULT_LINK</b> | ||
+ | <span class="ext-link">[[File:Thorin.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/a/a9/Thorin.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Is noted for posting in short bursts of randomness. Completely believes he’s Link, but he’s actually a Lonk.</li></ul> | ||
+ | <b>Wolfcat</b> | ||
+ | <span class="ext-link">[[File:Wolfcat.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/2/28/Wolfcat.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Creator of Weenie Licked, the infamous ARG on Within Hubris. He’s an overrated piece of garbage…. still good though.</li></ul> | ||
+ | <b>KidPichu</b> | ||
+ | <span class="ext-link">[[File:KidPichu.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/9/99/KidPichu.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>The Boss of #TeamFlan. Refuses to get in call with the group, “too shy” possibly sounds like Dr. Girlfriend.</li></ul> | ||
+ | <b>Mugen Kagemaru (K♦)</b> | ||
+ | <span class="ext-link">[[File:Mugen_Kagemaru.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/d/d6/Mugen_Kagemaru.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>W̶̕͜͠A̶̷N̴̡̕͠͞Ḑ͢Ę̸R͟͏I͠͝N̷͏̵͜G͢H̢͝͞Ứ̵͞R̶̶͡T̨͢I̸͘͞N̶̛͝G̨F̕͝Ì̶̡G̸̢̛̕H̷̡̀͠T̶̴̢̀I̵̛Ń̢G̀͘͠C̨̀͜R͏̷͟Y̶͠͏̕I̷̶͡N͏̸̨̛͡G̡̢̛͞K̶̡̕I͏L̸̴̛͞Ĺ̨̕I̕͜N͜G̷͘͝Ḿ̷̵̡͜O͏̷͞Ư̷̡̕͠R̸̡͞͏N̨Í̸̷͝N̸͢G͢͡M̴͘͠͏A̸̧Ņ͜͝I̸̧P͝Ư͡L̷̸ÀT̶̷̴̵Í̕͘͠N̶̸͘Ǵ̡̢͘͢Á̧͝G̵̶̨̕E̷̢̢͟͟L̨̨̕͝E̶̶͘͠S̵̶̕͞S͠S̀͏̶͝H̨̢̢͝Á̷Ḑ͝Ơ͡͝W̕</li></ul> | ||
+ | <b>Seeker von Yuki II / TheSeekerofLight</b> | ||
+ | <span class="ext-link">[[File:Seeker.jpg|class=pageImg|link=http://johnisdead.withinhubris.com/images/4/4b/Seeker.jpg|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>What is this I don’t even…</li></ul> | ||
+ | <b>ARGdov</b> | ||
+ | <span class="ext-link">[[File:ARG_Dov.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/8/8a/ARG_Dov.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>One of God’s chosen. A cool broskino, keeps the Sabbath so we get to talk about him all day on Saturday, like about how we still can’t believe he showed Doug the bomb plans!</li></ul> | ||
+ | <b>GreyouTT</b> | ||
+ | <span class="ext-link">[[File:GreyouTT.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/2/29/GreyouTT.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Triggered the YSHDT game by playing Oath to Order as a joke.</li></ul> | ||
+ | <b>Mando</b> | ||
+ | <span class="ext-link">[[File:Mando.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/0/08/Mando.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Tried to kill Mason and Doug, tricked us all. Untustable.</li></ul> | ||
+ | <b>Yuki</b> | ||
+ | <span class="ext-link">[[File:Yuki.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/d/d3/Yuki.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>The rarest and most elusive of the ID’s. Solved the infamous cipher given to us by Helper.</li></ul> | ||
+ | <b>Master Swordsman Faut</b> | ||
+ | <span class="ext-link">[[File:Faut.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/4/4d/Faut.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Lives on the other side of the world, usually comes around when we’re all asleep.</li></ul> | ||
+ | <b><strike>Zack Nelson / Gizemo</strike> (RIP)</b> | ||
+ | <span class="ext-link">[[File:Zack.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/e/e1/Zack.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>A picture tells a thousand words…</li></ul> | ||
+ | <b>Pancakes</b> | ||
+ | <span class="ext-link">[[File:Pancakes.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/6/6b/Pancakes.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>The only ID member to get younger with each minute that passes.</li></ul> | ||
+ | <b>Ryfoxx</b> | ||
+ | <span class="ext-link">[[File:Ryfoxx.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/8/8c/Ryfoxx.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Fuks your scripts with a huge cac, and doesn’t afraid of anything!</li></ul> | ||
+ | <b>Leslie</b> | ||
+ | <span class="ext-link">[[File:Leslie.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/3/38/Leslie.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>Proved their worth on the field of honor; solved BinReset.jpg.</li></ul> | ||
+ | <b>Juplaylp</b> | ||
+ | <span class="ext-link">[[File:Juplaylp.png|class=pageImg|link=http://johnisdead.withinhubris.com/images/b/b1/Juplaylp.png|target=_blank|50px|50px]]</span> | ||
+ | <ul><li>You’re here, you’re queer. Deal with it!</li></ul> | ||
− | |||
</poem></div> | </poem></div> | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</div> | </div> | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</div> | </div> | ||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
</div> | </div> | ||
+ | <h2>Images</h2> | ||
+ | Various images used for the Internet Detectives Tumblr. | ||
− | + | <gallery> | |
− | + | File:Internetdetectives.png|The Internet Detectives logo. | |
− | + | File:Avatar_afa54d657fdf_128.png|The Tumblr account's avatar. | |
− | + | File:Tumblr_nqfkukyW8X1rr4wf6o1_500.gif|An image used as the link to the "Meet-the-ID" page. | |
− | + | File:Tumblrbg.jpg|The Tumblr account's background image. | |
− | + | </gallery> | |
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
− | |||
{{Websites}} | {{Websites}} |
Latest revision as of 10:17, 31 July 2021
Internet Detectives Tumblr
Name | Internet Detectives Tumblr |
---|---|
URL | https://internetdetectives.tumblr.com/ |
Type | Archival Blog |
Affiliation | Players |
Status | Online (Deprecated) |
Tumblr is a blogging website where users can create their own customized blogs and upload images, videos, and audio files. The player Eevee created a Tumblr account for the Internet Detectives and used it as their main method of archiving Johnisdead for throughout 2015 and 2016. The Tumblr was used in conjunction with the original Johnisdead Wiki and Dropbox. The Tumblr saw its final large bout of activity in 2019, when it was used to archive canon conversations with characters. Since then, all archival activities have taken place on this Wiki.
Users
The following Players had access to the Tumblr account, which granted them the ability to publish posts and answer questions.
- Eevee - Blog creator and owner
- Thorin - Mod
- Wolfcat - Mod
- Circlehunter - Mod
Archive
Below is a transcript of the various pages found on the Internet Detectives Tumblr and its many posts.
Posts
This section contains all of the blog posts created on the Internet Detectives Tumblr as well as the files contained within them.
Internet Detectives Tumblr Posts
5/8/15
5/8/15 5/8/15"wonkwenkwonkwenkwonkwenknwonk ydaerla uoy enoemos si revewoh tnecniV .won mih dnoyeb raf ma I, sgnilbbircs yttep sih rof gnirac dnoyeb raf ma I dna yob taht denmad evah uoY"
- /Patrem\
#within hubris
#patrem
We literally stole Doug’s mail.
(Source: s13.zetaboards.com)
#helper
#doug
#within hubris
Jayckup sells his soul.
(Source: youtube.com)
#within hubris
#jayckup
"My father is dead, I don’t have any father figures and I have no idea what the fuck you are talking about. I am gonna go before someone steals my shit. Some little kid just walked up to me, like this young kid and just asked me if the “Purple man” is gone now, crying and shit. Fuck this, fuck everything about this, fuck you guys, fuck whoever the purple man is. I am going home now. Fuck this."
- Vincent
#potty mouth
#vincent
#within hubris
"You’ve all been very lucky so far. In all the times your members have rushed in and acted without the consensus of others, you haven’t killed anybody yet. Perhaps this will change tonight."
- Helper
(Source: s13.zetaboards.com)
#helper
"Anyways, hello adventurers! I am here to deliver a message. As I have lost my hat, and you heroes clearly are not on top of things, this message has been somewhat delayed, by about fourteen days. As it just so happens, you have not gone down the rabbit hole!
Or, more precisely, you guys “Missed something fucking big and apparent.” And that “Someone died because of your fuck up.” Not my words, I tell you! This came straight from your questgiver! I just know that finding out what it is should be priority number one. Well, good day! Try not to kill anyone else.
Murderers."
- Helper
#helper
"There will be a coming time in which a portal shall be opened. This place was forged by the one they call saint, and is governed by the one I call grand.
Named a petty insult directed at the terrible fate of one child and the loss of another. Through here you may encounter many things both of your kind, and from times before man.
He will seek the burned one, without his puppet he is only half of his potential. He will seek the link of that time, for it is through his death that he believes he will truly become a god."
- /Patrem\
#patrem
"Yes child, sleep is a very important thing for your kind. So I shall tell you the tail of another who also has trouble sleeping. There once was a child who was quite curious, he was surrounded by children and yet, it was not enough for him. So he sought the company of others.
Through trials and tribulations he found sanctuary in their communion, however he lost sight of the other children, his own name and even his self. But his new family loved him very much, so his father decided to give him a name.
Vincent, and before he new it he was a very responsible man. He was to oversee all of the children in his fathers home when his father was away. However one night, father saw that one of his children had become quite grand. This child was to come and see his father so that he might be told the secrets that only father may know.
But two terrible children, who must not be spoken of, one flying, one simply screaming, had come and interfered. Luckily the grand child had still done what was needed on that night, but their father was displaced.
He was hurt, that children would fuss in such a time of glory. But Vincent was a good boy, he gave his father refuge. But the event was much to bare, and Vincent had forgotten once again who his family truly was.
This all kept Vincent awake, always awake, and his father can do no work, if Vincent is always awake and crying as though he is still simply another child.
Now you must rest, for sleep is a very important thing for your kind. I may be able to go on without such a time wasting practice, but neither you nor Vincent can."
- /Patrem\’s Bedtime Story
#patrem
"Your link has been severed. You will no longer be able to use the power of Link. Songs will no longer affect the ARG for the time being."
- The Man
#The Man
"I will contact you soon.
Be ready."
- Mason 4/4/15
We need guidance
Hello /Patrem\ ,
A lot of events have recently unfolded, some of which we are still unsure of.
We learned that someone has ascended, though who that may be, is still unclear to us.
We were contacted by Mason, who now appears to be in our own timeline. I remember once you advised against crossing timelines, but I’m unsure how to avoid the chaos you said it would bring.
I know you must be very busy as of late, but any information you could give us would be helpful, and greatly appreciated.
~ Your faithful child.
**Announcement!**
The Man’s ARG has ended, and he will no longer make updates.
A new, ARG will now take it’s place: The Dead ARC
http://johnisdead.com/
#johnisdead.com
#yshdt.com
#RIP
#best arg ever
(Source: youtube.com)
#The Man
The Dead ARC
Welcome to the new ARG: The Dead ARC.
All links are up to date, and the timeline is complete and ready for the new game to begin.
Good luck Internet Detectives!
#johnisdead.com
#The Dead ARC
Main page image of johnisdead.com
(Source: johnisdead.com)
#johnisdead.com
#The Dead Arc
New ARG character: SKM
(Source: s13.zetaboards.com)
#johnisdead.com
#within hubris
mugen is cac lelelelelel
Yes. Let’s tie him up.
hi eve!
Hi Anon! (I mean Lonk)
"never forget morgan 2015"
- Circlehunter
#4 hours of laughter
_o_n__urned.png = John Burned
(Source: johnisdead.com)
#johnisdead.com
"February 19, 2015
CHECK YOUR NOTES"
- http://johnisdead.com/key592/fate.txt
(Source: johnisdead.com)
#johnisdead.com
Main page of http://lunarchildren.com
(Source: lunarchildren.com)
#lunarchildren.com
#SKM
Lunar children video titled ”MAXYHAXXXY.webm“ 5/19/15
#lunarchildren.com
LULZ
<totesnotagamejacker>: ur all cacs
--- SKM has banned *!*@mib-CBA078E0.hsd1.wa.comcast.net
*** totesnotagamejacker was kicked by SKM (SKM)
#RIP Thorin
(Source: youtube.com)
(Source: youtube.com)
Seems "tempdrezzed png" resembles Patrem's avatar.
Yes, I think the idea was that SKM did something to hinder /Patrem\s’ ability to hunt him that night. SKM uses the word “Drezzed” as a synonym for “fucked”. Luckily it’s only temporary, cuz’ I gotta have my /Patrem\!
FIREKID.webm
johnisdead.com update 5/22/15
#johnisdead.com
FOG.webm
johnisdead.com update 5/22/15
#johnisdead.com
Artist: Tylep
Track: Tyler's /Patrem\ impression #1
Album: John is Dead Soundtrack
Posted to WH on 3/17/15
Believed to have been recorded the same night as the Youtube videos.
(Source: s13.zetaboards.com)
#johnisdead.com
i knew id heard of the 8/8 archive loss thing before
It’s something I’m not at all familiar with, I’d have to re-read the whole moon children Arc again. I suppose that’s a good idea now that The Dead Arc is rich in that lore.
Chat with Tyler 5/26/15
Please read Below!
[5/26/2015 1:45:19 AM] Tylep the rotaerc: Is all well?
[5/26/2015 1:45:25 AM] Wolfcat: …dat avatar
[5/26/2015 1:45:37 AM] Dovid Magady: Oh. hi, I haven’t met you before.
[5/26/2015 1:45:44 AM] Tylep the rotaerc: I thought I should change it ^^;
[5/26/2015 1:45:51 AM] Tylep the rotaerc: Wasn’t sure what the other one was for
[5/26/2015 1:46:04 AM] Eve: Woah that sounds pretty spooked broskino XDYeah, I’m at work, all alone and i heard a spooky noise, lol
[5/26/2015 1:46:06 AM] Tylep the rotaerc: But I like to make dumb faces so I figured this was a good excuse ^^
[5/26/2015 1:46:17 AM] Tylep the rotaerc: Oh woa rip
[5/26/2015 1:46:25 AM] Stevey “Proest Heister 2015” Freeman: I’m off..
[5/26/2015 1:46:39 AM] Tylep the rotaerc: I have had to do overnight watch of my store before and it can be pretty spooky
[5/26/2015 1:46:46 AM] Tylep the rotaerc: we live in a not so good hood
[5/26/2015 1:47:01 AM] Eve: I work in a church, it’s extra spooky!
[5/26/2015 1:47:38 AM] Dovid Magady: That sounds creepy as hell- no sort-of pun intended
[5/26/2015 1:47:56 AM] Tylep the rotaerc: hue
[5/26/2015 1:48:11 AM] Eve: lol
[5/26/2015 1:48:18 AM] Eve: It’s ok now, I’m fine
[5/26/2015 1:49:37 AM] Eve: So tyler, How you doing?
[5/26/2015 1:51:12 AM] Tylep the rotaerc: lol tired
[5/26/2015 1:51:23 AM] Tylep the rotaerc: I just got home from work
[5/26/2015 1:51:35 AM] Dovid Magady: You mst be tired..
[5/26/2015 1:52:17 AM] Tylep the rotaerc: But I got the rest of the week off cause its my 6 year aniversary at the place.
[5/26/2015 1:52:36 AM] Dovid Magady: Wow. congrats!
[5/26/2015 1:53:09 AM] Eve: That’s a long time
[5/26/2015 1:53:12 AM | Removed 1:53:15 AM] Dovid Magady: This message has been removed.
[5/26/2015 1:53:20 AM] Tylep the rotaerc: lol thnx ^^
[5/26/2015 1:53:25 AM] Tylep the rotaerc: The pay is almost worth it
[5/26/2015 1:53:33 AM] Tylep the rotaerc: just enough to keep me in this shitty trailer
[5/26/2015 1:53:58 AM] Eve: I live in a shitty apartment, you’re lucky
[5/26/2015 1:54:01 AM] Tylep the rotaerc: But hey, the place is back up in the woods away from most everyone so I am cool with it.
[5/26/2015 1:54:11 AM] Oceanstuck: hey tylep
[5/26/2015 1:54:13 AM] Oceanstuck: hey guys
[5/26/2015 1:54:14 AM] Tylep the rotaerc: yea?
[5/26/2015 1:54:15 AM] Dovid Magady: Isnt thaqt scary?
[5/26/2015 1:54:17 AM] Tylep the rotaerc: oh
[5/26/2015 1:54:17 AM] Tylep the rotaerc: lol
[5/26/2015 1:54:19 AM] Tylep the rotaerc: hai
[5/26/2015 1:54:41 AM] Oceanstuck: lol i was just popping in to really quickly check on everyone
[5/26/2015 1:54:44 AM] Tylep the rotaerc: I have been in these woods since I was born
[5/26/2015 1:54:47 AM] Tylep the rotaerc: so nah XD
[5/26/2015 1:54:49 AM] Oceanstuck: i actually need to go to sleep
[5/26/2015 1:54:55 AM] Oceanstuck: what is le haps
[5/26/2015 1:54:58 AM] Eve: we’re good ocean, :)
[5/26/2015 1:55:22 AM] Eve: you’re a country boy?
[5/26/2015 1:55:29 AM] Eve: I’ve always lived inthe city
[5/26/2015 1:55:30 AM] Tylep the rotaerc: lol I guess Xp
[5/26/2015 1:55:59 AM | Edited 1:56:21 AM] Tylep the rotaerc: I like to think I am none of the country stereo types, but I probably am and just don’t see it.
[5/26/2015 1:56:26 AM] Dovid Magady: You don’t seem like it to me
[5/26/2015 1:58:20 AM] Tylep the rotaerc: It is kind of lonely around here though ^^;
[5/26/2015 1:58:29 AM] Tylep the rotaerc: My grandparents used to live here with me
[5/26/2015 1:58:53 AM] Tylep the rotaerc: but not anymore, so the place can admittedly be a bit spooky.
[5/26/2015 1:58:57 AM] Eve: I live with my grama now
[5/26/2015 1:59:04 AM] Oceanstuck: me too
[5/26/2015 1:59:13 AM] Wolfcat: you live with eves grama?
[5/26/2015 1:59:41 AM] Eve: lol, wolf
[5/26/2015 2:00:26 AM] Oceanstuck: yes
[5/26/2015 2:00:50 AM | Edited 2:00:56 AM] Eve: Ever think about moving tyler?
[5/26/2015 2:03:18 AM] Tylep the rotaerc: I have thought about it but I kinda have sentimental value attached to this place.
[5/26/2015 2:03:50 AM] Tylep the rotaerc: That and moving would be really expensive
[5/26/2015 2:04:29 AM] Eve: yeah everything is so expensive nowadays
[5/26/2015 2:04:33 AM] Tylep the rotaerc: The land I am currently on is mine because I inhereted it from my grandparents, we have our own well so we got no water bill either.
[5/26/2015 2:04:42 AM] Tylep the rotaerc: This place is pretty cheap XD
[5/26/2015 2:04:46 AM] Eve: That’s really cool
[5/26/2015 2:05:31 AM] Oceanstuck: i wanna stick around but i really need to sleep so night guys
[5/26/2015 2:05:37 AM] Dovid Magady: Night, ocean
[5/26/2015 2:05:40 AM] Oceanstuck: see you around ty?
[5/26/2015 2:05:40 AM] Eve: Night ocean!
[5/26/2015 2:05:41 AM] Tylep the rotaerc: nighty night broskino ^^
[5/26/2015 2:05:47 AM] Oceanstuck: ^_^
[5/26/2015 2:05:51 AM] Tylep the rotaerc: Yeah I ought to be around more I wanna think
[5/26/2015 2:06:03 AM] Tylep the rotaerc: Don’t have much of anyoe else to talk to really ^^;
[5/26/2015 2:06:19 AM] Eve: There’s always someone on around here
[5/26/2015 2:06:34 AM] Eve: We got broskinos 24/7 :)
[5/26/2015 2:06:57 AM] Tylep the rotaerc: wooooooooooo XD
[5/26/2015 2:08:40 AM] Wolfcat: Pretty much all my friends are online now
[5/26/2015 2:08:52 AM] Wolfcat: I get hardly any interaction in person
[5/26/2015 2:09:01 AM] Wolfcat: #shutin
[5/26/2015 2:09:12 AM] Eve: yeah, me too.
[5/26/2015 2:09:29 AM] Eve: though i do go to taco bell on wed. nights with my ex-coworkers
[5/26/2015 2:09:41 AM] Eve: they’re cool, and funny
[5/26/2015 2:11:22 AM] Eve: So, Tyler, ever think about making more videos for youtube?
[5/26/2015 2:11:56 AM] Eve: You’re pretty funny :P
[5/26/2015 2:12:08 AM] Tylep the rotaerc: lol tnx XD
[5/26/2015 2:12:23 AM] Dovid Magady: Yeah, I liked them
[5/26/2015 2:13:30 AM] Tylep the rotaerc: I was thinking of maybe making a sort of memorial video for my broskinos before I do anything else
[5/26/2015 2:14:10 AM] Eve: That would be nice.
[5/26/2015 2:14:34 AM] Dovid Magady: That would seem good, as a memorial, yeah
[5/26/2015 2:15:33 AM] Eve: Thinking of making it soon?
[5/26/2015 2:15:56 AM] Tylep the rotaerc: I went by johns old house today on my way home from work actually
[5/26/2015 2:16:01 AM] Tylep the rotaerc: to get some pictures for it
[5/26/2015 2:16:45 AM] Tylep the rotaerc: I was thinking of going by kevins house but it is a bit farther away so maybe tomorrow.
[5/26/2015 2:18:55 AM] Tylep the rotaerc: I’d go by where jacob lived but that is on the other end of the state ^^;
[5/26/2015 2:19:14 AM] Eve: That’s the guy is the first video, right?
[5/26/2015 2:19:19 AM] Tylep the rotaerc: I know I have some old pics of him though somewhere on an old usb so that should be good to find.
[5/26/2015 2:19:21 AM] Tylep the rotaerc: lol yeah
[5/26/2015 2:20:09 AM] Eve: You live in a big state?
[5/26/2015 2:20:23 AM] Eve: I’m in NJ, you can drive from one end to the other in like 2 hrs
[5/26/2015 2:20:29 AM] Eve: lol
[5/26/2015 2:20:45 AM] Tylep the rotaerc: >.>
[5/26/2015 2:20:48 AM] Tylep the rotaerc: <. am tylep the rotaerc: i live in florida="p" eve: woah yeah big lol never been to but heard it nice parts wolfcat: need head out for now. night all wolf..... dovid magady: allright wolf edited isn t like really hot and humid flroida or do you get used well if make that memorial video love see friends seemed cool. stevey heister freeman: are cool eve needs be added quotes of da year they were coolest broskinos knew hold on a sec brb k :p : soon was actually about plug my phone show guys something oh ok sounds uosl yo hey there zack hai whats up apparently didnt know who an hour ago not much just checking what he then why ask could quote exact words think misunderstood me bach tyler hello again your message with comman ...comma nevermind huh weird would why. thought took more than this since john ... curious question has anyone borrowed recently figure is kind business as well. cell almost always right next so nah. captain desdinova: returned from being here however house acting yesterday morning now reminded paid bill can dial tone="[" have tried calling sorry makes no sense won work="[" sucks ever woke by ringing before look maybe tower working area stopped may made laugh should circle oddly enough caller id fuked too its also pretty old kinda expect time areamaybe yea thingy gonna rotaerc fuck happened moved accident guess right.... thats left wow. god..... some wood looks burnt.. fire wireing hear .. wow.. man hope okay.. or...was okay his family told didn sadly home when mother country father trip sorry.. mean bring bad memories. fine hard pass every day coming gotten awful... don pry friend kevin around anymore sure relating him at one disapeared strange went once long back after hearing few months place looked ran sacked had else go hoping idk gone someone lost person disappeared haven talked her years she sort abandoned how feels awful we start over sometimes break looking these pictures reported missing later nothing cops couldn find anything police very helpful internet detectives help. tbh only amatuers hate negative mystery any leads said tomorrow clues. planing going last door hanging wide open normal little did seem take inside help want it. broken into hmmm still them totally wrecked thanks. twizzlers mess... sprikiroid: reminds marble hornets entry which found where goes encounters masky first forgot does note say real spook di-dion... rest word says enjoy di-di called nope aok checking. mh alex sleeping couch notes wall move slightly chills honest entries scared stop watching. those things there. im fraidy cat good closer picture line careful. many totheark videos pictureeven better yee dont part slenderman cough blood attacked creepy guy suit then. ha aw arg anyways got sound demanding lot pics anyway another pic today aggrivated though spraypainted kok rite large image shitty iphone less min minute noticed something. theres typed tape shit god seven sun drop bought way flapping wind everything regarding cross.. broke law noooo xd englnad already while investigation ended come seriously though. iu pissed enforcement hardly avoid it.. funeral even buried wow best highschool fam least cut contact aww well.. cant give atleast.. us will bottom new friendo asked property none business. further notice. spent other nights early ok. talk freinds ppl remember call papa johns abruptly leave because late group church. wasn religion imagine assume church goers="p" regards argument christian reacted rather strongly stupid youth subject hmm groups same. cause militant athiest fun debates thinking world religious concepts try recruit secretive opposite wanted quit asking met members .......kevin member sounded breifly described exactly spooky might exist dropped saying effect magic fucking doing wanna magics lemme in. please tell jacob barely mentioned regular dude conversation fight sad date october bullshit bit heading pizza finally job full oughta able own busy gotta go. again. man. damn number random unfamilliar voice meaning probably rid service spoken parents jacobs quite adventure let goes. invested bro exaclty life drudge memories mind our questions either sitting chatting leave. wish luck walk home. right. walking super spoops spoop myself shouldn done rip mainly hood hi hay broskino missed stuff fill later. scroll deal peeps scary lots drugs town fuk ur stalk>.>;
[5/26/2015 4:10:08 AM] Tylep the rotaerc: spoky
[5/26/2015 4:10:09 AM] Eve: LOL, NAH
[5/26/2015 4:10:20 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Nah, we’re all to lazy to stalk people
[5/26/2015 4:10:22 AM] Eve: I work to much to stalk
[5/26/2015 4:10:35 AM] Tylep the rotaerc: How did you know my county so fast though
[5/26/2015 4:10:39 AM] Tylep the rotaerc: woah
[5/26/2015 4:10:40 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Maybe mugen would, but that’s just cuz he’s a creep tho
[5/26/2015 4:11:44 AM] Dovid Magady: http://www.eonline.com/news/658122/everyone-s-worst-nightmare-has-come-true-it-s-literally-raining-spiders-in-australia on a lghter note, AAAAAAAAAAAAHHHHHHHHHH!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
[5/26/2015 4:12:03 AM] Eve: I have a map of the us on my wall in my office
[5/26/2015 4:12:12 AM] Eve: I have to call missionaries
[5/26/2015 4:12:24 AM] Eve: a lot of them are located in florida
[5/26/2015 4:12:48 AM] Dovid Magady: Florida is the state where like every messed up story ever has happned.
[5/26/2015 4:12:53 AM] Dovid Magady: At least haf of them
[5/26/2015 4:13:21 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: wait its LITERALLY RAINING SPIDERS IN AUSTRALIA
[5/26/2015 4:13:24 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: WHAT THE FUCK?
[5/26/2015 4:13:25 AM] Dovid Magady: YEP
[5/26/2015 4:13:28 AM] Dovid Magady: I KNOW, RIGHT
[5/26/2015 4:13:32 AM] Dovid Magady: AHHHH
[5/26/2015 4:13:58 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ;-;
[5/26/2015 4:14:04 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: why is Australia even a thing
[5/26/2015 4:14:04 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: like
[5/26/2015 4:14:07 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: why
[5/26/2015 4:14:18 AM] Captain “CircleHunter” Desdinova: i’m in the mood for pizza
[5/26/2015 4:14:27 AM] Dovid Magady: Australia- the only thing that wont kill you is old age
[5/26/2015 4:14:30 AM] Captain “CircleHunter” Desdinova: but it’s 4 in the morning
[5/26/2015 4:14:40 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Circ same, but its 1. and my mom is asleep
[5/26/2015 4:14:41 AM] Dovid Magady: Wow. random craving
[5/26/2015 4:14:50 AM] Tylep the rotaerc: [Tuesday, May 26, 2015 4:14 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: </.>id
[5/26/2015 4:32:58 AM] Stevey “Proest Heister 2015” Freeman: > ID
[5/26/2015 4:33:10 AM] Stevey “Proest Heister 2015” Freeman: you missed your chance eve
[5/26/2015 4:33:11 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[5/26/2015 4:33:12 AM] Captain “CircleHunter” Desdinova: pff
[5/26/2015 4:33:13 AM] Stevey “Proest Heister 2015” Freeman: you fucked up
[5/26/2015 4:33:32 AM] Eve: Yes stevey, ID'mire him
[5/26/2015 4:33:37 AM] Stevey “Proest Heister 2015” Freeman: GOOD
[5/26/2015 4:33:40 AM] Stevey “Proest Heister 2015” Freeman: I am now pleased
[5/26/2015 4:33:47 AM] Tylep the rotaerc: Woah
[5/26/2015 4:33:56 AM] Tylep the rotaerc: sounds like a spooky chooky broskino
[5/26/2015 4:33:59 AM] Tylep the rotaerc: but coolio tho
[5/26/2015 4:34:02 AM] Stevey “Proest Heister 2015” Freeman: …..he is erm
[5/26/2015 4:34:05 AM] Stevey “Proest Heister 2015” Freeman: not a broskino
[5/26/2015 4:34:08 AM] Eve: He’s great stevey
[5/26/2015 4:34:11 AM] Eve: great
[5/26/2015 4:34:11 AM] Tylep the rotaerc: Aw
[5/26/2015 4:34:13 AM] Tylep the rotaerc: oh
[5/26/2015 4:34:13 AM] Captain “CircleHunter” Desdinova: lol
[5/26/2015 4:34:14 AM] Tylep the rotaerc: wut
[5/26/2015 4:34:17 AM] Tylep the rotaerc: Im confused
[5/26/2015 4:34:17 AM] Stevey “Proest Heister 2015” Freeman: ignore eve.. she’s infaturated…
[5/26/2015 4:34:23 AM] Tylep the rotaerc: Do I not like this guy or do I
[5/26/2015 4:34:24 AM] Tylep the rotaerc: uhh
[5/26/2015 4:34:25 AM] Tylep the rotaerc: fug
[5/26/2015 4:34:27 AM] Stevey “Proest Heister 2015” Freeman: YOU DO NOT
[5/26/2015 4:34:29 AM] Stevey “Proest Heister 2015” Freeman: I AM IN YOUR MIND
[5/26/2015 4:34:29 AM] Tylep the rotaerc: ok
[5/26/2015 4:34:32 AM] Tylep the rotaerc: Yay
[5/26/2015 4:34:34 AM] Tylep the rotaerc: cool
[5/26/2015 4:34:37 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: potato
[5/26/2015 4:34:40 AM] Tylep the rotaerc: yes
[5/26/2015 4:34:54 AM] Eve: Thorin
[5/26/2015 4:35:12 AM] Eve: Patrem has ALL the Chocolate Milk
[5/26/2015 4:35:26 AM] Tylep the rotaerc: WO
[5/26/2015 4:35:28 AM] Tylep the rotaerc: I love this guy
[5/26/2015 4:35:28 AM | Edited 4:35:30 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: GIMME
[5/26/2015 4:35:50 AM] Eve: He also Lurks between Worlds (heart)
[5/26/2015 4:35:55 AM] Tylep the rotaerc: Wo
[5/26/2015 4:36:00 AM] Tylep the rotaerc: sounds lovecraftian
[5/26/2015 4:38:12 AM] Eve: I jest :P
[5/26/2015 4:38:17 AM] Eve: I like to spooks
[5/26/2015 4:38:31 AM] Captain “CircleHunter” Desdinova: GREAT OLD ONE
[5/26/2015 4:38:35 AM] Captain “CircleHunter” Desdinova: FORBIDDEN SIGHT
[5/26/2015 4:38:41 AM] Captain “CircleHunter” Desdinova: HE SEARCHES
[5/26/2015 4:38:49 AM] Captain “CircleHunter” Desdinova: HUNTER OF THE SHADOWS IS RIIIIIIIIIIISIIIIIIIIIIIIIING
[5/26/2015 4:38:59 AM] Captain “CircleHunter” Desdinova: IMMOOOOORTAAAAAAAAAAL
[5/26/2015 4:39:10 AM] Captain “CircleHunter” Desdinova: IN MAAAAAAAADNEEEEEEEEEEESS YOOOOOOU DWELLLLLLLLLLLLL
[5/26/2015 4:41:17 AM] Captain “CircleHunter” Desdinova: sorry did the power of metallica kill everyone
[5/26/2015 4:41:29 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: no
[5/26/2015 4:42:44 AM] Eve: Fade to black is my fav metallica song
[5/26/2015 4:42:49 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh great, I bit my lip and now theres a bump on it from it swelling a bit
[5/26/2015 4:42:59 AM] Captain “CircleHunter” Desdinova: i can play most of that actually
[5/26/2015 4:43:07 AM] Captain “CircleHunter” Desdinova: i can’t solo though
[5/26/2015 4:43:31 AM] Eve: the intro is so beautiful
[5/26/2015 4:43:38 AM] Eve: you should play it for me one day
[5/26/2015 4:44:25 AM] Captain “CircleHunter” Desdinova: i dont even know what my favorite metallica song is
[5/26/2015 4:44:30 AM] Captain “CircleHunter” Desdinova: they’re just great
[5/26/2015 4:44:59 AM] Eve: I think we wore out tyler :P
[5/26/2015 4:45:13 AM] Eve: he’s probably morgan snoring
[5/26/2015 4:45:17 AM] Captain “CircleHunter” Desdinova: lol
[5/26/2015 4:45:24 AM] Captain “CircleHunter” Desdinova: then we probably shouldn’t have done that
[5/26/2015 4:45:24 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[5/26/2015 4:45:34 AM] Eve: BUT WE DID!
[5/26/2015 4:48:19 AM] Eve: We should start a band
[5/26/2015 4:48:41 AM] Eve: Circle on the guitar
[5/26/2015 4:48:49 AM] Eve: I can play piano
[5/26/2015 4:49:00 AM | Edited 4:49:12 AM] Eve: Thorin, you play any instruments?
[5/26/2015 4:49:06 AM] Dovid Magady: Im heading out for the night
[5/26/2015 4:49:07 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i can make ear bleeding sounds on a recorder (the flute shit)
[5/26/2015 4:49:21 AM] Eve: night dovid
[5/26/2015 4:49:28 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Cya dov!
[5/26/2015 4:49:41 AM] Dovid Magady: C you all tomorrow night!
[5/26/2015 4:49:57 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I kinda want to learn to play a banjo or ukulele
[5/26/2015 4:50:02 AM] Eve: All we need is a kick ass singer…..
[5/26/2015 4:50:10 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hmmm
[5/26/2015 4:50:26 AM] Tylep the rotaerc: woah fuck sorry guys I fell asleep at the keyboard
[5/26/2015 4:50:26 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Tyler, can you sing?
[5/26/2015 4:50:30 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh lol
[5/26/2015 4:50:36 AM] Eve: lol, it’s ok tyler
[5/26/2015 4:50:43 AM | Edited 4:51:02 AM] Eve: we’re gonna start a band
[5/26/2015 4:50:46 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: We could get dawn to sing maybe?
[5/26/2015 4:51:01 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: idk
[5/26/2015 4:51:04 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i cant sing for shit
[5/26/2015 4:52:27 AM] Eve: Well, Tyler if you’re gonna head off for the night, take it easy
[5/26/2015 4:52:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Yeah
[5/26/2015 4:52:58 AM] Tylep the rotaerc: Woah weird
[5/26/2015 4:53:00 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ?
[5/26/2015 4:53:01 AM] Eve: what?
[5/26/2015 4:53:03 AM] Tylep the rotaerc: I am kinda spooked now ^^;
[5/26/2015 4:53:07 AM] Eve: why?
[5/26/2015 4:53:19 AM] Tylep the rotaerc: I remembered closing both the doors to my room
[5/26/2015 4:53:25 AM] Tylep the rotaerc: they are now both wide open
[5/26/2015 4:53:35 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Huh
[5/26/2015 4:53:38 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: that’s a bit spooky
[5/26/2015 4:54:00 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Got roommates or something that could have done it?
[5/26/2015 4:54:11 AM] Tylep the rotaerc: Nope
[5/26/2015 4:54:17 AM] Tylep the rotaerc: I live alone
[5/26/2015 4:54:22 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Well. that’s creepy
[5/26/2015 4:54:38 AM] Tylep the rotaerc: Maybe I didn’t close them good enough ^^;
[5/26/2015 4:54:45 AM] Tylep the rotaerc: Thats probably it
[5/26/2015 4:54:46 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[5/26/2015 4:54:50 AM] Eve: Maybe thats it
[5/26/2015 4:55:02 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hopefully
[5/26/2015 4:55:22 AM] Eve: Tyler
[5/26/2015 4:55:29 AM] Eve: try closing the doors
[5/26/2015 4:56:45 AM] Tylep the rotaerc: Alrighty brb =p
[5/26/2015 4:59:04 AM] Tylep the rotaerc: I didn’t notice before
[5/26/2015 4:59:14 AM] Eve: notice what?
[5/26/2015 4:59:21 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ?
[5/26/2015 4:59:33 AM] Tylep the rotaerc: but it looks like the door handle peice thingies are messing up
[5/26/2015 4:59:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh man, that sucks
[5/26/2015 4:59:52 AM] Tylep the rotaerc: the things that catch the little peice that come out of the door knob
[5/26/2015 4:59:56 AM] Tylep the rotaerc: idk what they are called
[5/26/2015 5:00:06 AM] Tylep the rotaerc: but it should stay closed now
[5/26/2015 5:00:10 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: k
[5/26/2015 5:00:15 AM] Tylep the rotaerc: Id fix them myself but
[5/26/2015 5:00:29 AM] Stevey “Bastard Of Winterfell” Freeman: my living room door does that if we slam it close too hard
[5/26/2015 5:00:36 AM] Tylep the rotaerc: WHOLLY MOLLY IS IT LATE INTO NIGHTTIME
[5/26/2015 5:00:46 AM] Stevey “Bastard Of Winterfell” Freeman: YES
[5/26/2015 5:00:52 AM] Stevey “Bastard Of Winterfell” Freeman: GET SOME SLEEP NOW YOUNG… OLD… MAN?
[5/26/2015 5:00:58 AM] Tylep the rotaerc: and I should probs sleep XD
[5/26/2015 5:01:03 AM] Tylep the rotaerc: I feel old XD
[5/26/2015 5:01:08 AM] Captain “CircleHunter” Desdinova: wait yeah how old even are you
[5/26/2015 5:01:20 AM] Stevey “Bastard Of Winterfell” Freeman: 60
[5/26/2015 5:01:33 AM] Captain “CircleHunter” Desdinova: i thought you were like 20 but your skype says 30
[5/26/2015 5:01:49 AM] Stevey “Bastard Of Winterfell” Freeman: WOW CIRCLE. you cant just ASK someone how old they are
[5/26/2015 5:01:55 AM] Stevey “Bastard Of Winterfell” Freeman: r000d with a capital R
[5/26/2015 5:01:59 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[5/26/2015 5:02:01 AM] Stevey “Bastard Of Winterfell” Freeman: even though mine doesnt have a capital R
[5/26/2015 5:02:02 AM] Stevey “Bastard Of Winterfell” Freeman: … fuck you
[5/26/2015 5:02:21 AM] Tylep the rotaerc: lol my skype age is fake XD
[5/26/2015 5:02:21 AM] Captain “CircleHunter” Desdinova: pff
[5/26/2015 5:02:51 AM] Tylep the rotaerc: I am actually 25 though
[5/26/2015 5:02:58 AM] Tylep the rotaerc: bout to be 26
[5/26/2015 5:03:00 AM] Stevey “Bastard Of Winterfell” Freeman: circle, did you get “pff” from ocean? I know she uses it alot and havent seen you use that untill lately
[5/26/2015 5:03:11 AM] Stevey “Bastard Of Winterfell” Freeman: Ooooh, come celebrate your birthday with us!
[5/26/2015 5:03:14 AM] Eve: and I should probs sleep XDHave a great night
[5/26/2015 5:03:17 AM] Captain “CircleHunter” Desdinova: nah man i’ve been using that for a long time
[5/26/2015 5:03:23 AM] Eve: or morning
[5/26/2015 5:03:25 AM] Eve: lol
[5/26/2015 5:03:39 AM] Tylep the rotaerc: its like 5 am right now DX
[5/26/2015 5:03:39 AM] Eve: make sure those doors are cloosed as best you can, don’t want teh spooks
[5/26/2015 5:03:44 AM] Tylep the rotaerc: so yeah actually mornin
[5/26/2015 5:03:50 AM] Tylep the rotaerc: fuk spooks
[5/26/2015 5:03:53 AM] Eve: yeah I’m eastcoast too :P
[5/26/2015 5:03:56 AM] Tylep the rotaerc: Im too tired for dat shit
[5/26/2015 5:03:57 AM] Stevey “Bastard Of Winterfell” Freeman: then that is what is called “morning” not “night” #problemsofanightowl
[5/26/2015 5:04:24 AM] Captain “CircleHunter” Desdinova: set up cameras at night
[5/26/2015 5:04:30 AM] Captain “CircleHunter” Desdinova: record spook
[5/26/2015 5:04:37 AM] Captain “CircleHunter” Desdinova: catch slender man on video
[5/26/2015 5:04:59 AM | Edited 5:05:03 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: catch freddy spookbear on cam15
[5/26/2015 5:05:21 AM] Eve: lol, guys, don’t spook him anymore than he already is :P
[5/26/2015 5:05:42 AM] Tylep the rotaerc: #spookedtillheischook
[5/26/2015 5:05:53 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol sorry
[5/26/2015 5:05:58 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: just fuckin around for a bit
[5/26/2015 5:06:45 AM] Stevey “Bastard Of Winterfell” Freeman: anyway
[5/26/2015 5:06:50 AM] Stevey “Bastard Of Winterfell” Freeman: you probably should get some sleep, young man
[5/26/2015 5:06:51 AM] Stevey “Bastard Of Winterfell” Freeman: so sleep
[5/26/2015 5:06:59 AM] Stevey “Bastard Of Winterfell” Freeman: GOODNIGHT TYLER. NO DISAGREEMENTS YOUNG MAN
[5/26/2015 5:07:05 AM] Stevey “Bastard Of Winterfell” Freeman: Or no supper tomorrow
[5/26/2015 5:07:16 AM | Removed 5:07:19 AM] Stevey “Bastard Of Winterfell” Freeman: This message has been removed.
[5/26/2015 5:08:39 AM] Eve: Pray to Patrem, he’ll keep you safe
[5/26/2015 5:08:43 AM] Eve: :P
[5/26/2015 5:09:46 AM] Captain “CircleHunter” Desdinova: or give you a spookjob
[5/26/2015 5:11:49 AM] Eve: Guess he’s gone :(
[5/26/2015 5:12:10 AM] Tylep the rotaerc: lol sorry started falling asleep again XD
[5/26/2015 5:12:12 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: or not
[5/26/2015 5:12:13 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[5/26/2015 5:12:21 AM] Tylep the rotaerc: Ok Im heading off to bed now ^^;
[5/26/2015 5:12:27 AM] Tylep the rotaerc: nighty nacht broskinos
Chat with Tyler 5/27/15
Read chat below:
[5/26/2015 11:59:10 PM] Tylep the rotaerc: Hey broskinos
[5/26/2015 11:59:13 PM] Captain “CircleHunter” Desdinova: Hi tylep
[5/26/2015 11:59:17 PM] Tylep the rotaerc: is all well?
[5/26/2015 11:59:23 PM] Eve: Meh
[5/26/2015 11:59:24 PM] Captain “CircleHunter” Desdinova: Is aight
[5/26/2015 11:59:24 PM] uoslǝN ʞɔɐZ: Heya tylep
[5/26/2015 11:59:31 PM] Oceanstuck: its…ok i guess?
[5/26/2015 11:59:37 PM] Tylep the rotaerc: hello friend ^^
[5/26/2015 11:59:49 PM] Captain “CircleHunter” Desdinova: Ocean, I’m just going to answer my own question since you can’t apparently
[5/26/2015 11:59:58 PM] Oceanstuck: i was about to answer
[12:00:07 AM] Oceanstuck: but then tylep showed up and i lost it
[12:00:17 AM] Captain “CircleHunter” Desdinova: It’s been lik 15 minutes
[12:00:49 AM] Captain “CircleHunter” Desdinova: So what’s up tyler?
[12:01:14 AM] Kaizell, Seeker Of Wisdom (K♦): Ohai Tyler
[12:01:15 AM] Oceanstuck: i take a really long time to find a decent-quality answer
[12:01:54 AM] Captain “CircleHunter” Desdinova: I’m sorry to say this, I really am, but I know you can’t think of any way to dispute my point
[12:01:58 AM] Tylep the rotaerc: I had a really uncomfortable day today ^^;
[12:02:06 AM] Oceanstuck: circle im not done
[12:02:13 AM | Edited 12:02:45 AM] Kaizell, Seeker Of Wisdom (K♦): @Tyler
Oh?
[12:02:15 AM] Oceanstuck: ffffuck
[12:02:20 AM] Captain “CircleHunter” Desdinova: You can’t
[12:02:21 AM] Oceanstuck: im taking it to drama room
[12:02:27 AM] Captain “CircleHunter” Desdinova: aight go ahead
[12:03:10 AM] Kaizell, Seeker Of Wisdom (K♦): What happened Tyler?
[12:03:44 AM] Tylep the rotaerc: Well I woke up really late for some reason
[12:03:54 AM] Tylep the rotaerc: like around 6pm
[12:04:07 AM] Tylep the rotaerc: and the power was out and the house was REALLY hot
[12:04:08 AM] Eve: You were up late with us, sorry
[12:04:30 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: why was your house hot?
[12:04:38 AM] Tylep the rotaerc: no ac cause no powah ^^;
[12:04:46 AM] Tylep the rotaerc: and Im in florida
[12:04:49 AM] Tylep the rotaerc: but damn
[12:04:57 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ah.
[12:05:03 AM] Tylep the rotaerc: the temp difference between inside and outside my house was crazy
[12:05:16 AM] Tylep the rotaerc: a bit cool when I stepped outside
[12:05:19 AM] Tylep the rotaerc: a bit rainy too
[12:05:22 AM] Eve: Hotter inside?
[12:05:28 AM] Tylep the rotaerc: but DAMN was it burning inside ^^;
[12:05:37 AM] kidpichu: like ocean I like you X3
[12:05:45 AM] Eve: Tyler, were your bedroom doors open?
[12:05:57 AM] Tylep the rotaerc: actually nope
[12:06:02 AM] Eve: Good
[12:06:17 AM] Eve: That spooked me last night
[12:06:20 AM] Tylep the rotaerc: strangely enough though I had a hard time getting them open at first when I awoke
[12:06:28 AM] kidpichu: e-e but I dunno it feels so weird when you say that
[12:06:31 AM] Kaizell, Seeker Of Wisdom (K♦): Weird
[12:06:50 AM] Tylep the rotaerc: which was weird cause last night they seemed broke in a way that would imply they were just gonna be swinging open easily for a while
[12:06:54 AM] Tylep the rotaerc: spoopy ^^;
[12:07:00 AM] Oceanstuck: very spoopy
[12:07:06 AM | Edited 12:07:11 AM] Kaizell, Seeker Of Wisdom (K♦): No comment
[12:08:08 AM] Tylep the rotaerc: I decided since the power was out I would use the phone battery I had to go try and take pictures of kevins house like I said I would do yesterday
[12:08:52 AM] Tylep the rotaerc: It started getting dark pretty quickly
[12:09:24 AM] Tylep the rotaerc: and the town was pretty empty around like 9 when I started my trek
[12:09:47 AM] Tylep the rotaerc: I only made it about half way there before turning back
[12:10:26 AM] Kaizell, Seeker Of Wisdom (K♦): Uh, OK? (:| :| :^)
[12:11:04 AM] *** kidpichu added Gabriel Leonardo ***
[12:11:21 AM] Stevey “Bastard Of Winterfell” Freeman: what does that have to do with anything, mugen?
[12:11:38 AM] Tylep the rotaerc: I saw a really really weird man
[12:11:44 AM] Kaizell, Seeker Of Wisdom (K♦): You expect me to know?
[12:11:46 AM] Kaizell, Seeker Of Wisdom (K♦): Oh hey
[12:12:02 AM] Oceanstuck: [12:10 AM] Kaizell, Seeker Of Wisdom (K♦):
<<< Uh, OK? (:| :| :^)[12:11 AM] Stevey “Bastard Of Winterfell” Freeman:
<<< what does that have to do with anything, mugen?im not seeing how the latter follows from the former
[12:12:09 AM] Kaizell, Seeker Of Wisdom (K♦): What do you remember about the Weird Man?
[12:12:31 AM] Tylep the rotaerc: I saw him in the distance at first while I was coming up to the town library
[12:12:36 AM] Kaizell, Seeker Of Wisdom (K♦): Curly hair? Accordion? (smirk)
[12:12:46 AM] *** Oceanstuck misses the reference ***
[12:12:51 AM] Stevey “Bastard Of Winterfell” Freeman: the fuck are you talking about ocean?
[12:12:53 AM] Stevey “Bastard Of Winterfell” Freeman: it’s a question
[12:12:59 AM] Kaizell, Seeker Of Wisdom (K♦): Later, Ocean.
[12:13:02 AM] Stevey “Bastard Of Winterfell” Freeman: of course it follows, cause I’m asking how it relates..
[12:13:15 AM] Kaizell, Seeker Of Wisdom (K♦): Later, Steve
[12:13:36 AM] kidpichu: by mugi
[12:13:44 AM] kidpichu: smell ya later bro
[12:13:48 AM] Kaizell, Seeker Of Wisdom (K♦): Not what I mean, Pichu
[12:13:51 AM] kidpichu: ooohhh
[12:13:53 AM] kidpichu: XD
[12:14:08 AM] Kaizell, Seeker Of Wisdom (K♦): Anyway Tyler what did the guy look like?
[12:14:11 AM] Tylep the rotaerc: He was just kind of moving left and right far off in the distance
[12:14:16 AM] Tylep the rotaerc: and I couldn’t really make him out
[12:14:35 AM] Kaizell, Seeker Of Wisdom (K♦): Didn’t get close enough?
[12:14:42 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Moogs
[12:14:46 AM] Captain “CircleHunter” Desdinova: i wouldn’t even want to
[12:14:52 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: why would he go up to the creepy guy moving left and right
[12:14:56 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: like
[12:14:58 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: seriously
[12:14:59 AM] Kaizell, Seeker Of Wisdom (K♦): Hey you never know
[12:15:04 AM] Kaizell, Seeker Of Wisdom (K♦): Might be worth it
[12:15:10 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: (facepalm)
[12:15:16 AM] Kaizell, Seeker Of Wisdom (K♦): Kickstarted my career
[12:15:24 AM] Tylep the rotaerc: he seemed pretty tall and I guess he was in all black because I could barely make him out in the dim bit of nighttime light
[12:15:36 AM] Kaizell, Seeker Of Wisdom (K♦): Uh oh
[12:16:01 AM] Kaizell, Seeker Of Wisdom (K♦): Suddenly sounding like keeping distance was a good call
[12:16:51 AM] Tylep the rotaerc: I really had no choice but to go closer seeing as he was on the path I was on
[12:17:11 AM] Grey: ey wat up
[12:17:14 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: hey grey
[12:17:17 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Met tyler yet?
[12:17:19 AM] Kaizell, Seeker Of Wisdom (K♦): … Thought you said you didn’t do that
[12:17:33 AM] Grey: huh?
[12:17:38 AM] Tylep the rotaerc: He seemed kind of weird just leaning around and going left and right but I figured, fuck it probs just one of the drugged up people in my not so good hood.
[12:17:40 AM] Grey: oh hello
[12:17:45 AM] Kaizell, Seeker Of Wisdom (K♦): We got a newcomer, Grey
[12:17:48 AM] Tylep the rotaerc: hai broskino
[12:18:11 AM] Kaizell, Seeker Of Wisdom (K♦): Seems he was friends with John
[12:18:44 AM] kidpichu: tylep was it the good kind?
[12:18:48 AM] Kaizell, Seeker Of Wisdom (K♦): So anyway Tyler you say you didn’t get a good look at him?
[12:18:52 AM] Kaizell, Seeker Of Wisdom (K♦): Gah
[12:18:54 AM] Kaizell, Seeker Of Wisdom (K♦): Pichu
[12:18:55 AM] kidpichu: I know the difference
[12:19:08 AM] kidpichu: i’m not sorry
[12:19:12 AM] *** kidpichu aways ***
[12:19:30 AM] Eve: What happened next Tyler?
[12:19:30 AM] Tylep the rotaerc: I didn’t want to upset the guy by making him think I was staring (cause I was a lot)
[12:19:51 AM] Tylep the rotaerc: So I just looked down at my phone and pretended I didn’t notice him
[12:20:16 AM] Eve: Hmm
[12:20:24 AM] Tylep the rotaerc: and kept walking
[12:20:30 AM] Eve: Did you walk past him?
[12:20:32 AM] Tylep the rotaerc: hoping I could just pass by him
[12:20:46 AM] Tylep the rotaerc: I looked up for a moment as I got next to the library
[12:21:00 AM] Tylep the rotaerc: where he was moving around at
[12:21:12 AM] Tylep the rotaerc: and realized he had disapeared
[12:21:23 AM] Kaizell, Seeker Of Wisdom (K♦): And as a result you didn’t get a good look at him, meaning he might still not be who he could have been
[12:21:54 AM] Tylep the rotaerc: But I got some pictures and a short video of him
[12:22:00 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh cool
[12:22:06 AM] Eve: Perfect.
[12:22:08 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Mind if we see em?
[12:22:17 AM] Tylep the rotaerc: I am putting it together right now
[12:22:20 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Cool
[12:22:21 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: :D
[12:22:35 AM] Tylep the rotaerc: I began filming and taking pics as fast as I could
[12:22:45 AM] Tylep the rotaerc: because I realized something as I looked up
[12:22:46 AM] Eve: In case he does something weird, you can show it to authority.
[12:22:59 AM] Eve: Some ppl, ya know
[12:23:14 AM] Tylep the rotaerc: I looked at the library
[12:23:22 AM] Tylep the rotaerc: and the lights were now on
[12:23:38 AM] Tylep the rotaerc: at around 9:30 at night
[12:23:48 AM] Tylep the rotaerc: and he was standing inside the library
[12:24:27 AM] Kaizell, Seeker Of Wisdom (K♦): Was he doing anything else?
[12:24:39 AM] Tylep the rotaerc: he was just standing there
[12:24:42 AM] Tylep the rotaerc: perfectly still
[12:24:58 AM] Kaizell, Seeker Of Wisdom (K♦): Did his head tilt any?
[12:25:04 AM] Tylep the rotaerc: it felt unnatural how unmoving he was in that moment
[12:25:19 AM] Tylep the rotaerc: I felt a bit unerved
[12:25:26 AM] Tylep the rotaerc: so I decided to sprint back home
[12:25:48 AM] Tylep the rotaerc: as I was attempting to take the pictures and video
[12:25:57 AM] Tylep the rotaerc: the lights in the library shut back off
[12:26:25 AM] Kaizell, Seeker Of Wisdom (K♦): Damn, could it really be him? What’s he even doing here?
[12:26:42 AM] Tylep the rotaerc: uhhh who?
[12:27:07 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Moogs
[12:27:13 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: don’t scare the new guy with random stuff m8
[12:28:01 AM] Tylep the rotaerc: him implying you know who this guy is
[12:28:07 AM] Eve: Lol, no
[12:28:16 AM] Tylep the rotaerc: Tbh I am kind of angry now
[12:28:19 AM] kidpichu: mugi thinks he knows everyone like at the club
[12:28:22 AM] Kaizell, Seeker Of Wisdom (K♦): Guy I ran into a while back. I do know he was doing something in FL, but I doubt it’s relevant.
[12:28:25 AM] Eve: Moogen has a dumb sense of humor
[12:28:28 AM] Tylep the rotaerc: Because I feel like this guy knows where I live now or something
[12:28:39 AM] Tylep the rotaerc: Because I found this paper when I came home
[12:28:47 AM] Kaizell, Seeker Of Wisdom (K♦): What was on it?
[12:29:04 AM] kidpichu: tylep peper spray is you’re friend
[12:29:16 AM] Wolfcat: holy pepper spray
[12:29:28 AM] kidpichu: my dad said to get some i’ll give you some
[12:29:46 AM] kidpichu: but my dad has a tazer too so you’d think he’d give me that
[12:29:47 AM] Tylep the rotaerc: I don’t like this shit
[12:30:11 AM | Edited 12:30:16 AM] Kaizell, Seeker Of Wisdom (K♦): I’d be worried if you did
[12:30:23 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: wait what was on the paper?
[12:30:28 AM] Kaizell, Seeker Of Wisdom (K♦): ^
[12:30:29 AM] Tylep the rotaerc: It was just this crumpled up peice of parchment paper under a rock on my door step
[12:30:35 AM] Tylep the rotaerc: it had all this moon shit on it
[12:30:38 AM] kidpichu: he’s a security guard last I checked
[12:30:40 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: also moogs stahp creepin tyler, you don’t know the guy
[12:30:50 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: it was probably just some crazy homeless guy
[12:30:50 AM] Kaizell, Seeker Of Wisdom (K♦): Can we get a picture of the paper?
[12:30:55 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: my dad used to be one of them
[12:31:07 AM] Kaizell, Seeker Of Wisdom (K♦): Thorin I wanna believe that.
[12:31:13 AM] Tylep the rotaerc: and a weird symbol on the back with the word “WATCHING” on it
[12:31:22 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: woah
[12:31:25 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: that’s sp00ky
[12:31:31 AM] Kaizell, Seeker Of Wisdom (K♦): welp
[12:31:47 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: moogs why did you change your name
[12:31:53 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i keep thinkin you’re seeker
[12:31:55 AM] Tylep the rotaerc: I am on the ropes about the police at the moment because they have such a fucking shitty track record
[12:32:02 AM] Tylep the rotaerc: but I have no one else to turn to
[12:32:11 AM] kidpichu: i had a mental dude on my street who would take empty bottles and leave full bottles of windex
[12:32:37 AM] Kaizell, Seeker Of Wisdom (K♦): Hey Tyler? Can we get a picture of this paper?
[12:32:38 AM] Wolfcat: Maybe get one of those security lights that flicks on when it detects motion? Or set up a camera at night?
[12:32:41 AM] kidpichu: e-e" in my yard
[12:32:43 AM] Wolfcat: Just in case
[12:33:00 AM] kidpichu: oh camera lights are good we have those here
[12:33:11 AM] kidpichu: lights not the camera
[12:33:22 AM] Kaizell, Seeker Of Wisdom (K♦): What about the action?
[12:33:29 AM] Wolfcat: boo
[12:33:36 AM] kidpichu: boo
[12:33:55 AM] Kaizell, Seeker Of Wisdom (K♦): But no seriously, picture of the paper?
[12:34:02 AM] Kaizell, Seeker Of Wisdom (K♦): Might have clues on it
[12:34:20 AM | Removed 12:34:22 AM] Wolfcat: This message has been removed.
[12:34:26 AM] Kaizell, Seeker Of Wisdom (K♦): …
[12:34:31 AM] Kaizell, Seeker Of Wisdom (K♦): Yes, Erik
[12:34:34 AM] kidpichu: e-e" moon shit ? clues to the spooky bunny in the moon
[12:34:37 AM] Kaizell, Seeker Of Wisdom (K♦): Just like Blue’s Clues
[12:34:50 AM] Captain “CircleHunter” Desdinova: HERE’S THE MAIL IT NEVER FAILS IT MAKES ME WANNA WAG MY TAIL WHEN IT COMES I WANNA WAIL MAAAAAAAAAAAAAAIIIIIIIIIIIIIIIIIIIIIIL
[12:34:51 AM] The Sun: I heard there were shitstorms.
[12:34:54 AM] Kaizell, Seeker Of Wisdom (K♦): Or maybe a super advanced civilization?
[12:34:59 AM] The Sun: Do I need to smack someone?
[12:35:05 AM] Wolfcat: yeah smack mugen
[12:35:06 AM] Kaizell, Seeker Of Wisdom (K♦): Oh hey it’s THE MAN
[12:35:09 AM] The Sun: Because I’m too lazy to.
[12:35:11 AM] Kaizell, Seeker Of Wisdom (K♦): (y) (y) (y)
[12:35:25 AM] The Sun: Mugen has three arms?
[12:35:29 AM] The Sun: I thought he only had one.
[12:35:30 AM] Wolfcat: well
[12:35:34 AM] Wolfcat: jfc
[12:35:40 AM] Kaizell, Seeker Of Wisdom (K♦): (facepalm)
[12:35:42 AM] kidpichu: dearest mugi of valiant nature refrain from using personal names for it is creepy
[12:35:45 AM] Kaizell, Seeker Of Wisdom (K♦): Dude
[12:35:51 AM] kidpichu: dude seriously
[12:35:56 AM] Kaizell, Seeker Of Wisdom (K♦): Was ages ago
[12:36:02 AM] Wolfcat: he got better
[12:36:04 AM] The Sun: That’s literally the last time I was here.
[12:36:11 AM] The Sun: Oh, that explains it.
[12:36:15 AM] Kaizell, Seeker Of Wisdom (K♦): Norma plz don’t start in front of the new guy
[12:36:17 AM] kidpichu: it’s creepy and i kinda want you 10 feet from this conversation
[12:36:31 AM] Wolfcat: collin fuckboy m gonna slap ur shit
[12:36:38 AM] Kaizell, Seeker Of Wisdom (K♦): Bring it
[12:36:42 AM] *** Wolfcat slaps ur shit ***
[12:36:47 AM] Captain “CircleHunter” Desdinova: i’ll punch yer gobs
[12:36:48 AM] Kaizell, Seeker Of Wisdom (K♦): Pfft
[12:36:52 AM] Kaizell, Seeker Of Wisdom (K♦): All you got?
[12:36:59 AM | Edited 12:37:05 AM] Kaizell, Seeker Of Wisdom (K♦): Also ew
[12:37:03 AM] Wolfcat: I did what I stated out to do
[12:37:29 AM] Wolfcat: sorry tyler
[12:37:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: …
[12:37:51 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lel we r dum
[12:37:51 AM] kidpichu: i punch where dawn don’t shine
[12:38:07 AM] kidpichu: or not
[12:38:12 AM] kidpichu: :P
[12:38:13 AM] Kaizell, Seeker Of Wisdom (K♦): So anyway Tyler found an interesting paper that may have some vital info on it
[12:38:26 AM] Kaizell, Seeker Of Wisdom (K♦): Can we have a photo plz?
[12:38:26 AM | Edited 12:38:35 AM] kidpichu: it has a map to the rabbit in the moon
[12:38:39 AM] Kaizell, Seeker Of Wisdom (K♦): Had other shit too he said
[12:39:12 AM] Eve: Tyler you still here man?
[12:39:21 AM] Tylep the rotaerc: Yeah sorry
[12:39:45 AM] Tylep the rotaerc: Trying to take the picture but ever since I got back
[12:39:55 AM] Tylep the rotaerc: my phone has been acting really weird too
[12:40:06 AM] Kaizell, Seeker Of Wisdom (K♦): Weird how?
[12:40:07 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh that sucks
[12:40:32 AM] Tylep the rotaerc: the screen keeps fucking up while I am doing things and then it shuts itself off
[12:40:36 AM] Tylep the rotaerc: but hold on a sec
[12:40:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh man that sucks
[12:41:22 AM] Kaizell, Seeker Of Wisdom (K♦): Flat much, Thorin?
[12:42:14 AM] kidpichu: secretly he’s double D’s
[12:42:27 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: whaddya mean flat
[12:42:27 AM] *** kidpichu shot ***
[12:42:29 AM] Wolfcat: nice
[12:42:34 AM] Kaizell, Seeker Of Wisdom (K♦): Would explain his behavior Pichu
[12:42:40 AM] kidpichu: D:
[12:42:46 AM] Wolfcat: pics plz
[12:42:49 AM] Kaizell, Seeker Of Wisdom (K♦): If he was Edd
[12:42:50 AM | Removed 12:43:11 AM] kidpichu: This message has been removed.
[12:42:56 AM] Eve: Tyler was telling us last night, that his phone service was screwing around too
[12:43:01 AM] Kaizell, Seeker Of Wisdom (K♦): Pichu TMI
[12:43:12 AM] Eve: I hope he gets that sorted
[12:43:14 AM] kidpichu: k XD
[12:43:15 AM] Captain “CircleHunter” Desdinova: i finally have context for the image
[12:43:19 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ( ͡° ͜ʖ ͡°)
[12:43:21 AM] Stevey “Bastard Of Winterfell” Freeman: not your place to decide that, mugen
[12:43:28 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: yeah moogs
[12:43:31 AM] Wolfcat: ( ͡° ͜ʖ ͡°)
Captain “CircleHunter” Desdinova
[12:43:34 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: she can say whatever the fuck she wants
[12:43:38 AM] Captain “CircleHunter” Desdinova: 4 u moog
[12:43:46 AM] Kaizell, Seeker Of Wisdom (K♦): Not yours either Steve
[12:43:49 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: it can be ( ͡° ͜ʖ ͡°) or non ( ͡° ͜ʖ ͡°)
[12:43:59 AM] Tylep the rotaerc: Alright FINALLY got my phone to work
[12:44:03 AM] kidpichu: i would care if stevey said tmi tho
[12:44:05 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Lol circ
[12:44:10 AM] Stevey “Bastard Of Winterfell” Freeman: Yes it is, cause you’re trying to tell people what to do. I’m telling you to stop telling people what to do.
[12:44:12 AM] Kaizell, Seeker Of Wisdom (K♦): Stop trying to start fights in front of the new giy
[12:44:16 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh sweet tyler
[12:44:22 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oi
[12:44:25 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: stevey and moogs
[12:44:28 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: stahp pls
[12:44:36 AM] Kaizell, Seeker Of Wisdom (K♦): If he absconds it’s on you
Tylep the rotaerc
[12:44:41 AM] Captain “CircleHunter” Desdinova: mostly moogs tbh you need to just stop talking
[12:45:09 AM] kidpichu: but mugi you’re making this a soap opera just a lil
[12:45:13 AM] Wolfcat: whoa
[12:45:14 AM] kidpichu: ok no a lot
[12:45:21 AM] kidpichu: o__O
[12:45:24 AM] kidpichu: oh
[12:45:29 AM] Wolfcat: maybe it’s just some crazy flyer?
[12:46:14 AM] Kaizell, Seeker Of Wisdom (K♦): Wow so much for subtlety
[12:46:16 AM] kidpichu: woah which one is she?
[12:46:29 AM] Kaizell, Seeker Of Wisdom (K♦): Could be all of them
[12:46:31 AM] kidpichu: or is it bunch of moon goodeses
[12:46:41 AM] Eve: It won’t load for me ;(
[12:46:47 AM] kidpichu: she doesn’t look like any of my tribes soo
[12:47:09 AM] Kaizell, Seeker Of Wisdom (K♦): I’m hazarding a guess that they think she’s all of them
[12:47:15 AM] kidpichu: i mean not that i’m an indian XD that’s my ancestors
[12:47:38 AM] Kaizell, Seeker Of Wisdom (K♦): Already gotten
[12:47:43 AM] kidpichu: not cause its a she
[12:47:49 AM] kidpichu: the moon god i know is a he
[12:48:03 AM] kidpichu: or heard about
[12:48:05 AM] Kaizell, Seeker Of Wisdom (K♦): Wouldn’t surprise me
Tylep the rotaerc
[12:48:26 AM] Tylep the rotaerc: “ALL ARE HER” “WATCHING”
[12:48:32 AM] Kaizell, Seeker Of Wisdom (K♦): …
[12:48:34 AM] Kaizell, Seeker Of Wisdom (K♦): Wow
[12:48:37 AM] Kaizell, Seeker Of Wisdom (K♦): Called it
[12:48:40 AM] Tylep the rotaerc: I fucking swear
[12:48:49 AM] Tylep the rotaerc: If the police don’t do something about this
[12:48:55 AM] Captain “CircleHunter” Desdinova: Mugen what the fuck are you even talking about?
[12:48:56 AM] Tylep the rotaerc: I NEED to find a way to move
[12:49:52 AM] Kaizell, Seeker Of Wisdom (K♦): @Circle
[12:47 AM] Kaizell, Seeker Of Wisdom (K♦️): I’m hazarding a guess that they think she’s all of them
[12:50:09 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: mugen
[12:50:15 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: how much crack have you been smokin
[12:50:37 AM] Kaizell, Seeker Of Wisdom (K♦): Not enough seeing as you think I am.
[12:50:39 AM] kidpichu: pffp
[12:50:41 AM] kidpichu: mugi
[12:50:47 AM] kidpichu: the paper says goddesses
[12:51:00 AM] Kaizell, Seeker Of Wisdom (K♦): And on the back says “ALL ARE HER”
[12:51:13 AM | Edited 12:51:21 AM] Kaizell, Seeker Of Wisdom (K♦): I did not expect to be right about that
[12:51:19 AM] kidpichu: ?
[12:51:22 AM] kidpichu: oki
[12:51:27 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh yeah i saved the images i’d put them in the Dropbox but my Dropbox is full
[12:51:43 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: moogs srsly what the fuck are you on about
[12:51:45 AM] kidpichu: dropbox y u nu eat it
[12:51:54 AM] Kaizell, Seeker Of Wisdom (K♦): FFS Thorin read up
[12:51:56 AM] kidpichu: i want what mugi is havening
[12:51:58 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: yer creepin me out a bit, and i bet tyler is creeped out too
[12:52:18 AM] kidpichu: unless it really bad then no
[12:52:20 AM] Tylep the rotaerc: I just want to know what the fuck is going on
[12:52:23 AM] Tylep the rotaerc: like seriously
[12:52:25 AM] Captain “CircleHunter” Desdinova: tbh so do i
[12:52:29 AM] Kaizell, Seeker Of Wisdom (K♦): No clue
[12:52:44 AM] Kaizell, Seeker Of Wisdom (K♦): I’m just shooting off theories on the folks that sent it
[12:52:47 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i doubt any of us know.
[12:52:55 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: we can probably try to help find out
[12:53:37 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: crap
[12:53:38 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i g2g
[12:53:43 AM] kidpichu: i don’t think it’s werewolves or vampires if that’s help ^-^“
[12:56:32 AM] kidpichu: it doesn’t….does it? i’m sorry Q^Q
[12:56:58 AM] Eve: Tyler, tbh, lock all your doors, shut all your blinds.
[12:57:00 AM] Wolfcat: git yerself a gun
[12:57:14 AM] Oceanstuck: whatd i miss
[12:57:16 AM] Kaizell, Seeker Of Wisdom (K♦): Lycans would be interesting but I doubt it
[12:57:24 AM] Kaizell, Seeker Of Wisdom (K♦): Ohai Ocean
[12:57:28 AM] Eve: And don’t answer the door to anyone
[12:57:42 AM] kidpichu: not even the pizza boy
[12:57:48 AM] Oceanstuck: esp not the pizza boy
[12:57:54 AM] Wolfcat: never the pizza boy
[12:57:58 AM] Kaizell, Seeker Of Wisdom (K♦): He might take your eyes
[12:58:03 AM] Wolfcat: and your money
[12:58:07 AM] Oceanstuck: double esp if hes green and malformed
[12:58:15 AM] Kaizell, Seeker Of Wisdom (K♦): But def your eyes
[12:58:44 AM] Tylep the rotaerc: Have any of you seen these symbols before?
[12:58:49 AM] Kaizell, Seeker Of Wisdom (K♦): No
[12:58:55 AM] Captain "CircleHunter” Desdinova: nope
[12:59:07 AM] Wolfcat: hm
[12:59:13 AM] Oceanstuck: what symbols were they again
[12:59:36 AM] Oceanstuck: i had to skim the backlog i think i missed them
[1:00:07 AM] Kaizell, Seeker Of Wisdom (K♦): Ocean
[1:00:24 AM] Oceanstuck: what
[1:00:25 AM] Oceanstuck: just
[1:00:29 AM] Oceanstuck: tell me what they were
[1:00:36 AM] Kaizell, Seeker Of Wisdom (K♦): I was trying to
[1:00:41 AM] Eve: Well, one symbol kinda reminds me of Zelda
[1:00:48 AM] Kaizell, Seeker Of Wisdom (K♦): Skype and phone were being bitches
[1:01:02 AM] kidpichu: yeah it kinda does
[1:01:06 AM] Kaizell, Seeker Of Wisdom (K♦): Yeah the upper one makes me think of the falling moon from MM
[1:01:20 AM] kidpichu: D: that’s horrible
[1:01:24 AM] Captain “CircleHunter” Desdinova: and the bottom one is a TIE bomber
[1:01:27 AM] Stevey “Bastard Of Winterfell” Freeman: Illuminaughty
[1:01:35 AM] Stevey “Bastard Of Winterfell” Freeman: and the bottom one is a TIE bomberCIRCLE NO
[1:01:38 AM] Stevey “Bastard Of Winterfell” Freeman: YOU’RE NOT MEANT TO MAKE MEL AUGH
[1:01:40 AM] Stevey “Bastard Of Winterfell” Freeman: STHAP
[1:01:41 AM] Stevey “Bastard Of Winterfell” Freeman: Immediatly
[1:02:28 AM] kidpichu: XD
[1:02:31 AM] Captain “CircleHunter” Desdinova: nah though it looks like an eye
[1:02:41 AM] Kaizell, Seeker Of Wisdom (K♦): Makes sense
[1:02:45 AM] Wolfcat: I need to check something
[1:02:56 AM | Edited 1:03:05 AM] kidpichu: oh aren’t their like eye monsters Zelda?
[1:03:18 AM] Kaizell, Seeker Of Wisdom (K♦): Says “watching” between them
[1:03:23 AM] kidpichu: where you shoot arrows at them like pew pew
[1:03:26 AM] Kaizell, Seeker Of Wisdom (K♦): Yes but none like that
[1:03:30 AM] Wolfcat: brb
[1:03:36 AM] Eve: I was thinking of the eye of truth
[1:03:50 AM] Eve: But I’m just a Zelda buff
[1:03:59 AM] Eve: Tyler… Srsly.
[1:04:01 AM] Kaizell, Seeker Of Wisdom (K♦): Nope
[1:04:30 AM] Eve: Don’t answer the door. And draw your shades
[1:04:33 AM] Kaizell, Seeker Of Wisdom (K♦): Looks nothing like it not even Agahnim’s version
[1:04:34 AM] Kaizell, Seeker Of Wisdom (K♦): Eve
[1:04:37 AM] kidpichu: not even vatti?
[1:04:44 AM] Eve: BTW, do you have power yet?
[1:04:44 AM] Kaizell, Seeker Of Wisdom (K♦): Broken record much?
[1:04:51 AM] Kaizell, Seeker Of Wisdom (K♦): No Pichu
[1:05:03 AM] Kaizell, Seeker Of Wisdom (K♦): Methinks it’s original but I could find someone
[1:05:05 AM] kidpichu: you shouldn’t break records bad mugi bad
[1:05:18 AM] Kaizell, Seeker Of Wisdom (K♦): Wasn’t me who broke it
[1:05:20 AM] kidpichu: those are history
[1:05:33 AM] kidpichu: but you smelt it
[1:05:46 AM] kidpichu: so you delt it
[1:05:59 AM] Kaizell, Seeker Of Wisdom (K♦): T'was Eve who dealt it as I was calling her on it
[1:06:18 AM] Kaizell, Seeker Of Wisdom (K♦): Seriously people can we knock off the damn hostilities around the new guy?
[1:06:22 AM] Kaizell, Seeker Of Wisdom (K♦): Fucking hell
[1:06:31 AM] kidpichu: just teasin~
[1:06:41 AM] Kaizell, Seeker Of Wisdom (K♦): And look where it got you
[1:06:45 AM] Tylep the rotaerc: [1:04 AM] Eve:
<<< BTW, do you have power yet?
[1:06:57 AM] Tylep the rotaerc: How else would I be on my computer with the lights on lol
[1:07:05 AM] kidpichu: wizzard
[1:07:21 AM] kidpichu: it got me where i like it~
[1:07:56 AM] kidpichu: xD ok sorry that one was bad
[1:08:09 AM] Kaizell, Seeker Of Wisdom (K♦): Yes it was
[1:08:18 AM] kidpichu: chu~
[1:08:36 AM] Eve: On 5/27/2015, at 1:06 AM, Tylep the rotaerc wrote:
> How else would I be on my computer with the lights on lol
Lol, yur right. That was dumb.
[1:08:39 AM] Stevey “Bastard Of Winterfell” Freeman: Noones even being “mean” to the new guy
[1:08:49 AM] Kaizell, Seeker Of Wisdom (K♦): Semantics
[1:08:56 AM] kidpichu: pfff
[1:08:56 AM] Eve: He he, guys….
[1:09:04 AM] Kaizell, Seeker Of Wisdom (K♦): You’re being mean where he can see it
[1:09:12 AM] Tylep the rotaerc: I am actually in a skype call with my girlfriend at the moment who I am trying to convince I am ok.
[1:09:40 AM] Kaizell, Seeker Of Wisdom (K♦): How’s she doing?
[1:09:48 AM] kidpichu: i-i read that sooo wrooongg
[1:09:55 AM] Eve: Oh, your GF, cooool
[1:09:55 AM] kidpichu: i’m so sorry XD
[1:10:17 AM] Kaizell, Seeker Of Wisdom (K♦): …
[1:10:26 AM] Tylep the rotaerc: I didn’t want to show her the paper, but I know she has done some relgious studies before so I doodled the symbol on a piece of paper. And showed her.
[1:10:29 AM] Kaizell, Seeker Of Wisdom (K♦): Don’t worry Tyler you’ll get used to it
[1:10:35 AM] kidpichu: seamonkeys
[1:10:40 AM] Tylep the rotaerc: She said she has never seen it before ^^;
[1:10:50 AM] Kaizell, Seeker Of Wisdom (K♦): Not surprised
[1:11:24 AM] Stevey “Bastard Of Winterfell” Freeman: that eye does look familar to be honest
[1:11:31 AM] Stevey “Bastard Of Winterfell” Freeman: cant seem to place it… its so annoying
[1:11:43 AM] Wolfcat: Yeah, the bottom symbol looks very familiar
[1:11:55 AM] Stevey “Bastard Of Winterfell” Freeman: I know right?
[1:12:02 AM] Wolfcat: Reminds me of Gohma
[1:12:19 AM] Stevey “Bastard Of Winterfell” Freeman: seems almost egyptian or somethin. or illoominati
[1:12:34 AM] Kaizell, Seeker Of Wisdom (K♦): Wat
[1:13:08 AM] Kaizell, Seeker Of Wisdom (K♦): Not seeing the resemblance
[1:13:54 AM] Wolfcat: mostly the hyrule warriors one
[1:14:05 AM] Wolfcat: http://vignette1.wikia.nocookie.net/fantendo/images/e/e2/Queen_Gohma_(Hyrule_Warriors).png/revision/latest?cb=20140928032212
[1:14:31 AM] kidpichu: o-o spooky
[1:14:34 AM] kidpichu: that look right
[1:14:35 AM] Kaizell, Seeker Of Wisdom (K♦): OK that might make some sense
[1:14:40 AM] Kaizell, Seeker Of Wisdom (K♦): But why Gohma?
[1:14:55 AM] kidpichu: cause go big or gohma
[1:15:01 AM] Wolfcat: I don’t think it’s acutlaly meant to be Gohma, it just reminds me of that
[1:15:06 AM] Wolfcat: pichu go home you’re drunk
[1:15:14 AM] kidpichu: 3: k
[1:15:25 AM] kidpichu: can i stay and watch?
[1:15:43 AM] Wolfcat: sure
[1:15:51 AM] kidpichu: yay
[1:16:20 AM] Stevey “Bastard Of Winterfell” Freeman: [1:14 AM] kidpichu:
<<< cause go big or gohmaXD PICHU NO
[1:16:28 AM] Stevey “Bastard Of Winterfell” Freeman: stop.jpeg
[1:17:35 AM] Sprikiroid: yo
[1:17:44 AM] Sprikiroid: what have I missed
[1:17:46 AM] Oceanstuck: sup
[1:17:57 AM] Oceanstuck: site shit and drama
[1:18:15 AM] kidpichu: drama lama
[1:19:21 AM] Stevey “Bastard Of Winterfell” Freeman: does llama have two l’s?
[1:20:08 AM] Kaizell, Seeker Of Wisdom (K♦): Yep
[1:20:22 AM] kidpichu: that’s how much drama it brings XD
[1:20:42 AM] kidpichu: i prefer alpacas though
[1:29:56 AM] uoslǝN ʞɔɐZ: Welp, Gotta go guys, see ya later ^^
[1:30:03 AM] Oceanstuck: bye zack
[1:32:29 AM] Wolfcat: I’m gonna head out also. Night guys.
[1:33:27 AM] Dovid Magady: Hello
[1:33:56 AM] Kaizell, Seeker Of Wisdom (K♦): Hai Dov
[1:34:18 AM] Kaizell, Seeker Of Wisdom (K♦): You meet Tyler yet?
[1:34:38 AM] Tylep the rotaerc: I got a video together of the guy to show the authorities
[1:34:44 AM] Tylep the rotaerc: also hello ^^
[1:35:39 AM] Dovid Magady: Whats ip?
[1:35:48 AM] Dovid Magady: Yeah, we met lst night
[1:36:39 AM] Dovid Magady: What happnened, Tyler?
[1:37:26 AM] kidpichu: o-o that’s smart
[1:38:31 AM] Tylep the rotaerc: In the middle of editing I added in text as if I was talking to all of you
[1:39:06 AM] Tylep the rotaerc: I feel like I kind of did that on accident unconciously since I was technically on skype with you all while editing with the intent to show you all as well.
[1:39:27 AM] Tylep the rotaerc: But if they ask I’ll just say I was gonna show it to random un named friends first.
[1:43:42 AM] Eve: OK, that’s believable
[1:43:50 AM] Eve: :P
[1:43:56 AM] Dovid Magady: Sounds good
[1:44:46 AM | Removed 1:47:30 AM] Dovid Magady: This message has been removed.
[1:45:15 AM] Tylep the rotaerc: [1:43 AM] Eve:
<<< OK, that’s believableIs that sarcasm cause I can’t even tell ^^;
[1:45:16 AM | Removed 1:47:33 AM] Dovid Magady: This message has been removed.
[1:46:18 AM] Dovid Magady: And now I realize that no one knows what the fuck Im talking about
[1:50:48 AM] Tylep the rotaerc: I am locking all my doors and shutting off my lights
[1:51:10 AM] Dovid Magady: All right. be careful.
[1:51:11 AM] Tylep the rotaerc: I feel very un easy at the moment
[1:51:21 AM] Kaizell, Seeker Of Wisdom (K♦): You post the vid?
[1:52:21 AM] Tylep the rotaerc: https://www.youtube.com/watch?v=PpaMPlmk81k
[1:52:26 AM] Dovid Magady: Thanks
[1:52:33 AM] Tylep the rotaerc: I put it together in a bit of a rush but yeah
[1:52:33 AM] Eve: On 5/27/2015, at 1:45 AM, Tylep the rotaerc wrote:
> [1:43:47 AM] Eve: OK, that’s believable
<<< Is that sarcasm cause I can’t even tell ^^;
It wasn’t, sorry.
[1:52:55 AM] Kaizell, Seeker Of Wisdom (K♦): Awesome
[1:53:01 AM] Stevey “Bastard Of Winterfell” Freeman: why do you feel unsafe..?
[1:53:04 AM] Stevey “Bastard Of Winterfell” Freeman: is something the matter?
[1:53:07 AM] Dovid Magady: What paper did you find in front of your home?
[1:53:14 AM] Dovid Magady: What’d it say?
[1:53:30 AM] Tylep the rotaerc: I thought I already uploaded it
[1:53:38 AM] Tylep the rotaerc: Thinking back I feel I should have put it in the video
[1:53:46 AM] Kaizell, Seeker Of Wisdom (K♦): It’s cool
[1:53:50 AM] Tylep the rotaerc: but Ill just show it to the police when I call them tomorrow
[1:53:56 AM] Dovid Magady: I might have missed it
[1:54:19 AM] Kaizell, Seeker Of Wisdom (K♦): Dov the paper has two sides, one was a flyer about Moon patrons, all female
[1:54:24 AM] Kaizell, Seeker Of Wisdom (K♦): This is the back
[1:54:40 AM] Dovid Magady: Thank you
[1:54:54 AM] Dovid Magady: you don’t have the front, I take it?
[1:55:41 AM] Kaizell, Seeker Of Wisdom (K♦): I do
[1:55:46 AM] Kaizell, Seeker Of Wisdom (K♦): Just went back and saved it
[1:56:13 AM] Dovid Magady: Thank yo, again. not much help, though
[1:56:18 AM] Kaizell, Seeker Of Wisdom (K♦): Yeah
[1:57:05 AM] Kaizell, Seeker Of Wisdom (K♦): I had a theory that they believed all of these Moon patronesses were the same person, like seconds before he showed us the back
[1:57:10 AM] Kaizell, Seeker Of Wisdom (K♦): Caught me off guard
[1:57:49 AM] Dovid Magady: The words and symbols seem to mixed up… #statingtheobvious
[1:58:46 AM] Dovid Magady: But yeah, I get the idea. you allright, Tyler?
[1:59:01 AM] Tylep the rotaerc: Not really
[1:59:14 AM] Tylep the rotaerc: Just got out of a call with carla
[1:59:40 AM] Tylep the rotaerc: She just thinks I am suddenly obsessively curious about obscure symbols now
[1:59:44 AM] Tylep the rotaerc: So thats good
[1:59:48 AM] Tylep the rotaerc: I hate to worry her
[2:00:26 AM] Dovid Magady: Sorry, whos Carla?
[2:01:11 AM] Tylep the rotaerc: My girlfriend
[2:01:25 AM] Dovid Magady: Ah. I should have figured
[2:01:32 AM] Tylep the rotaerc: I have been with her for the longest time
[2:01:46 AM] Dovid Magady: That’s sweet
[2:01:57 AM] Tylep the rotaerc: Hey actually now that I just thought about it
[2:02:03 AM] Tylep the rotaerc: Damn
[2:02:06 AM] Tylep the rotaerc: That necklace
[2:02:24 AM] Tylep the rotaerc: I was wearing it in “Fun night with john and kevin”
[2:02:41 AM] Tylep the rotaerc: She gave it to me as a birthday present
[2:02:54 AM] Tylep the rotaerc: and I lost it a while back
[2:03:37 AM] Kaizell, Seeker Of Wisdom (K♦): It’s still missing?
[2:03:42 AM] Tylep the rotaerc: Yeah
[2:05:09 AM] Tylep the rotaerc: I remember when it went missing me and kevin got in a fight about it
[2:05:27 AM] Tylep the rotaerc: Because he had shown some serious interest in it a few times
[2:05:33 AM] Tylep the rotaerc: and then it was just gone one day
[2:05:39 AM] Tylep the rotaerc: and I looked everywhere
[2:05:45 AM] Tylep the rotaerc: and could not find it at all
[2:06:03 AM | Edited 2:06:19 AM] Dovid Magady: Wher’d Carla get the necklace?
[2:06:22 AM] Tylep the rotaerc: She told me she bought it online
[2:06:53 AM] Dovid Magady: Oh, ok. Nothing more specific?
[2:07:07 AM] Tylep the rotaerc: I think it might have been ebay or amazon
[2:07:09 AM] Tylep the rotaerc: idk
[2:07:28 AM] Dovid Magady: Allright. sorry to pry
[2:07:32 AM] Tylep the rotaerc: Its fine
[2:07:39 AM] Tylep the rotaerc: But I thought he might have taken it
[2:07:48 AM] Tylep the rotaerc: which made me feel like an ass hole to say
[2:08:00 AM] Tylep the rotaerc: but I had searched my entire home
[2:08:06 AM] Tylep the rotaerc: top to bottom
[2:08:10 AM] Tylep the rotaerc: and it was just gone
[2:08:31 AM] Kaizell, Seeker Of Wisdom (K♦): What about Kevin’s place?
[2:08:59 AM] Tylep the rotaerc: The only time I have thoroughly been through his house
[2:09:06 AM] Tylep the rotaerc: was after he disapeared
[2:09:22 AM] Kaizell, Seeker Of Wisdom (K♦): No joy?
[2:09:44 AM] Tylep the rotaerc: But he was rather upset with me for accusing him
[2:09:55 AM] Tylep the rotaerc: So I just dropped it after a while
[2:10:07 AM] Kaizell, Seeker Of Wisdom (K♦): Maybe it went with him and he didn’t know
[2:10:16 AM] Tylep the rotaerc: idk
[2:10:22 AM] Kaizell, Seeker Of Wisdom (K♦): Although blowing up at the thought that he ran off with it
[2:10:25 AM] Tylep the rotaerc: Carla wasn’t upset though that I lost it
[2:10:30 AM] Tylep the rotaerc: she is a very forgiving person
[2:10:32 AM] Tylep the rotaerc: so it was fine
[2:10:37 AM] Kaizell, Seeker Of Wisdom (K♦): Yeah
[2:11:02 AM] Kaizell, Seeker Of Wisdom (K♦): But I find Kevin’s outburst strange
[2:11:20 AM] Dovid Magady: It was definetly odd
[2:11:24 AM] Kaizell, Seeker Of Wisdom (K♦): I mean yeah, not very friendly but damn
[2:11:50 AM] Tylep the rotaerc: Kevin was always a pretty weird guy though
[2:11:58 AM] Tylep the rotaerc: Silent and weird one minute
[2:12:02 AM] Kaizell, Seeker Of Wisdom (K♦): Welp, maybe if we find Kevin we’ll get our answer
[2:12:02 AM] Tylep the rotaerc: very loud the next
[2:12:17 AM] Tylep the rotaerc: I feel like he didn’t take it though
[2:12:20 AM] Dovid Magady: But how can we find him?
[2:12:21 AM] Kaizell, Seeker Of Wisdom (K♦): His name does strike a chord with me
[2:12:26 AM] Tylep the rotaerc: Or he would have said something
[2:12:29 AM] Tylep the rotaerc: I feel
[2:13:00 AM] Kaizell, Seeker Of Wisdom (K♦): Maybe he didn’t but better to check for something that isn’t there than to be blindsided by what is.
[2:13:23 AM] Dovid Magady: But there was guy by his house wasn’t there?
[2:16:30 AM] Tylep the rotaerc: huh?
[2:16:45 AM] Dovid Magady: The man in the shadows you passed by
[2:17:13 AM] Tylep the rotaerc: I never even made it to kevins house today ^^;
[2:17:27 AM] Tylep the rotaerc: I got too scared when that happened
[2:17:31 AM] Tylep the rotaerc: and ran back home
[2:17:47 AM] Tylep the rotaerc: that was about 3 and a half hours ago
[2:17:56 AM] Dovid Magady: Allright. Im just saying that guy seemed weird.
[2:18:37 AM] Eve: So, you said you’re gonna go to the authorities tomorrow?
[2:18:44 AM] Tylep the rotaerc: Yes
[2:18:57 AM] Eve: Let us know what they say
[2:19:30 AM | Edited 2:19:44 AM] Eve: If they can’t help you, we’ll find a way, somehow
[2:21:24 AM] Tylep the rotaerc: Idk what you guys could really do
[2:22:52 AM] Kaizell, Seeker Of Wisdom (K♦): You never know
[2:23:33 AM] Dovid Magady: We could help in someway
[2:23:55 AM] Dovid Magady: Im sure we can
[2:24:04 AM] Eve: At the very least, we’re here to be some bro’s for you.
[2:24:35 AM] Eve: In honor of John ;)
[2:25:06 AM] Eve: His bro’s are our bro’s
[2:32:43 AM] Eve: You OK, Tyler?
[2:33:38 AM] Eve: :( maybe he fell asleep.
#tyler
A video of the encounter Tyler had with the spooky guy, on the way home from Kevin’s house.
EDIT: The police made Tyler delete this video from Youtube! (5/29/15)
(Source: youtube.com)
#Tyler
Chat with SKM 5/28/15
Read chat below:
<wolfcat>: What’s up broskino
<CaptainDesdinova>: I have arrived
<Oceanstuck>: hellos
<Helper>: Hello, adventurers!
<Helper>: I have decided to follow you.
<CaptainDesdinova>: Awesome
<SKM>: Well not a whole hell of a lot, but things of importance none the less. The damn shazz bots fixed the domain faster than I thought they would ^^;
<wickedlady4180>: SKM, we were told to contact you
<Oceanstuck>: hey again skoom
<Oceanstuck>: hey again helper
<SKM>: I arranged for you to receive this message yes XD
<wickedlady4180>: The message said you had more information about Tyler
<wolfcat>: Was the kid the one sending us the texts?
<SKM>: You mean our good old numbers friend?
<ADULT_LINK>: Hi! i’m not banned this time
<SKM>: Oh no
<wolfcat>: not yet
<SKM>: I have no idea what that thing is
<SKM>: Speaking of texting, it is quite good Tylers phone has such a formidable battery as it is my only form of access into his actions in meat space atm.
<wickedlady4180>: Tyler is is trouble
<SKM>: Just a weeeee bit ^^;
<SKM>: His power went out last night
<ADULT_LINK>: he also found a spooky guy
<wickedlady4180>: More than that, he’s being watched and followed
<SKM>: I have been keeping up with the goings and doings of the piss children as well, and I am very certain they shan’t drezz him just yet.
<SKM>: However
<SKM>: they are not above simply trying to fuck with the mans psyche
<Oceanstuck>: >
<SKM>: and potentially hurt him a bit
<wickedlady4180>: We want to avoid that
<SKM>: But they seem to be waiting for something of significance to happen before acting.
<Oceanstuck>: ‘like what
<ADULT_LINK>: Hmm
<SKM>: I am honestly not sure
<ADULT_LINK>: Any idea on what we can do to help tyler?
<SKM>: They have been getting MUCH more secretive of what they do. The updates you are seeing on the terminology went through almost 48hrs of debate before getting clearance.
<wickedlady4180>: I have a few questions for you
<SKM>: Yes of course
<SKM>: proceed m'lady
<wickedlady4180>: Are you aware of the note tyler got? What do the symbols mean?
<ADULT_LINK>: M'duck
<SKM>: I saw all that yes
<SKM>: The symbol on the top refers to a part of there beliefs known as “Parallelos” and they put it on shit all over the place. Sometimes I can make connections as to why, and other times I feel it is just used because a “Parallelos” ranked member had something to do with the related action, or just for what appears to be shits and giggles.
<ARGdov>: Sorry, but what exactly is Parallelos? Or was that already sked?
<SKM>: The symbol on the bottom is known as the “lunarum oculus” and simply means they want to emphasize that “mother” is bearing witness to whatever is unfolding.
<SKM>: Parallelos is a strange idea they have about parallel dimensions, the multiverse, and the various time lines in each one. Some idea that through lunas power certain things can be manifested by borrowing from other “Parallelos” and that when you ascend you are traveling through certain kinds of “Parallelos”
<Oceanstuck>: elaborate on it please
<SKM>: and that luna currently resides in a special kind of “Parallelos”
<ARGdov>: Cool. I had a feeling it was something like that
<ZackyN>: Hai!
<Oceanstuck>: sup
<wickedlady4180>: I still have another question, and then I’ll let everyone have a go
<ADULT_LINK>: Parallelos does sound like Parallel
<ADULT_LINK>: i mean
<SKM>: Parallelos parrallelos parallelos yada yada yada, tbh it felt like a bunch of drek to me.
<ADULT_LINK>: it kinda comes from it
<Oceanstuck>: i wanna know tho
<ARGdov>: What about the stuff on the other side of the note? Is that relevant in any way?
<SKM>: It seems to me like all that is happening
<SKM>: to these people that they kill
<SKM>: is they are somehow becoming digitized afterwards
<SKM>: which is REALLY schway in concept XD
<ARGdov>: Asension?
<ADULT_LINK>: Kinda like BEN from the old creepypasta?
<Oceanstuck>: hnh. ive heard something like that
<SKM>: YES actually that is another thing they go on about A LOT
<ARGdov>: Yeah, exactly
<SKM>: Before I messed up there shit the first time
<ADULT_LINK>: lol
<ADULT_LINK>: what’d ya do?
<wickedlady4180>: SKM, I wanna ask about Kevin. Tyler is searching for Kevin, and we think that we know where he is.
<SKM>: They had a collection of explanatory pages and videos
<wickedlady4180>: Or rather, who he is now
<SKM>: I actually got nothing on Tylers friend Kevin ^^;
<SKM>: I am pretty in the dark about this guy actually
<ADULT_LINK>: Huh
<wickedlady4180>: I see, ok.
<SKM>: hell more in the dark then usual now that I think about it
<ARGdov>: Allrighty, then
<ADULT_LINK>: he never told us about him before he got the minor amnesia about us
<wickedlady4180>: What did you do to patrem?
<SKM>: But that is probably my own fault due to lack of further observation on my own behalf ^^;
<ADULT_LINK>: Lol
<ARGdov>: By any chance do you know who “MattR” is?
<Oceanstuck>: speaking of patrem
<ADULT_LINK>: Yo zack, you have any questions bout stuff? this’d be your time to ask bro :3
<Oceanstuck>: i remember someone asked you what relation you had with that guy last time we spoke
<Oceanstuck>: you said it could wait until next time
<Oceanstuck>: and its next time now
<Oceanstuck>: so
<SKM>: woah nelly slow down kids
<SKM>: which question first ^^;
<Oceanstuck>: whats the relation between you and patrem
<ARGdov>: Didn’t something happen to him? Matt, I mean.
<ARGdov>: Ocean can go first
<SKM>: Me and pisstrum
<Oceanstuck>: ye
<Oceanstuck>: whats the relation between you two
<SKM>: About 4 years back I was visiting family in america
<SKM>: they had recently moved to florida and planned to live out the rest of their retirement there.
<SKM>: I had a younger brother, about 9 at the time who was quite active on the internet. And introduced me to a place known as “Within Hubris”
<ADULT_LINK>: we know hubris ;3
<SKM>: Yes… I know… ^^;
<Oceanstuck>: hubris?
<Oceanstuck>:
<ARGdov>: Yep. don’t we know it well
<ADULT_LINK>: :L
<SKM>: I payed no mind to it at the time
<Oceanstuck>: weve all been
<SKM>: However that would prove to be a costly mistake on my own behalf
<ADULT_LINK>: (you can answer this later, but have you read Weenie Licked yet? its glorious)
<ARGdov>: What could be so bad?
<SKM>: My brother told me of a character he met in his actions on the website
<SKM>: He called him “The purple man”
<ARGdov>: Well, that could be any number of-… oh
<SKM>: I was under the assumption he was talking about a bloody teletubby or something
<SKM>: and payed it no mind
<ADULT_LINK>: XD
<SKM>: About a month later he went missing
<SKM>: He was last seen playing with his camera in the local park.
<ADULT_LINK>: wait, your bro went missing or patrem
<SKM>: My brother
<ADULT_LINK>: oh shit
<ARGdov>: Wow.
<ARGdov>: Im sorry to hear that
<ADULT_LINK>: that sucks D:
<SKM>: On his camera there was nothing but garbled purple mess in each photograph
<Oceanstuck>: ;_;
<ARGdov>: That’s awful.
<wickedlady4180>: So, what you assume happened?
<SKM>: I felt at the time he may have been abducted by someone he met in his online games.
<ADULT_LINK>: probably not somone from hubris (mugen is a possibility, hes a creep) but still that sucks
<Oceanstuck>: lel
<SKM>: So I made I began to pay close attention to the website he spoke of most. “This place where ben is always being really scary and I talk to the purple man, who tells me he will show me how to fly.”
<ARGdov>: BENs not been on there for awhile, though
<Oceanstuck>: tbf its not the same hubris now that it was 4yrs ago
<ARGdov>: Yeah, I just realized my mistake.
<Oceanstuck>: derp
<SKM>: At the begining of november I was contacted by a strange character that was calling itself BEN
<SKM>: It was telling me all sorts of gibberish code and nonsense so I ignored this as well.
<SKM>: until around november 11th
<SKM>: I don’t remember a whole lot about that day, but I know that was the day it happened.
<SKM>: I was minding my own business
<SKM>: analyzing everything from the information on the previous cults website, and the various other groups that seemed to be interested in all of this, hoping for some chance to discover anything regarding my brother.
<SKM>: My techno drek lost its fucking mind all of a sudden.
<CaptainDesdinova>: I feel pretty good about maintaining the wiki now
<SKM>: The screen literally blew out in my face
<SKM>: I thought the computer would fully catch on fire as I watched bits of steam come out of it, but as I went to pull the plug I noticed something.
<SKM>: My vision was a bit blurred, but I saw this… thing at my doorway.
<SKM>: About up to my neck in height it seemed and looked to be dressed in green with its hands at its sides.
<SKM>: But it didn’t look right
<Oceanstuck>: (an elegy?)
<SKM>: I heard a loud screeching and I passed out.
<ARGdov>: Then what?
<ARGdov>: Also, you ever play Majoras Mask?
<SKM>: I awoke and my grandfather was asking me what had happened, I was bloody disturbed he had not called paramedics seeing as I had cuts all over my face from the pieces of computer screen. But I did not want to come off as a fucking mad man so I explained “I may have been experiencing some EXTREAMLY” faulty wiring issue.
<Oceanstuck>: arg
<Oceanstuck>: focus
<ARGdov>: Sorry. I was just wondering if he recognized the statue and scream
<SKM>: I eventually got a new computer screen and discovered my computer (Very strangely) still worked just fine.
<ARGdov>: Weird
<ADULT_LINK>: Huh
<ADULT_LINK>: well i mean
<ADULT_LINK>: if only the screen was damaged
<ADULT_LINK>: then it makes sence that it’d work
<SKM>: But there were a text file on my computer titled lostmemory423 with some binary in it
<SKM>: stating
<ZackyN>: Stating what!?
<SKM>: “you do not realize how much you have helped me, but I shall help you. Father had him taken for the children. Watch 27.718435, -82.429048 they are near there.”
<SKM>: Sorry had to go find the file ^^;
<Oceanstuck>: k
<ZackyN>: Sorry, just impatient -,-
<ZackyN>: But thank you!
<ARGdov>: You ever check that place out?
<ADULT_LINK>: why are “the children” in florida
<SKM>: The current main base of operations, and a bloody sad one at that, “The fishery” is there.
<SKM>: for the lunar children
<SKM>: Father
<SKM>: is that fucking purple bastard
<ARGdov>: Patrem?
<wolfcat>: No, the other purple bastard
<ADULT_LINK>: other?
<ARGdov>: Who?
<Oceanstuck>: megun?
<ADULT_LINK>: what?
<wolfcat>: ..
<SKM>: Thats the “Holy title” they call “Father” by
<ADULT_LINK>: oh wait mugen said that
<ADULT_LINK>: patrem is the father?
<Oceanstuck>: i thought we already knew that
<Oceanstuck>: anyway skoom go on
<SKM>: Its what they call him
<ZackyN>: What did you actually do to patrem?
<SKM>: Ahhhhhh yessss
<ADULT_LINK>: Hey SKM, eve wants to know where patrem is Right now, but you can answer zack first
<SKM>: He is in pain most likely ^^
<SKM>: if whatever he is can feel it
<SKM>: But sadly he will be at large again soon.
<SKM>: He came at me at a horrible time when he did.
<SKM>: The time shift had just happened, as well as the trick I had the kid pull on him to use up his resources trying to make it into your skype room.
<SKM>: for a computer program and/or “god” he sure has a human like ego XD
<ADULT_LINK>: lol
<SKM>: and was almost unaware of his own strengths
<SKM>: He was trying to brute force me through my connection to your site he seems to like inhabiting.
<SKM>: So I sent him a little present
<ADULT_LINK>: Lol wow
<ADULT_LINK>: also JJ
<ARGdov>: What was it?
<ADULT_LINK>: did you DDoS him?
<SKM>: I overloaded him with more data than he could handle at once at that moment in time.
<ADULT_LINK>: Nice
<Oceanstuck>: >:D
<SKM>: then temporarily dl’d him
<SKM>: and cut and paste him into the 592 directory
<ARGdov>: Smart move
<ARGdov>: You can do that? just move him around like that?
<SKM>: while he was idle yes
<SKM>: but it was rather risky ^^;
<SKM>: and damn the action alone almost blew my rig up
<ARGdov>: Why not just delete him?
<SKM>: I actually tried that tbh ^^;
<SKM>: It did literally nothing
<SKM>: which is rather strange honestly
<SKM>: however
<ARGdov>: Dang.
<SKM>: I still have little understanding of what these things are
<SKM>: So I am sure there is a way to truly “Delete” this bastard
<SKM>: but I am currently not sure how
<ADULT_LINK>: Hmm
<ADULT_LINK>: you could probably put him on an external drive and dispose of that
<wolfcat>: then shoot it off into space. on the moon, for poetic justice
<SKM>: I remember trying something similar to this once back in 2013 XD
<ADULT_LINK>: lol
<SKM>: I got him in a rather similar position as the one he was recently in
<SKM>: But I put him on my old laptop (rip old friend =[ )
<SKM>: I smashed the bloody thing once I was sure he was there
<SKM>: and connected to no internet
<SKM>: and plugged into NOTHING
<SKM>: But somehow
<SKM>: SOMEHOW
<SKM>: This fucking THING
<ADULT_LINK>: Hmm
<SKM>: as I smashed the laptop with a meat tenderizer from my kitchen
<ADULT_LINK>: maybe he somehow has split himself, or made backups?
<SKM>: I was electrocuted
<SKM>: passed out
<wolfcat>: Or some wacky paralellos thing brought him back
<SKM>: and assumed he must have been gone
<ADULT_LINK>: you were electrocuted? damn
<SKM>: until I heard the fucking bloody piss children going on about them as though they had recently made contact with him.
<SKM>: him*
<Oceanstuck>: oof
<SKM>: but enough about my damn shazzbotry
<SKM>: You will probably hear from him again soon enough
<ARGdov>: Allrigjht
<SKM>: but when that happens I hope to have a new plan devised for harming this bastard.
<SKM>: I feel we have plenty more question do we not?
<ARGdov>: I think some of us do. I have non right now at the moment
<wolfcat>: Do you have any suggestions for helping bring back Tyler’s memory?
<wolfcat>: Or should we just do it the old fashioned way, dropping hints ect ect
<SKM>: That will be rather tricky
<SKM>: Because I do not understand what they did to even make him lose it to begin with.
<SKM>: On a side note about Tyler
<SKM>: I am currently doing some work to get his power back on
<ADULT_LINK>: he told us it was one when we asked
<ADULT_LINK>: he said something like “if my power was off how could i be on my computer with the lights on” or something
<ADULT_LINK>: *on not one
<SKM>: Near the beginning of this conversation I thought I said it went back off again ^^;
<SKM>: But you might have missed that so my appologies
<Oceanstuck>: oh yeah you did i just checked
<SKM>: I was taking note of his chat with you all last night
<SKM>: and then my feed went black
<SKM>: so I switched over to his cell phone
<ADULT_LINK>: oh oops sorry
<SKM>: and eventually established he lost power again
<ADULT_LINK>: oh lol i must have missed that
<ZackyN>: So, why is this lostmemory423 in the chat?
<ZackyN>: and admin at that
<SKM>: Well after the last escapade when I damn near lost the kid do to my own shazzbotry
<Oceanstuck>: (i still remember when regipimpiss popped in and i was like FUCKIN RUN BITCH. hehe)
<SKM>: I had to download him directly onto my computer for a brief moment, which has not happened in a bloody long time.
<SKM>: Which was why for a moment he was talking through me as you may recall
<Oceanstuck>: i think i remember that
<SKM>: I call him kid for a reason
<SKM>: In the time I have spent working with this thing
<SKM>: He sure as hell feels like a kid XD
<wolfcat>: The Lunar Children sure seem touchy about this 'Deuro’ thing
<SKM>: So touchy actually that I am just barely hearing of the term actually
<SKM>: They just made it “Public” so to speak about 2 weeks ago.
<wolfcat>: They still haven’t uploaded what exactly a 'Eulogy’ is yet
<Oceanstuck>: it seems to be a taboo subject, barring really dire circumstances
<SKM>: Still not sure what this “Deuro” thing is to them.
<SKM>: however “Eulogy”
<SKM>: its funny you should mention that XD
<CaptainDesdinova>: Eulogy?
<SKM>: I actually just jacked in and got that drok off of the site admin while he was not paying attention to his network XD
<SKM>: fucking shazzbots run this bloody site
<wolfcat>: You mean MattR?
<SKM>: YESSS that bloody fool lel
<wolfcat>: It’s weird, he’s got a name really similar to someone from the Moon Children.
<SKM>: I have a small handful of intel on him.
<Oceanstuck>: matt r and matt h
<SKM>: but he doesn’t come off as too important
<wolfcat>: Even more, Matt H’s alias was Rodney R, hence the R
<SKM>: What I do know about him
<SKM>: is that he is fairly new
<SKM>: but managed to quickly prove his worth and attain “Parallelos” rank
<SKM>: His mask, like other parallelos members, bares the parallelos symbol.
<SKM>: His mask is a skull, and I have never seen him without it.
<SKM>: Also did anyone want that drok I got off him?
<Oceanstuck>: ok
<Oceanstuck>: sure
<SKM>: Its a draft of the “Eulogy” info page
<Oceanstuck>: aight
<Oceanstuck>: give it here
<SKM>: Eulogy A eulogy is defined by its capabilities as an ascended child. One who has simply Ascended may communicate to this realm by some means, however one who has more capabilities (such as minor manipulation of this reality, minor physical manifestation ect…) is to be seen as a eulogy capable of even greater power.
<SKM>: But more often than not, a eulogy will remain a capable as it is upon awakening in its asended form.
<SKM>: couldn’t fit it all in one post ^^;
<ARGdov>: Allright, thanks
<wolfcat>: Last time you said those against Patrem call him “The misguided legion”. Those against Patrem, are you referring to the Moon Children? Just want to clarify.
<SKM>: The moon children had referred to him as that a few times in some conversations about him I had taken note of.
<SKM>: Any more questions?
<SKM>: I have about 13 minutes before I should be going
<CaptainDesdinova>: Any Tyler advice?
<SKM>: Just wait till tomorrow
<SKM>: and I should have him online
<SKM>: ALSO
<SKM>: I just remembered XD
<SKM>: Do tell him
<SKM>: stop talking to the police
<Oceanstuck>: why tho
<SKM>: they are not his friends in that town
<Oceanstuck>: wait so the lc has a hold on the police?
<lostmemory423>: What’s wrong with the police?
<wolfcat>: It does sound like a shady place, what with the drug dealers and killer cults
<SKM>: good question kid XD
<SKM>: Glad to see your awake now
<SKM>: surprised me there
<Oceanstuck>: hello lm423
<Oceanstuck>: can i call you loom
<lostmemory423>: Why?
<Oceanstuck>: wanted to give you a nickname
<lostmemory423>: …
<Oceanstuck>: oh never mind that we need to get back to business
<Oceanstuck>: sry sry distracted
<SKM>: He has been a little wonky do to everything I had him do before
<SKM>: But the down time has seemed to stabilize him a bit
<SKM>: But the police
<SKM>: A good portion of them are either corrupt and taking bribes from the lunar children
<SKM>: have children in the lunar children
<SKM>: or are actually senior members
<Oceanstuck>: oh
<SKM>: My advice would be do not talk to them anymore
<SKM>: ever
<ARGdov>: Wow. That’s gonna br a problrm
<SKM>: seriously XD
<Oceanstuck>: how are we gonna get him to stay away tho
<wolfcat>: Oh also… do you know anyone named George?
<ARGdov>: Thanks for the heads up
<Oceanstuck>: in a normal situation talking to law enforcement is the sensible option. how are we gonna convince him to not do that without spooping him half to death
<SKM>: That is actually the hard part ^^;
<SKM>: I don’t know how to social engineer my way through that honestly
<SKM>: But
<SKM>: Him showing them the paper
<SKM>: Isn’t so bad
<SKM>: chances are they already knew
<Oceanstuck>: ok so were not fucked *yet*
<ARGdov>: Maybe we should tell him theres something up and to be careful. But then he probably wont trust us either
<wolfcat>: Well he already doesn’t put much stock in the police
<wolfcat>: Can’t be that hard
<wolfcat>: Especially since they didn’t do anything after Kevin disappeared
<Oceanstuck>: if we can explain why the turnaround in opinion on going to the feds, then yeah i guess
<Oceanstuck>: we just need to figure out how to explain the turnaround in opinion on going to the feds
<SKM>: Annnnnd the alarm has gone off
<SKM>: That is my que to leave
<ARGdov>: You better get out
<Oceanstuck>: bye skoom
<SKM>: to anyone taking note
<ARGdov>: Thnaks for the info!
<wolfcat>: Alright, thanks for all the help man
<Oceanstuck>: bye loom
<SKM>: hurry up
<SKM>: good bye for now friends
#chat
#skm
Chat with Tyler 5/29/15
Read chat below:
[9:33:09 PM] Tylep the rotaerc: HELLO
[9:33:23 PM] Mando 寒山: look who lives
[9:33:38 PM] Tylep the rotaerc: wut
[9:35:18 PM] The Sun: o fuk
[9:35:24 PM] The Sun: It’s asking me for previous teaching experience
[9:35:30 PM] The Sun: I’m just not going to put anything in
[9:38:33 PM] Eevee: Hi tyler
[9:38:53 PM] Tylep the rotaerc: Hello ^^;
[9:40:10 PM] Tylep the rotaerc: the past couple days have been pretty…. eventful
[9:40:30 PM] Eevee: Really? How have you been, safe, I hope
[9:44:33 PM] Tylep the rotaerc: Well yesterday my power finally came back
[9:45:10 PM] Tylep the rotaerc: it had been coming on and off really frequently just before hand
[9:45:30 PM] Tylep the rotaerc: and when it would I would get a phone call while the power was on
[9:47:21 PM] Eevee: Who was on the other end of the phone?
[9:47:41 PM] Tylep the rotaerc: I would pick up and hear silence right before the power would instantly go back off
[9:49:07 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Creepy
[9:49:26 PM] Tylep the rotaerc: However around the 6th or 7th time
[9:49:34 PM] Tylep the rotaerc: It came on and stayed on
[9:49:35 PM] Eevee: Yeah, did you get the number?
[9:49:48 PM] Eevee: like did you recognize it?
Tylep the rotaerc
[9:50:43 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh
[9:51:14 PM] Eevee: spooky
[9:51:26 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Probably just some kids prank calling you
[9:51:28 PM] Eevee: When they stayed on, did they say anything?
[9:51:29 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Happened to me once
[9:51:57 PM] Dovid Magady: Hello
[9:52:01 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hey arg
[9:52:42 PM] Tylep the rotaerc: I heard a kinda of garbled and stuttery voice talking, like its connection was shitty and over the internet.
[9:52:44 PM] Dovid Magady: That’s creepy
[9:52:50 PM] Tylep the rotaerc: In an english accent
[9:52:52 PM] Tylep the rotaerc: it said
[9:52:54 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: wait, over the internet?
[9:53:01 PM] Dovid Magady: By any chance did you record the call?
[9:53:04 PM] Tylep the rotaerc: “Right then, this is a test.”
[9:53:47 PM | Edited 9:53:58 PM] Tylep the rotaerc: The sound of it was similar to what I usually hear in a voice call over the web, when the connection starts to shit out.
[9:54:29 PM] Tylep the rotaerc: I was going to but couldn’t find my phone at the time
[9:54:44 PM] Tylep the rotaerc: which reminds me, I should go get that thing charged up.
[9:54:56 PM] Dovid Magady: That would be a good idea
[9:56:05 PM] Tylep the rotaerc: I decided to call the police earlier today
[9:56:14 PM] Tylep the rotaerc: A bit later than I planned
[9:56:26 PM] Eevee: Tyler, I noticed that you deleted the video you posted for the police
[9:56:35 PM] Dovid Magady: whatd they say?
[9:57:04 PM] Tylep the rotaerc: Well they told me to delete the video after I gave them a digital copy
[9:57:06 PM] Tylep the rotaerc: Said it was
[9:57:31 PM] Tylep the rotaerc: “Important to their investigation that I make sure anyone stalking you does not know you have evidence of them.”
[9:57:42 PM] Dovid Magady: That seems weird.
[9:57:47 PM] Tylep the rotaerc: They also took the weird paper from me.
[9:58:25 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hmm
[9:58:39 PM | Edited 9:59:07 PM] Eevee: Tyler, did the police act weird?
[9:58:57 PM] Tylep the rotaerc: and they spent about 6 hours or so questioning me about everything in the back room of the station.
[9:59:05 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: well we have the photos of it, and I think one of us downloaded the video, so we may still be able to help. Even if it is only minorly
[9:59:08 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: also wow 6 hours?
[9:59:29 PM] Dovid Magady: That seems extreme for a case like this. Your not a suspect in anything
[9:59:41 PM] Tylep the rotaerc: Most of my wait time was them walking off after a few questions and then not coming back for fucking ever
[9:59:58 PM] Dovid Magady: what kind of questions did they ask?
[10:00:20 PM] Tylep the rotaerc: “Did you see any detail of this man that was not captured on film”
[10:01:16 PM] Dovid Magady: Did you, by any chance?
[10:01:16 PM] Tylep the rotaerc: “Have you seen him since then”
[10:01:26 PM] Tylep the rotaerc: Well I mean not really ^^;
[10:02:08 PM] Tylep the rotaerc: I saw him moving back and forth and what looked like him leaning around before he seemed to just dimension jump into the fucking library and turn the lights on.
[10:02:31 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: yeah that’s really screwy
[10:02:39 PM] Dovid Magady: Well, that’s just creepy
[10:02:40 PM] Tylep the rotaerc: I still do not understand how he so quickly got in there
[10:03:04 PM | Edited 10:03:10 PM] Tylep the rotaerc: Or how he did it without walking past me, or atleast without me noticing him do it.
[10:03:14 PM] Eevee: Tyler, now that you’ve gone to the Police. You should probably lay low for a bit.
[10:04:25 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Yeah, they held you for a pretty long time
[10:04:42 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I’d lay low too, just to try to get rid of whoever might be stalking you too
[10:04:45 PM] Tylep the rotaerc: They asked me weird shit too
[10:05:02 PM] Tylep the rotaerc: “How close did you get to him?”
[10:05:42 PM] Tylep the rotaerc: “Did he make any noise?”
[10:06:11 PM] Tylep the rotaerc: “Did the footage make any notable changes during viewing?”
[10:06:23 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hmm
[10:06:32 PM] Eevee: That seems like legit questions.
[10:06:34 PM] Dovid Magady: Somethings weird
[10:06:51 PM] Tylep the rotaerc: The last one specifically felt weird in the various lines of questions
[10:07:00 PM] Eevee: What makes me feel suspicious is them asking to delete the video
[10:07:12 PM] Dovid Magady: If your stalking someone
[10:07:14 PM] Eevee: They shouldn’t have asked that
[10:07:32 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I mean the first two make general sence, The third one makes a little less, but I guess I understand it.
[10:07:34 PM] Tylep the rotaerc: but they just continued on with questions like it was nothing
[10:08:13 PM] Tylep the rotaerc: “Describe his movement patterns?”
[10:08:13 PM] Dovid Magady: and you found out your victim had evidence, wouldn’t you try to get rid of it or be even more careful?
[10:08:23 PM] Tylep the rotaerc: Is another slightly odd thing I recall
[10:08:26 PM] Dovid Magady: brb
[10:08:49 PM | Edited 10:08:56 PM] Tylep the rotaerc: like how the fuck do I answer that?
[10:08:59 PM] Tylep the rotaerc: he was moving
[10:09:07 PM] Tylep the rotaerc: he kind of leaned around a bit
[10:09:24 PM] Eevee: Y'know Tyler, between what you’ve told me about the way the cops handled the dissapearance of your friends, and now this, they seem suspicious
[10:09:30 PM] Tylep the rotaerc: idk I get a bad feeling this is gonna be another instance of the police doing jack shit
[10:09:50 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Hmm
[10:11:38 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: did you tell them about the seemingly teleporting movement patterns?
[10:12:14 PM] Tylep the rotaerc: I did tell them how he seemed to be in one place while I walked towards him
[10:12:21 PM] Tylep the rotaerc: then he was somehow in the library
[10:12:26 PM] Tylep the rotaerc: when I looked up again
[10:12:36 PM] Tylep the rotaerc: and they went away for a bit
[10:12:44 PM] Tylep the rotaerc: like 2 hours actually ^^;
[10:13:34 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I could kinda get why that’d be a bit strange, Missing friends, seeming stalker, teleporting guy, Some people could think that to be a bit off.
[10:14:17 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Not that we don’t believe you ofc, just that cops tend to be a bit more suspicious than most people (at least that’s what ive noticed, may not be like that everywhere tho)
[10:17:00 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Anyways, anything else happen?
[10:17:11 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: DId you call a technitian about your power or anything?
[10:17:32 PM] Tylep the rotaerc: Around 8:30 they let me go then I walked home and got here about 9
[10:17:49 PM] Tylep the rotaerc: I guess I should call a technician tomorrow.
[10:18:09 PM] Dovid Magady: That sounds good
[10:19:13 PM] Eevee: This all reminds me of creepy stories you read about where crazy shit happens, and the police can’t be trusted, cuz’ they’re in on it.
[10:19:21 PM] Eevee: lol
[10:19:27 PM] Eevee: I hope that’s not the case
[10:19:43 PM] Dovid Magady: yeah, lets hope not
[10:19:49 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Lol, creepypastas make me see everything as spookier than it should be
[10:20:16 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I should really stop reading scary shit at night
[10:20:31 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: stupid subconscious D<
[10:21:08 PM] Eevee: Still, it’s always good to be cautious
[10:21:38 PM] Dovid Magady: is there anyone you know who you couldstay with you until this blows over, tyler?
[10:21:44 PM] Dovid Magady: You know, to be safe
[10:22:10 PM] Tylep the rotaerc: I have no one ^^;
[10:22:22 PM] Dovid Magady: Oh, im sorry.
[10:22:40 PM | Edited 10:25:25 PM] Tylep the rotaerc: I mean I was leaving to go see my girlfriend at the end of the year like I do every year
[10:22:50 PM] Tylep the rotaerc: But that is not for another 6 months
[10:25:09 PM] Eevee: Well, anything else happen on your wild journey?
[10:25:56 PM] Tylep the rotaerc: Nothing else of note really
[10:26:35 PM] Eevee: Ah, I see
[10:27:01 PM] Tylep the rotaerc: I am feeling like I wanna go to sleep soon
[10:27:05 PM] Tylep the rotaerc: with airconditioning XD
[10:27:17 PM] Eevee: Yeah, it was really hot today
[10:27:18 PM] Dovid Magady: xD
[10:27:33 PM | Edited 10:27:42 PM] Eevee: I hope your power holds up
[10:28:14 PM] Dovid Magady: Yeah, get a repairman to check into that as soon as you can.
[10:28:15 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: yeah, fluctuating power sucks
[10:28:45 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Also, check with a few of your neighbors, Could have been a thing happening a few places and not just you
[10:31:06 PM] Eevee: Well, have a good night Tyler
[10:31:21 PM] Eevee: And be careful :)
[10:31:26 PM] Eevee: tust no one! lol
[10:31:42 PM] Captain “CircleHunter” Desdinova: especially not the police from what i just read
[10:31:50 PM] Eevee: ^^^ I agree
[10:31:57 PM] Dovid Magady: Watch out for them
[10:32:02 PM] Captain “CircleHunter” Desdinova: that’s just complete bullshit
[10:32:12 PM] Dovid Magady: And keep an eye out for anything.
[10:32:15 PM] Dovid Magady: What?
[10:35:34 PM] Eevee: I guess he fell asleep
[10:35:45 PM] Dovid Magady: He does that all the time
[10:35:56 PM] Dovid Magady: Just leaves without telling us, I mean.
[10:36:17 PM] Dovid Magady: By the way has anyone tried searching anything on the lunarchildren website?
[10:38:21 PM] Tylep the rotaerc: Yeah sorry nearly passed out at the key board again there
[10:38:34 PM] Tylep the rotaerc: what is the lunarchildren website?
[10:39:08 PM] Eevee: It’s a website we go to for spooks
[10:39:18 PM] Eevee: We are a spooky loving group
[10:40:11 PM] Tylep the rotaerc: Woah can I see it?
[10:40:22 PM] Eevee: sure
[10:41:09 PM] Eevee: http://lunarchildren.com/
[10:42:02 PM] Eevee: It’s a brand new website we are investigating
[10:42:46 PM] Eevee: We found it because I was tipped off by an annonymous phonecall as well
[10:44:04 PM] Eevee: Righ now, it seems as though there’s a group of people in some sort of “gang”
[10:44:18 PM] Tylep the rotaerc: Woah
[10:44:22 PM] Tylep the rotaerc: sounds pretty chooky
[10:44:31 PM] Eevee: We’re waiting to find out more stuff.
[10:44:47 PM] Dovid Magady: I have to go. The Sabbaths starting
[10:44:56 PM] Dovid Magady: I’’ see you all Saturday night
[10:44:58 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Cya arg!
[10:45:22 PM] Dovid Magady: Good luck to you all.
[10:45:52 PM] Eevee: Night dovid
[10:47:45 PM] Tylep the rotaerc: I am probably gonna go to bed too
[10:47:53 PM] Tylep the rotaerc: nighty nacht broskinos
[10:48:01 PM] Captain “CircleHunter” Desdinova: nighty
[10:48:12 PM] Captain “CircleHunter” Desdinova: do a safe and be a happy
[10:48:23 PM] Tylep the rotaerc: I hope tomorrow everything is ok, no fukn power outages, weird people or any need to call police.
[10:48:43 PM] Eevee: Ok, Tyler :P
[10:48:48 PM] Eevee: Have a great night
[10:48:51 PM] Tylep the rotaerc: nighty nacht
#chat
#tyler
itwasme.webm
johnisdead.com update 5/30/15
#johnisdead.com
#video
Chat with Tyler 5/31/15
Read more below:
[10:44:46 PM] Tylep the rotaerc: Im staying in a motel tonight
[10:44:52 PM] Captain “CircleHunter” Desdinova: Oh you’re safe!
[10:44:55 PM] Tylep the rotaerc: Im leaving my house now
[10:45:00 PM] Dovid Magady: Oh, hai, Tyler
[10:45:01 PM] Gabriel Leonardo: Oh? Cant stay home tonight, Tyler?
[10:45:06 PM] Captain “CircleHunter” Desdinova: Be very careful out there
[10:45:23 PM] Tylep the rotaerc: There was a person outside my house
[10:45:27 PM] Tylep the rotaerc: I caught it all on video
[10:45:28 PM] Dovid Magady: Whoa
[10:45:35 PM] Gabriel Leonardo: Oh crap
[10:45:37 PM] Dovid Magady: That’s bad.
[10:46:08 PM] Dovid Magady: Like really
[10:46:09 PM] Eevee: Tyler, please be very careful
[10:46:12 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: tyler
[10:46:19 PM] Tylep the rotaerc: I have been back for a while now but I am very shaken
[10:46:26 PM] Dovid Magady: You don’t know who that could be.
[10:46:28 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: you were gone for a while after saying you were going to “take care” of that guy
[10:46:38 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: it sounded like you were gonna go shoot him or something :L
[10:46:38 PM] Captain “CircleHunter” Desdinova: did you like
[10:46:39 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: anyways
[10:46:41 PM] Captain “CircleHunter” Desdinova: kill him?
[10:46:42 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: you ok tho?
[10:46:43 PM] Tylep the rotaerc: He left a recorder on one of my grandfathers old broken trucks
[10:46:50 PM] Tylep the rotaerc: I didn’t want to kill him
[10:46:50 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: That’s creepy
[10:46:53 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: good
[10:46:54 PM] Tylep the rotaerc: I just wanted him to leave
[10:47:03 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: those cops were strange enough, don’t want to have a murder on your hands
[10:47:04 PM] Tylep the rotaerc: But he was all over the fucking place
[10:47:13 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: whaddya mean
[10:47:20 PM] Tylep the rotaerc: I chased after him
[10:47:26 PM] Tylep the rotaerc: to try and scare him away
[10:47:34 PM] Tylep the rotaerc: and everywhere I would go
[10:47:46 PM] Tylep the rotaerc: it seemed like he would vanish and appear somewhere else
[10:48:14 PM] Captain “CircleHunter” Desdinova: that’s incredibly odd
[10:48:21 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: That is really spooky
[10:48:32 PM] Dovid Magady: That’s really weird.
[10:48:56 PM] Tylep the rotaerc: I chased him a decent ways into the woods to make sure he was off my property
[10:49:17 PM] Tylep the rotaerc: and then it seemed like I was going to have him out in the open because we were reaching the road
[10:49:31 PM] Tylep the rotaerc: once I had him out on the road
[10:49:35 PM] Tylep the rotaerc: he was just gone
[10:49:50 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Sounds like a creepypasta TBH
[10:49:52 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: that’s spooky
[10:49:56 PM] Captain “CircleHunter” Desdinova: What did he throw earlier?
[10:50:29 PM] Tylep the rotaerc: It looked like a lid to a container
[10:50:46 PM] Tylep the rotaerc: thinking back on it actually
[10:50:56 PM] Tylep the rotaerc: it looked like it came off of one of my bait buckets
[10:51:32 PM] Tylep the rotaerc: Im going to try to upload the video to my chanel straight from my phone
[10:51:38 PM] Dovid Magady: Do you guys think this guy may be supernatural?
[10:51:42 PM] Tylep the rotaerc: but I am leaving now
[10:51:49 PM] Tylep the rotaerc: I don’t know or care what he is
[10:52:06 PM] Tylep the rotaerc: I have a night set up at an inn down the road
[10:52:13 PM] Captain “CircleHunter” Desdinova: Good
[10:52:23 PM] Dovid Magady: That sounds good
[10:52:30 PM] Eevee: Tyler, please be very careful
[10:52:36 PM] Tylep the rotaerc: Im going to have to go in the dark now that the sun has set
[10:52:36 PM] Dovid Magady: You should be careful, really
[10:52:38 PM] Eevee: Don’t answer the door to anyone
[10:52:40 PM] Tylep the rotaerc: but fuck it
[10:52:45 PM] Dovid Magady: WHOA
[10:52:46 PM] Tylep the rotaerc: Its better than being here
[10:52:55 PM] Dovid Magady: Are you sure that’s a good idea?
[10:53:06 PM] Tylep the rotaerc: I wanna think he is gone
[10:53:21 PM] Eevee: Tyler, will/can you contact us as soon as you get to your hotel room?
[10:53:28 PM] Tylep the rotaerc: Yes Ill try
[10:53:32 PM] Eevee: Good.
[10:53:33 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Sweet
[10:53:50 PM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: we don’t want anything bad to happen to ya, and I think its safe to say we’re all interested in whats happening
[10:53:54 PM] Tylep the rotaerc: and Ill try to get the video uploaded from my phone
[10:54:04 PM] Eevee: ok
[10:54:05 PM] Tylep the rotaerc: I have to leave now
[10:54:09 PM] Tylep the rotaerc: I don’t feel safe
[10:54:12 PM] Eevee: Take care Tyler
Video from Tyler, posted in the ID Main Skyp Chat on 6/1/15
(Source: youtube.com)
#tyler
#video
Chat with Tyler 6/1/15
Read more below:
[6/1/2015 2:01:21 AM] Tylep the rotaerc: Hey guys
[6/1/2015 2:01:27 AM] Eevee: Hi!
[6/1/2015 2:01:27 AM] Captain “CircleHunter” Desdinova: Hi
[6/1/2015 2:01:33 AM] uoslǝN ʞɔɐZ: hI
[6/1/2015 2:01:33 AM] Captain “CircleHunter” Desdinova: Thorin has terrible timing
[6/1/2015 2:01:36 AM] The Chosen: Hey!
[6/1/2015 2:01:38 AM] Eevee: Lol
[6/1/2015 2:01:49 AM] The Chosen: Is everything all right, man?
[6/1/2015 2:02:17 AM] Master Swordsman, Faut: WHAT HAPPENED
[6/1/2015 2:02:43 AM] Sprikiroid: wow literally two minutes after he leaves
[6/1/2015 2:02:58 AM] Eevee: BTW, is anyone on that cipher?
[6/1/2015 2:03:24 AM | Edited 2:03:36 AM] Tylep the rotaerc: Well I gathered some clothes and shit and threw them in a bag and hauled ass to the inn down the road from my house after I hastly booked a last minute room over the phone
[6/1/2015 2:04:38 AM] Eevee: Do you feel safe?
[6/1/2015 2:04:55 AM] Tylep the rotaerc: As safe as I can be
[6/1/2015 2:05:00 AM] The Chosen: did anything strange on the way there?
[6/1/2015 2:05:04 AM] Sprikiroid: [Monday, June 01, 2015 2:02 AM] Eevee:
<<< BTW, is anyone on that cipher?I would be if I knew what the hell it was
[6/1/2015 2:05:14 AM] Tylep the rotaerc: there are people in the rooms next to me
[6/1/2015 2:05:25 AM] Tylep the rotaerc: which has not been a thing for about 2 years now
[6/1/2015 2:05:35 AM] The Chosen: must be weird
[6/1/2015 2:07:39 AM] Tylep the rotaerc: I felt like I was being watched the moment I stepped outside
[6/1/2015 2:08:06 AM] Tylep the rotaerc: I wish I hadn’t wasteds all the time chasing the guy through the woods before and I would have had some day light left to run to the inn
[6/1/2015 2:08:24 AM] Tylep the rotaerc: I think I dropped some clothes on the way
[6/1/2015 2:08:33 AM] Tylep the rotaerc: but I couldn’t really see
[6/1/2015 2:08:34 AM] Eevee: Were you able to upload the video?
[6/1/2015 2:08:55 AM] Tylep the rotaerc: I am trying to now that I am somewhere sitting still and semi safe
[6/1/2015 2:12:28 AM] Eevee: Look through your things, hopefully you didn’t drop anything important
[6/1/2015 2:16:15 AM] Tylep the rotaerc: I have everything except a couple shirts I guess I dropped
[6/1/2015 2:16:29 AM] The Chosen: Oh, that’s not so bad, then.
[6/1/2015 2:16:34 AM] Tylep the rotaerc: I remember having 3 but now I only have 1
[6/1/2015 2:16:46 AM] The Chosen: oh. not so good,I guess
[6/1/2015 2:17:13 AM] Eevee: Don’t go back for them
[6/1/2015 2:23:47 AM] Tylep the rotaerc: The fucking shit in this video
[6/1/2015 2:24:01 AM] Tylep the rotaerc: what the hell is this guy
[6/1/2015 2:24:33 AM] Eevee: ??
[6/1/2015 2:26:57 AM] Tylep the rotaerc: https://youtu.be/wxyzQfSbD_g
[6/1/2015 2:27:02 AM] Tylep the rotaerc: there its uploaded
[6/1/2015 2:27:08 AM] Tylep the rotaerc: Ill be right back
[6/1/2015 2:27:11 AM] Tylep the rotaerc: I need a drink
[6/1/2015 2:29:53 AM] The Chosen: Thanks!
[6/1/2015 2:31:13 AM] Sprikiroid: I think I heard the happy birthday song around 2:47
[6/1/2015 2:32:10 AM] The Chosen: There are eyes
[6/1/2015 2:32:16 AM] The Chosen: 1:58
[6/1/2015 2:35:24 AM] Captain “CircleHunter” Desdinova: Bongo Bongo when the man appears
[6/1/2015 2:36:32 AM] The Chosen: tyler, is there anyway we can get a dgital copy of what was on the recorder?
[6/1/2015 2:37:13 AM] The Chosen: Wait, this isn’t the tall guy?
[6/1/2015 2:42:22 AM] Captain “CircleHunter” Desdinova: woah shit
[6/1/2015 2:42:26 AM] Captain “CircleHunter” Desdinova: that was trippy
[6/1/2015 2:42:32 AM] The Chosen: yeah, at the end?
[6/1/2015 2:43:36 AM] Eevee: When he brandished the knife, I laughed more than I should have
[6/1/2015 2:45:26 AM] The Chosen: you sure you should say that?
[6/1/2015 2:47:25 AM] Eevee: Sure, why not. He’s right though, he should have a gun
[6/1/2015 2:48:01 AM] The Chosen: Well, that’s hard to disagree with. But he cant risk going back
[6/1/2015 2:50:36 AM] The Chosen: If I were him, I would try and get as far away as I possibly could.
[6/1/2015 2:50:40 AM] Tylep the rotaerc: Laughing huh?
[6/1/2015 2:50:52 AM] Tylep the rotaerc: Sorry I can’t have the army surplus on standby
[6/1/2015 2:51:13 AM] Eevee: No, I wish you could get away as far as possible
[6/1/2015 2:51:23 AM] Tylep the rotaerc: But I mean I was expecting some punk ass kid or something
[6/1/2015 2:52:09 AM] Tylep the rotaerc: A knife would be fine for some stupid kid or drug addict from around my town
[6/1/2015 2:52:20 AM] The Chosen: and that’s not who it was?
[6/1/2015 2:52:21 AM] Eevee: Me too, but now it seems as though it’s something far more sinister
[6/1/2015 2:52:34 AM] The Chosen: What did this guys mask look like?
[6/1/2015 2:53:28 AM] Tylep the rotaerc: It had some fur around the edges and was bumpy and tan
[6/1/2015 2:53:39 AM] Tylep the rotaerc: with no facial features
[6/1/2015 2:53:50 AM | Edited 2:53:59 AM] Tylep the rotaerc: except what kind of looked like holes at the top
[6/1/2015 2:54:34 AM] Eevee: Hmmm
[6/1/2015 2:55:58 AM] Eevee: Anything funny happening at the inn?
[6/1/2015 2:56:05 AM] Tylep the rotaerc: no
[6/1/2015 2:56:08 AM] Eevee: Good
[6/1/2015 2:56:18 AM] Tylep the rotaerc: most everyone is sleeping
[6/1/2015 2:56:25 AM] The Chosen: Did the mask look anything like an animal?
[6/1/2015 2:56:58 AM] Tylep the rotaerc: No animal I have ever seen
[6/1/2015 2:57:22 AM] The Chosen: you should be safe, right?
[6/1/2015 2:57:50 AM] Tylep the rotaerc: Im not too fucking amused by the fact that in the end of the video he stalked me all the way back to my house again
[6/1/2015 2:58:05 AM] The Chosen: That was strang
[6/1/2015 2:58:20 AM] Tylep the rotaerc: Im over reacting to all of this shit right now though
[6/1/2015 2:58:22 AM] The Chosen: and that was an understatement
[6/1/2015 2:58:36 AM] The Chosen: What I said, to be exact
[6/1/2015 2:58:50 AM] Tylep the rotaerc: Weird shit was in the video
[6/1/2015 2:59:20 AM] Eevee: Tyler, have you considered that something supernatural maybe happening?
[6/1/2015 2:59:27 AM] Tylep the rotaerc: my camera has been weird on my phone since I saw the tall guy, maybe because it was sprinkling a bit and the phone isn’t supposed to get wet
[6/1/2015 3:00:11 AM] The Chosen: I think that’s the case, to be honest
[6/1/2015 3:00:19 AM] Tylep the rotaerc: I felt like the guy was teleporting or something.
[6/1/2015 3:00:26 AM] Tylep the rotaerc: But in all honesty
[6/1/2015 3:00:44 AM] Tylep the rotaerc: He could have just been damn good at sneaking around the woods
[6/1/2015 3:01:01 AM | Edited 3:01:09 AM] Eevee: Do you have enemies?
[6/1/2015 3:01:17 AM] Tylep the rotaerc: Not that I know of
[6/1/2015 3:02:29 AM] The Chosen: remind me, when did all this start happening?
[6/1/2015 3:03:30 AM] Tylep the rotaerc: Weird people stalking me?
[6/1/2015 3:03:34 AM] The Chosen: Yeah.
[6/1/2015 3:03:40 AM] Eevee: My guess, is that there’s some people who are screwing with you. I have a few suspicions.
[6/1/2015 3:04:08 AM] Tylep the rotaerc: A few nights ago when I thought I would go walk to kevins house and I saw that weird guy get into the library.
[6/1/2015 3:04:19 AM] Tylep the rotaerc: Then someone left that paper at my doorstep
[6/1/2015 3:04:33 AM] Tylep the rotaerc: then the police didn’t do shit about it
[6/1/2015 3:04:35 AM] Tylep the rotaerc: now this
[6/1/2015 3:04:46 AM] Eevee: The police won’t help you
[6/1/2015 3:05:05 AM] The Chosen: So, when you started looking into krvins disappearance, then?
[6/1/2015 3:05:12 AM] The Chosen: That cant be coincidence
[6/1/2015 3:06:35 AM] Eevee: Tyler, how’s your memory?
[6/1/2015 3:06:53 AM] Eevee: Have you forgotten stuff recently?
[6/1/2015 3:07:20 AM] Tylep the rotaerc: My memory is fine
[6/1/2015 3:07:36 AM] Tylep the rotaerc: and why would it not be a coincidence?
[6/1/2015 3:08:18 AM] The Chosen: It seems weird
[6/1/2015 3:08:31 AM] The Chosen: You look into the house of your friend who disapeared
[6/1/2015 3:08:41 AM] The Chosen: And then your getting stalked by people.
[6/1/2015 3:09:17 AM] Eevee: I have a sneaking suspicion it has something to do with that religion he was a part of.
[6/1/2015 3:09:22 AM] Tylep the rotaerc: My phone is about to die
[6/1/2015 3:09:30 AM] The Chosen: It could be
[6/1/2015 3:09:37 AM] Eevee: OK, Tyler.
[6/1/2015 3:09:45 AM] Eevee: Please be safe
[6/1/2015 3:09:53 AM] The Chosen: Allright.
[6/1/2015 3:10:08 AM] The Chosen: Goodnight, tyler.
[6/1/2015 3:10:35 AM] Eevee: We’re here for you, if you need to talk
[6/1/2015 3:10:37 AM] Tylep the rotaerc: I don’t know a damn thing about his religion
[6/1/2015 3:10:39 AM] Tylep the rotaerc: I never did
[6/1/2015 3:10:43 AM | Edited 3:11:07 AM] Tylep the rotaerc: and he would never tell me
[6/1/2015 3:10:44 AM] Eevee: I know
[6/1/2015 3:11:01 AM] Tylep the rotaerc: and I don’t understand how that could have anythign to do with this
[6/1/2015 3:11:21 AM] The Chosen: it could, you never know
[6/1/2015 3:11:23 AM] Eevee: But, maybe they have something to do with his dissapearance
[6/1/2015 3:11:49 AM] Eevee: And you asking questions made them mad
[6/1/2015 3:12:03 AM] Eevee: Just throwing out an idea
[6/1/2015 3:12:03 AM] The Chosen: In both that case of him disappearing and with the stalker, the police have been unhelpful/suspicious.
[6/1/2015 3:12:11 AM] The Chosen: We could be wrong
[6/1/2015 3:12:51 AM] The Chosen: But it seems like it could be likely
[6/1/2015 3:13:15 AM] Tylep the rotaerc: Im going to try to sleep for now
[6/1/2015 3:13:39 AM] Eevee: OK, Tyler.
[6/1/2015 3:13:41 AM] Tylep the rotaerc: I have a lot of shit on my mind
[6/1/2015 3:13:47 AM] Eevee: I understand
[6/1/2015 3:14:02 AM | Edited 3:14:06 AM] Eevee: Try to rest
[6/1/2015 3:14:10 AM] The Chosen: Good night, tyler
[6/1/2015 3:14:11 AM] Tylep the rotaerc: Im not going to leave my home because of some fucker in a shitty halloween costume
[6/1/2015 3:14:36 AM] Tylep the rotaerc: Im going back home day after tomorrow
[6/1/2015 3:15:04 AM] Eevee: OK, give it some time to calm down
[6/1/2015 3:15:27 AM] The Chosen: All right. you should probably wait, you’re rigght
[6/1/2015 3:15:29 AM] Eevee: Let know you’re safe.
[6/1/2015 3:15:30 AM] Tylep the rotaerc: I may go back tomorrow for my charger though
[6/1/2015 3:15:37 AM] Tylep the rotaerc: Because in the rush I forgot it
[6/1/2015 3:15:59 AM] Tylep the rotaerc: Im going for now
[6/1/2015 3:16:05 AM] Tylep the rotaerc: goodnight broskinos
<nowiki#tyler
- chat</nowiki>
Chat with Tyler 6/2/15
Read more below:
[1:38:16 AM] Tylep the rotaerc: Hey everybody
[1:38:26 AM] Sprikiroid: nope, nothing new there yet
[1:38:36 AM] Captain “CircleHunter” Desdinova: sup
[1:38:42 AM] Dovid Magady: Hey, tyler
[1:38:45 AM] Oceanstuck: well shit so much for going to bed i guess
[1:38:48 AM] Oceanstuck: sup typles
[1:39:17 AM] Dovid Magady: You doing ok, tyler?
[1:41:15 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh hey tyler
[1:43:32 AM] Tylep the rotaerc: hello
[1:43:55 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: everything go good with the Hotel?
[1:44:02 AM] Dovid Magady: Hows your day been, tyler?
[1:44:09 AM] Tylep the rotaerc: its been
[1:44:36 AM] Tylep the rotaerc: I went home today for a short bit to get my charger
[1:44:51 AM] Oceanstuck: sure thats safe?
[1:45:34 AM] Tylep the rotaerc: no it wasn’t
[1:45:45 AM] Oceanstuck: didnt think so
[1:45:48 AM] Tylep the rotaerc: but I figured fuck it and just took the walk
[1:45:54 AM] Tylep the rotaerc: during the day of course
[1:46:03 AM] Dovid Magady: that should have been allright
[1:46:27 AM] Oceanstuck: well
[1:46:33 AM] Oceanstuck: couldve been worse i guess
[1:46:57 AM] Tylep the rotaerc: I have spent most of the day walking around trying to clear my head
[1:47:08 AM] Tylep the rotaerc: and I was procrastinating going to my house
[1:47:11 AM] Tylep the rotaerc: but I did
[1:47:24 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: You should listen to some Vaporwave. Might help ya calm down
[1:47:47 AM] Tylep the rotaerc: I actually was once I got my phone charged
[1:47:55 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: niice
[1:48:09 AM] Sprikiroid: The hotel room you’re staying in, does it have a nice view?
[1:48:17 AM] Sprikiroid: or is it like a shitty motel like in Psycho
[1:48:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: [1:48 AM] Sprikiroid:
<<< like in Psychoprob shouldn’t compare a creepy situation with horror.
[1:48:56 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: :L
[1:49:05 AM] Oceanstuck: yeah probably a bit too soon for that
[1:49:12 AM] Tylep the rotaerc: Im on the top floor actually as of this morning
[1:49:12 AM] Wolfcat: we only got shitty crackhead motels around here
[1:49:14 AM] Dovid Magady: Undoubtly
[1:49:22 AM] Sprikiroid: very nice
[1:49:24 AM] Tylep the rotaerc: Idk why but I was told I had to relocate myself
[1:49:32 AM] Dovid Magady: weird
[1:49:33 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Huh
[1:49:36 AM] Oceanstuck: relocate?
[1:49:45 AM] Dovid Magady: Did the people in the other room complain or something?
[1:49:58 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: was it like, Move from room 592 to 600 or something
[1:50:17 AM] Tylep the rotaerc: to room 592 after the inn got some call from oversees management or something about my room needing to be inspected
[1:50:22 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh woah
[1:50:26 AM | Edited 1:50:38 AM] Tylep the rotaerc: They didn’t really go into too much detail ^^;
[1:50:33 AM] Oceanstuck: woah
[1:50:35 AM] Oceanstuck: spoopy
[1:50:39 AM] Dovid Magady: That sounds strange
[1:50:45 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: wow I guessed your room number perfectly :L
[1:50:48 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: im scared now
[1:50:53 AM] Dovid Magady: this is a chain hotel then?
[1:50:53 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I never get things that wright
[1:50:58 AM] Dovid Magady: Like the holiday inn?
[1:51:13 AM] Tylep the rotaerc: This place used to be a holiday inn actually
[1:51:20 AM] Dovid Magady: oh. wow.
[1:51:28 AM] Tylep the rotaerc: I remember it was back when I was a little kid
[1:51:37 AM] Oceanstuck: what happened to it
[1:51:37 AM] Dovid Magady: Who owns it now?
[1:51:53 AM] Tylep the rotaerc: I don’t feel to comfortable at the moment giving off every detail of where Im at ^^;
[1:51:59 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol yeah
[1:52:03 AM] Oceanstuck: fair enough
[1:52:09 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I mean
[1:52:10 AM] Dovid Magady: sorry. Yyour right
[1:52:11 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: that makes sence
[1:52:25 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: if hes being stalked
[1:52:33 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: I doubt he’d want to say where he is
[1:53:42 AM] Wolfcat: oh yeah that weird recording device thingy
[1:53:56 AM] Wolfcat: I can’t make out what it says
[1:54:02 AM] Dovid Magady: Do you have a digital copy of what it is?
[1:54:10 AM] Tylep the rotaerc: At this point I can’t either
[1:54:16 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: huh
[1:54:24 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: any guesses?
[1:54:39 AM] Tylep the rotaerc: the quality of the sound in the device seems to get shittier each time I play it
[1:54:50 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh damn
[1:54:56 AM] Oceanstuck: wo
[1:55:00 AM | Edited 1:55:05 AM] Dovid Magady: weird
[1:57:28 AM] Oceanstuck: any idea what to do now?
[1:57:58 AM] Tylep the rotaerc: Im actually gonna try and record what it sounds like now and send it to you guys
[1:58:06 AM] Dovid Magady: K.
[1:58:07 AM] Tylep the rotaerc: its gotten rather fucky
[1:58:10 AM] Oceanstuck: stay safe
[1:58:22 AM] Tylep the rotaerc: Im in my room =I
[1:58:24 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Alright
[1:58:42 AM] Oceanstuck: tru
[1:59:17 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh I have a question, is the hotel your at a decent hotel? Like, i’m trying to figure out if its really nice, clean, fancy ect. or if its like, run down trailer park quality hotel
[1:59:27 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: my brain isn’t sure what to go with
[1:59:30 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: :L
[2:05:59 AM] Oceanstuck: its so quiet in here…
[2:06:16 AM] Dovid Magady: I hate it when it gets like this.
[2:06:33 AM] Dovid Magady: Did you get the download by anychance yet, Tyler?
[2:07:53 AM] Tylep the rotaerc: download?
[2:08:20 AM] Oceanstuck: i think he means the recording
[2:08:48 AM] Tylep the rotaerc: yeah I got it hold on
[2:09:04 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh also sorry if my last question sounded a bit creepy
[2:09:05 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: .-.
[2:09:11 AM] *** ***
[2:09:20 AM] Dovid Magady: Thanks!
[2:10:02 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: oh damn
[2:10:09 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: lol
[2:10:17 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: it sounds like a pencil sharpener I have
[2:10:26 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: its a monster dude
[2:10:38 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: you have him eat the pencil, it sounds like hes eating it when he chews
[2:10:43 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: when you take it out he burps
[2:10:51 AM | Edited 2:11:05 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: but its more ofa LOOEEHKKK
[2:11:04 AM] Captain “CircleHunter” Desdinova: dem bedsprings
[2:11:08 AM] Oceanstuck: i cant hear it my audios broken
[2:11:08 AM | Edited 2:11:13 AM] Oceanstuck: per usual
[2:11:27 AM] Oceanstuck: thankfully im finally getting that shit checked out this weekend
[2:11:52 AM] Dovid Magady: It kind of sounds like weird throat sounds
[2:12:14 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i’d record the pencil sharpener
[2:12:23 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: but its late and i’m supposed to be going to sleep
[2:12:32 AM] Oceanstuck: lol same
[2:12:48 AM] Oceanstuck: id sleep but i have shit to take care of
[2:13:05 AM] Oceanstuck: and also this is really attention-grabbing
[2:13:11 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: i’d sleep but I was just gonna go play some xenoblade till like 2
[2:13:34 AM] Wolfcat: I’m gonna head out. Noight
[2:13:38 AM] Oceanstuck: night wolf
[2:13:42 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Cya
[2:13:46 AM] Tylep the rotaerc: Woah fuck
[2:13:50 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: ?
[2:13:52 AM] Dovid Magady: Night, wolf
[2:13:55 AM] Dovid Magady: What is it?
[2:14:02 AM] Tylep the rotaerc: some guy just got carted out of his room
[2:14:07 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Oh shit
[2:14:08 AM] Dovid Magady: Why?
[2:14:10 AM] Oceanstuck: what why
[2:14:44 AM] Tylep the rotaerc: Idk I was walking around on the first floor hallway cause its the only one with a vending machine oddly enough
[2:15:00 AM] Tylep the rotaerc: and I just watched this guy getting carried out by paramedics from his room
[2:15:09 AM] Tylep the rotaerc: Im not sure what just happened to him
[2:15:22 AM] Dovid Magady: Can you try asking someone?
[2:15:28 AM] Oceanstuck: did it look like he had anything in particular
[2:16:15 AM] Tylep the rotaerc: He looked kind of old so maybe he is just having an old broskino problemo
[2:16:27 AM] Dovid Magady: Seizure maybe?
[2:16:33 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: prob a heart attack or somethin
[2:16:45 AM] Oceanstuck: makes sense
[2:17:18 AM] Tylep the rotaerc: He was shouting “152” over and over right before they got him out of the hallway.
[2:17:27 AM] Oceanstuck: 152?
[2:17:31 AM] Dovid Magady: Ok, that’s strange
[2:17:31 AM] Tylep the rotaerc: I think that was his room number
[2:17:33 AM] Tylep the rotaerc: idk
[2:17:46 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: How old did he look?
[2:17:52 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: could have been some sort of PTSD
[2:18:03 AM] Eevee: Ahem ;)
[2:18:10 AM] Oceanstuck: hey eevee
[2:18:30 AM] Tylep the rotaerc: I live next to a retirement community so he was probs in his 60’s but idk
[2:19:01 AM] Dovid Magady: Hey, eve
[2:20:02 AM] Eevee: Tyler, did you get what you needed from the vending machines?
[2:20:23 AM] Tylep the rotaerc: lol yeah, I was grabbing a butter finger.
[2:20:29 AM] Eevee: If so, you should get back to your room.
[2:20:42 AM] Tylep the rotaerc: Thats the plan
[2:20:47 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: [2:20 AM] Tylep the rotaerc:
<<< butter finger.classy
[2:20:53 AM] Tylep the rotaerc: Its pretty late honestly
[2:21:02 AM] Tylep the rotaerc: I am probs about to go to bed
[2:21:08 AM] Eevee: I’m an Almond Joy girl…
[2:21:14 AM] Oceanstuck: i like crunch
[2:21:17 AM] Oceanstuck: or kit kat
[2:21:34 AM] Dovid Magady: Kit Kats and crunchs are the besy
[2:21:49 AM] Eevee: On 6/2/2015, at 2:21 AM, Tylep the rotaerc wrote:
> I am probs about to go to bed
OK, if anything else happens, let us know.
[2:21:55 AM] Sprikiroid: night Tyler
[2:21:55 AM] Dovid Magady: Night, tyler
[2:21:59 AM] Tylep the rotaerc: righto broskino
[2:22:01 AM] Eevee: I’m glad you’re safe
[2:22:10 AM] Tylep the rotaerc: Ill most likely return home tomorrow
[2:22:16 AM] ᴹᶦᶰᶦˢʰ ᴬᴰᵁᴸᵀ_ᴸᴵᴺᴷ: Cool
[2:22:19 AM] Tylep the rotaerc: Thnx me too ^^;
[2:22:21 AM] Oceanstuck: night broskino
[2:22:30 AM] Tylep the rotaerc: nighty nacht broskinos
#tyler
#chat
control.webm
johnisdead.com main page update - 6/4/15
#johnisdead.com
#video
blood-moon.avi
lunarchildren.com/archives - update 6/5/15
#lunarchildren.com
#video
Whenever /Patrem\ says "Child"... I melt.
Chat with Tyler 6/4/15
Read more below:
[6/4/2015 11:01:53 PM] Tylep the rotaerc: I have returned home at long last
[6/4/2015 11:01:54 PM] Wolfcat: NO CHOICE
[6/4/2015 11:02:06 PM] Wolfcat: oh hey
[6/4/2015 11:02:07 PM] Gabriel Leonardo: Hey Tyler, how was your stay?
[6/4/2015 11:03:07 PM] Tylep the rotaerc: Pretty chill ^^
[6/4/2015 11:03:34 PM] Gabriel Leonardo: Feeling better?
[6/4/2015 11:04:31 PM] Tylep the rotaerc: as good as I can be tbh
[6/4/2015 11:04:34 PM] Tylep the rotaerc: I mean
[6/4/2015 11:04:56 PM] Tylep the rotaerc: I feel like there are probably people stalking me even now
[6/4/2015 11:05:20 PM] Tylep the rotaerc: But I havent seen anything out of the ordinary since I have returned
[6/4/2015 11:05:46 PM] Tylep the rotaerc: I started back at work again as well so atleast thats something.
[6/4/2015 11:05:59 PM] Tylep the rotaerc: everything has been pretty good the past couple days
[6/4/2015 11:07:16 PM] ADULT_LINK: That’s good
[6/4/2015 11:09:58 PM] Tylep the rotaerc: Im also going to be looking into getting soem security cameras soon
[6/4/2015 11:10:07 PM] Tylep the rotaerc: probably a good gun as well
[6/4/2015 11:10:10 PM] ADULT_LINK: Thats probably smart
[6/4/2015 11:10:15 PM] ADULT_LINK: Ooh a gun
[6/4/2015 11:10:23 PM] Gabriel Leonardo: I’m not sure about having a gun
[6/4/2015 11:10:32 PM] Gabriel Leonardo: Like, sure, it can protect you
[6/4/2015 11:10:48 PM] Gabriel Leonardo: But you’d need to keep an eye on it always
[6/4/2015 11:11:02 PM] Gabriel Leonardo: Or it could be taken from you and then it’ll literally backfire
[6/4/2015 11:11:07 PM] ADULT_LINK: Yeah
[6/4/2015 11:11:10 PM] Gabriel Leonardo: maybe something a bit less dangerous?
[6/4/2015 11:11:26 PM] Tylep the rotaerc: Idk
[6/4/2015 11:11:43 PM] Gabriel Leonardo: Long-range Taser guns are effective
[6/4/2015 11:11:52 PM] Gabriel Leonardo: Or maybe a concealed one that looks like an umbrella?
[6/4/2015 11:11:53 PM] ADULT_LINK: tasers are cool
[6/4/2015 11:12:07 PM] Wolfcat: Anything could be taken and backfire honestly
[6/4/2015 11:12:15 PM] Tylep the rotaerc: I would feel safer knowing I have a weapon that can blow Mr.Masks brains out before he decides to Mgs his ass over to my house again.
[6/4/2015 11:12:18 PM] Wolfcat: though it’d be badass to have a machette
[6/4/2015 11:12:20 PM] Tylep the rotaerc: I would just call the police
[6/4/2015 11:12:26 PM] Gabriel Leonardo: Well, if a taser backfires, you’d get paralyzed
[6/4/2015 11:12:32 PM] Tylep the rotaerc: but they will probably once again
[6/4/2015 11:12:39 PM] Tylep the rotaerc: do litterally nothing but make my day worse
[6/4/2015 11:12:42 PM] Gabriel Leonardo: If a gun backfires, you probs couldn’t tell the tale at all
[6/4/2015 11:13:18 PM] Wolfcat: this is murrica son
[6/4/2015 11:13:27 PM] Gabriel Leonardo: Not for me :P
[6/4/2015 11:13:35 PM] Tylep the rotaerc: woah wut is it for u?
[6/4/2015 11:14:47 PM] Gabriel Leonardo: I live in South America
[6/4/2015 11:14:51 PM] Gabriel Leonardo: Not the states
[6/4/2015 11:16:19 PM] Tylep the rotaerc: Oh I see now, venezuela sounds like a pretty coolio place from what I have heard.
[6/4/2015 11:16:36 PM] Gabriel Leonardo: …It… Kind of isn’t
[6/4/2015 11:16:42 PM] Gabriel Leonardo: Strange, I feel Deja Vu
[6/4/2015 11:16:47 PM] ADULT_LINK: wait
[6/4/2015 11:16:57 PM] ADULT_LINK: he never said it was Venezuela tho….
[6/4/2015 11:17:06 PM] Tylep the rotaerc: My old friend denny used to make it out to be coolio from what he described lol
[6/4/2015 11:17:21 PM] Gabriel Leonardo: Interesting…
[6/4/2015 11:18:00 PM] Gabriel Leonardo: “Cursed, takes the souls of those there”
[6/4/2015 11:18:14 PM] Gabriel Leonardo: Scarily accurate, but not nailed
[6/4/2015 11:18:39 PM] Tylep the rotaerc: >the spirit of his dance
[6/4/2015 11:18:49 PM] Tylep the rotaerc: nigga be describing some next level shit
[6/4/2015 11:19:02 PM] Tylep the rotaerc: I wanna do the lsd he does lol
[6/4/2015 11:19:11 PM] Gabriel Leonardo: Oh
[6/4/2015 11:19:16 PM] ADULT_LINK: lol
[6/4/2015 11:19:17 PM] Gabriel Leonardo: That explains…. Waaaaaaaaaaay too much
Tylep the rotaerc
[6/4/2015 11:20:57 PM] ADULT_LINK: lol
[6/4/2015 11:21:04 PM] ADULT_LINK: poor maggie
[6/4/2015 11:21:53 PM] Gabriel Leonardo: I’d say…
[6/4/2015 11:23:03 PM] Stevey “Kyubey: Son of Satan” Freeman: 5 shots o rum ago
[6/4/2015 11:24:27 PM] Gabriel Leonardo: Feisbewk pls
[6/4/2015 11:28:23 PM] Tylep the rotaerc: Welp I just remembered I have work early in the morning so I am actually gonna head off to bed
[6/4/2015 11:29:10 PM] ADULT_LINK: Cya tyler
[6/4/2015 11:29:19 PM] Gabriel Leonardo: Night, Bro
[6/4/2015 11:29:36 PM] Tylep the rotaerc: Just wanted to say all is well now broskinos
[6/4/2015 11:29:39 PM] Tylep the rotaerc: for now anyways
[6/4/2015 11:29:52 PM] Tylep the rotaerc: I am expecting everything to stay smooth for now
[6/4/2015 11:31:24 PM] ADULT_LINK: Cool
[6/4/2015 11:31:58 PM] ADULT_LINK: Yo, anyone on janus?
[6/4/2015 11:32:14 PM] Tylep the rotaerc: nighty nacht broskinos ^^
#tyler
#chat
Track: Call with John #1
The first call with John Mesic 6/8/15
Read transcript below:
John: I’m not the one you seek (not in audio)
Circlehunter: John?
Circlehunter: What do you mean? What do you mean?
Circlehunter: uhg, what do you mean you’re not the one we seek?
(music)
John: I mean (inaudible)
(music)
John: (inaudible)
(music)
John: (inaudible)
(music)
Call ends
(if anyone can understand what john said, please submit the transcript asap)
#john
#audio
ID Tyler Info Fail 6/8/15
Read more below
[6/8/2015 10:51:36 PM] Tylep the rotaerc: Woah nelleh
[6/8/2015 10:51:36 PM] Eevee: Hi tyler!
[6/8/2015 10:51:38 PM] Master Swordsman, Faut: your icon looks creepy XD
[6/8/2015 10:51:39 PM] Tylep the rotaerc: woah woah woah
[6/8/2015 10:51:45 PM] Tylep the rotaerc: hey broskinos ^^
[6/8/2015 10:51:58 PM] Tylep the rotaerc: Was actually just cheking in really quick
[6/8/2015 10:51:59 PM] Gabriel Leonardo: Yo, Tylerino
[6/8/2015 10:52:02 PM] Kaizell, Seeker Of Wisdom (K♦): Got a question for ya
[6/8/2015 10:52:04 PM] Oceanstuck: sup typles
[6/8/2015 10:52:07 PM] Tylep the rotaerc: I woke up a little late for my nightshift ^^;
[6/8/2015 10:52:14 PM] Master Swordsman, Faut: Are you tyed up right now
[6/8/2015 10:52:23 PM] Master Swordsman, Faut: we could talk later
[6/8/2015 10:52:30 PM] Kaizell, Seeker Of Wisdom (K♦): Thinkin’ of doin’ a quick call. You want in?
[6/8/2015 10:52:37 PM] Tylep the rotaerc: I have to go to work in about 15 minutes DX
[6/8/2015 10:52:39 PM | Edited 10:52:47 PM] ADULT_LINK: [Monday, June 08, 2015 10:52 PM] Master Swordsman, Faut:
<<< tyed up>Ty
[6/8/2015 10:52:44 PM] Tylep the rotaerc: ^ kek
[6/8/2015 10:52:52 PM] ADULT_LINK: kek
[6/8/2015 10:52:55 PM] Kaizell, Seeker Of Wisdom (K♦): You in or no?
[6/8/2015 10:52:58 PM | Edited 10:53:39 PM] Tylep the rotaerc: v nigga u gay
[6/8/2015 10:53:32 PM] Gabriel Leonardo: hue
[6/8/2015 10:53:34 PM] Master Swordsman, Faut: Up for it?
[6/8/2015 10:53:39 PM] Master Swordsman, Faut: : >
[6/8/2015 10:53:46 PM] Tylep the rotaerc: lel
[6/8/2015 10:53:50 PM] Gabriel Leonardo: How could you?
[6/8/2015 10:53:52 PM] Tylep the rotaerc: XD
[6/8/2015 10:53:57 PM] Gabriel Leonardo: ;~;
[6/8/2015 10:53:58 PM] Master Swordsman, Faut: BOOM GRILLED
[6/8/2015 10:53:59 PM] Kaizell, Seeker Of Wisdom (K♦): Tyler
[6/8/2015 10:54:00 PM] Eevee: Truth is we need to talk to you for a min
[6/8/2015 10:54:01 PM] Kaizell, Seeker Of Wisdom (K♦): Call?
[6/8/2015 10:54:07 PM] Kaizell, Seeker Of Wisdom (K♦): You in?
[6/8/2015 10:54:31 PM] Tylep the rotaerc: I don’t really got time atm however I did wanna mention some good news
[6/8/2015 10:54:38 PM] Master Swordsman, Faut: ahh
[6/8/2015 10:54:41 PM] Kaizell, Seeker Of Wisdom (K♦): So is that a no?
[6/8/2015 10:54:43 PM] Master Swordsman, Faut: What it beee
[6/8/2015 10:54:47 PM] Eevee: i think so mugen
[6/8/2015 10:54:52 PM] ADULT_LINK: Good news everyone!
[6/8/2015 10:55:02 PM] Gabriel Leonardo: Common sense says “It’s a no”
[6/8/2015 10:55:02 PM] ADULT_LINK: o͡͡͡╮༼ ಠДಠ ༽╭o͡͡͡━☆゚.*・。゚
[6/8/2015 10:55:10 PM] Kaizell, Seeker Of Wisdom (K♦): Guys let him talk
[6/8/2015 10:55:15 PM] Tylep the rotaerc: I have some things set up and I am going to be leaving the country and moving in with my girlfriend
[6/8/2015 10:55:21 PM] Gabriel Leonardo: Awesome
[6/8/2015 10:55:25 PM] Oceanstuck: cool
[6/8/2015 10:55:27 PM] Gabriel Leonardo: Where does your GF live?
[6/8/2015 10:55:27 PM] Master Swordsman, Faut: Aweesome
[6/8/2015 10:55:32 PM] Master Swordsman, Faut: Bye to USA
[6/8/2015 10:55:35 PM] Eevee: Oh, that’s great
[6/8/2015 10:55:36 PM] Tylep the rotaerc: It wont be for a few months
[6/8/2015 10:55:41 PM] Eevee: oh
[6/8/2015 10:55:52 PM] Master Swordsman, Faut: Wait Ty YOU HAVE A GF??
[6/8/2015 10:55:56 PM] Kaizell, Seeker Of Wisdom (K♦): …
[6/8/2015 10:55:59 PM] ADULT_LINK: … GG
[6/8/2015 10:55:59 PM] Tylep the rotaerc: but I think I can handle myself till then ^^
[6/8/2015 10:56:00 PM] Oceanstuck: hehehehe
[6/8/2015 10:56:01 PM] Kaizell, Seeker Of Wisdom (K♦): Old news Faut
[6/8/2015 10:56:03 PM] Gabriel Leonardo: [Monday, June 08, 2015 10:56 PM] Master Swordsman, Faut:
<<< Wait Ty YOU HAVE A GF??Lol
[6/8/2015 10:56:14 PM] Master Swordsman, Faut: s hit i fu ked up
[6/8/2015 10:56:22 PM] Captain “CircleHunter” Desdinova: Well good news indeed!
[6/8/2015 10:56:22 PM] Oceanstuck: lol faut
[6/8/2015 10:56:23 PM | Edited 10:56:34 PM] Kaizell, Seeker Of Wisdom (K♦): Anyway you might wanna hear what we have for you Tyler
[6/8/2015 10:56:32 PM] Captain “CircleHunter” Desdinova: Australia should be damn good for you
[6/8/2015 10:56:40 PM] Master Swordsman, Faut: nah australia is dedly
[6/8/2015 10:56:44 PM] ADULT_LINK: oh jeesus australia
[6/8/2015 10:56:48 PM] ADULT_LINK: im too scared to go there
[6/8/2015 10:56:48 PM] Eevee: I’m happy for you Tyler
[6/8/2015 10:56:55 PM] Tylep the rotaerc: If its anythign too long I don’t have time atm sadly
[6/8/2015 10:56:56 PM] Master Swordsman, Faut: everything is trying to kill you in australia
[6/8/2015 10:56:58 PM] Oceanstuck: everything in australia either wants to kill you or is going to want to kill you after a while
[6/8/2015 10:57:00 PM] ADULT_LINK: i’m afread of being killed by an australlian kitten or somethin
[6/8/2015 10:57:06 PM] Gabriel Leonardo: Stay away from poisonous shit (AKA stay away from everything not man–made)
[6/8/2015 10:57:10 PM] Kaizell, Seeker Of Wisdom (K♦): @tyler
To tell ya the truth it’s about your problem
[6/8/2015 10:57:14 PM] Tylep the rotaerc: I am already about to be late in about 3 minutes as it stands
[6/8/2015 10:57:18 PM] Master Swordsman, Faut: GOGOGOGO
[6/8/2015 10:57:25 PM] Captain “CircleHunter” Desdinova: Then we wait for it
[6/8/2015 10:57:25 PM] Oceanstuck: then well have to make this quick
[6/8/2015 10:57:27 PM] Gabriel Leonardo: Oh, don’t let us keep you, brotherino
[6/8/2015 10:57:28 PM] Tylep the rotaerc: If I lose my job I am boned DX
[6/8/2015 10:57:30 PM] Eevee: ok, well. We’ll wait for it
[6/8/2015 10:57:33 PM] Master Swordsman, Faut: SHIT GO
[6/8/2015 10:57:36 PM] Master Swordsman, Faut: RUN
[6/8/2015 10:57:41 PM] Oceanstuck: im not sure if well have time to wait on it tho
[6/8/2015 10:57:44 PM] Tylep the rotaerc: yeah g2g guys
[6/8/2015 10:57:46 PM] Master Swordsman, Faut: TAKE CARE OF YOURSELF
[6/8/2015 10:57:48 PM] Eevee: bye
[6/8/2015 10:57:48 PM] Oceanstuck: but
[6/8/2015 10:57:49 PM] ADULT_LINK: How long you think you gon be gone?
[6/8/2015 10:57:51 PM] Gabriel Leonardo: Chao
[6/8/2015 10:57:52 PM] Captain “CircleHunter” Desdinova: shit
[6/8/2015 10:57:53 PM] Tylep the rotaerc: just wanted to share the good news
[6/8/2015 10:58:03 PM] ADULT_LINK: K
[6/8/2015 10:58:03 PM] Master Swordsman, Faut: okiee
[6/8/2015 10:58:05 PM] Eevee: Tyler, please be careful
[6/8/2015 10:58:09 PM] Eevee: I mean it
[6/8/2015 10:58:10 PM] Tylep the rotaerc: I should be around sometime tomorrow night if I am not dead asleep
[6/8/2015 10:58:15 PM] ADULT_LINK: We do have some important stuff to tell ya when you get back tho
[6/8/2015 10:58:17 PM] Master Swordsman, Faut: Take care of yourself
[6/8/2015 10:58:20 PM] Oceanstuck: [Monday, June 08, 2015 10:58 PM] Tylep the rotaerc:
<<< not dead
[6/8/2015 10:58:22 PM] ADULT_LINK: Cya
[6/8/2015 10:58:24 PM] Gabriel Leonardo: Cool, hopefully we’ll talk then ^^
[6/8/2015 10:58:26 PM] Kaizell, Seeker Of Wisdom (K♦): Emphasis on important
[6/8/2015 10:58:30 PM] ADULT_LINK: yeah
[6/8/2015 10:58:31 PM] ADULT_LINK: like
[6/8/2015 10:58:36 PM] Oceanstuck: TYPLES
[6/8/2015 10:58:37 PM] Kaizell, Seeker Of Wisdom (K♦): Thorin
[6/8/2015 10:58:37 PM] ADULT_LINK: really important
[6/8/2015 10:58:44 PM] Eevee: lol
[6/8/2015 10:58:48 PM] Master Swordsman, Faut: I think we made dat clear
[6/8/2015 10:58:49 PM] Oceanstuck: be
[6/8/2015 10:58:50 PM] Oceanstuck: safe
[6/8/2015 10:58:50 PM] ADULT_LINK: what
[6/8/2015 10:58:51 PM] ADULT_LINK: o͡͡͡╮༼ ಠДಠ ༽╭o͡͡͡━☆゚.*・。゚
[6/8/2015 10:58:52 PM] Oceanstuck: i guess
[6/8/2015 10:58:53 PM] Gabriel Leonardo: I think Tallarino is gone
[6/8/2015 10:58:55 PM] ADULT_LINK: u wan fukin go mugen
[6/8/2015 10:59:07 PM] Oceanstuck: guys
[6/8/2015 10:59:07 PM] Tylep the rotaerc: yeah all should be good
[6/8/2015 10:59:09 PM] Tylep the rotaerc: but g2g
[6/8/2015 10:59:10 PM] Tylep the rotaerc: ttyl
[6/8/2015 10:59:13 PM] Captain “CircleHunter” Desdinova: tyler no
[6/8/2015 10:59:20 PM] Oceanstuck: i kinda still wanna talk now instead of later
[6/8/2015 10:59:21 PM] Tylep the rotaerc: peace be upon ye broskinos ^^
[6/8/2015 10:59:22 PM] Kaizell, Seeker Of Wisdom (K♦): @Tyler
All we’ll say for right now is what we have for you is relevant to your problem
[6/8/2015 10:59:31 PM] Captain “CircleHunter” Desdinova: …fuck
[6/8/2015 10:59:37 PM] Gabriel Leonardo: gente
[6/8/2015 10:59:42 PM] Captain “CircleHunter” Desdinova: I just realized
[6/8/2015 10:59:43 PM] Eevee: Tyler, you won’t be ok
John’s Call (reverse trans)
Read more below
(Crying)
what, no!
what, stop! (inaudible)
(breathing)
(crying)
no!
what i go by is nuts
(laughing)
Your notes, hope your taking
I really, really
you must not know
laughing
listen!
he hates
not how he communicates
new, redo
clearly am i not speaking
its the only way
he has to know what happened
(inaubible), what you, i already told you
i’m not (inaudible)
he is the messenger
were, i’ve said it once, in the (inaudible)
sure, we’re all in danger
(sobbing)
tell you, i cannot
know who I am, you already
ill have him soon
please
at all costs, must stop him
Convo with Tyler 6/10/15
Read more below:
[6/10/2015 12:18:01 AM] Tylep the rotaerc: Hello broskinos ^^
[6/10/2015 12:18:12 AM] Gabriel Leonardo: Tyler!
[6/10/2015 12:18:19 AM] Gabriel Leonardo: We need to tell you something very important
[6/10/2015 12:18:38 AM] Tylep the rotaerc: lol ok ^^
[6/10/2015 12:18:53 AM] Tylep the rotaerc: Yeah sorry I couldn’t be around for whatever it was before
[6/10/2015 12:19:04 AM] Tylep the rotaerc: I was gonna be late DX
[6/10/2015 12:19:06 AM] Tylep the rotaerc: and I was
[6/10/2015 12:19:12 AM] Tylep the rotaerc: but it was ok
[6/10/2015 12:19:21 AM] Gabriel Leonardo: Okay, this is gonna be long
[6/10/2015 12:19:27 AM] Gabriel Leonardo: But do take your time with this read:
[6/10/2015 12:19:39 AM] Tylep the rotaerc: alrighty ^^
[6/10/2015 12:19:39 AM] Gabriel Leonardo: I have some information to tell you, and I’d like to ask that you hear me out with an open mind.
I’d like to begin by explaining a little more about us, The Internet Detectives. We are a group that investigates, and tries to help people who fall into the clutches of a certain religious group. A cult, basically. This cults members are followers of a Moon Goddess named Luna, and they are split into two factions; one is called the Lunar Children, and the other is called the Moon Children. Both factions are very dangerous, and they have odd practices that include human sacrifice to achieve higher forms of enlightenment.
[6/10/2015 12:21:04 AM] Gabriel Leonardo: In the past, The Internet Detectives had certain powers that were granted to us, and by using those powers we were able to effect people, even those who were a great distance away from us
[6/10/2015 12:21:25 AM] Gabriel Leonardo: So far, so good?
[6/10/2015 12:21:44 AM] Tylep the rotaerc: …uh yeah ^^;
[6/10/2015 12:22:08 AM] Gabriel Leonardo: Okay, lemme continue
[6/10/2015 12:22:13 AM] Gabriel Leonardo: But do feel free to ask questions
[6/10/2015 12:22:33 AM] Gabriel Leonardo: John, Jacob, and yourself were members of our group. You all shared in our powers, and you helped us try to save two young men from this cult. Unfortunately, somewhere along our path, something went wrong.
[6/10/2015 12:23:45 AM] Gabriel Leonardo: We believe that your friend Kevin, was a member of this cult. We believe that on the night you recorded the videos you uploaded to youtube, something happened to the four of you. We still don’t know what, but as a result John was killed, and you, Kevin, and Jacob went into hiding.
[6/10/2015 12:25:03 AM] Gabriel Leonardo: We’ve been contacted by other people who are also trying to help save members of this cult. They’ve kept us informed, and we know for sure that you’ve suffered from some kind trauma from that night, and have lost your memory. The fact that you don’t remember all of us as good friends, is evidence of that. I’m sorry we did not tell you right away, but we needed to gain your trust first. Whether we have succeeded or not, is no longer important.
[6/10/2015 12:26:14 AM] Gabriel Leonardo: We have learned recently that you are in serious danger, this cult is the cause of all the crazy stuff that’s been happening to you. The cult is located in Florida, very near to your home. Their base of operation, is at an abandoned fishery, I’m sure you know what I’m talking about, and know exactly where it is. DO NOT GO THERE UNDER ANY CIRCUMSTANCE!
[6/10/2015 12:26:44 AM] Gabriel Leonardo: (I really need to stress out that you should NOT go to the fishery under any circumstance)
[6/10/2015 12:27:26 AM] Gabriel Leonardo: for some reason, we no longer have our powers of effect. If you fall into their clutches we cannot help you. The police are not your allies, they are loyal to the cultists. Do not speak to them!
[6/10/2015 12:27:45 AM] Gabriel Leonardo: We’ve been told to warn you, and now we have. We can prove all of this, I have several links to websites that will back up our story. Please don’t freak out! You are one of us, and we believe that we can find Jacob and Kevin, wherever they are hiding. I hope you understand the gravity of this situation, and the reason for us not coming right out and telling you.
[6/10/2015 12:28:38 AM | Edited 12:28:46 AM] Gabriel Leonardo: …Phew, that’s a mouthful, but there, that’s all
[6/10/2015 12:38:57 AM] Gabriel Leonardo: …Tyler?
[6/10/2015 12:41:51 AM] Tylep the rotaerc: Ok
[6/10/2015 12:42:05 AM] Tylep the rotaerc: What you are saying right now is kind of fucking insane tbh
[6/10/2015 12:42:42 AM] Gabriel Leonardo: ….But?
[6/10/2015 12:43:10 AM] Tylep the rotaerc: Are you expecting me to believe this?
[6/10/2015 12:44:51 AM] Gabriel Leonardo: I hope you will… If not… Well, I did say we have links that prove it
[6/10/2015 12:51:21 AM] Grey: You guys tell him he got mindwiped by an elder god yet
[6/10/2015 12:51:23 AM] Master Swordsman, Faut: Ty
[6/10/2015 12:51:40 AM] Master Swordsman, Faut: Okay man this may sound crazy but I can swear its all true
[6/10/2015 12:51:52 AM] Tylep the rotaerc: Show me proof
[6/10/2015 12:51:55 AM] Master Swordsman, Faut: Those crazy incidents? Those are proof
[6/10/2015 12:51:57 AM] Gabriel Leonardo: Fair enough
[6/10/2015 12:52:02 AM] Tylep the rotaerc: Tbh I don’t think you can
[6/10/2015 12:52:19 AM] Gabriel Leonardo: http://s13.zetaboards.com/WithinHubris/single/?p=8087462&t=7326964
This is a post you made yourself, with a recording of your own voice
[6/10/2015 12:52:19 AM] Tylep the rotaerc: because this sounds like a rp you are taking a little to seriously
[6/10/2015 12:52:30 AM] Master Swordsman, Faut: Those crazy ass incidents with the police, that disappearing man
[6/10/2015 12:52:34 AM] Grey: Mugen’s not here
[6/10/2015 12:52:39 AM] Gabriel Leonardo: Grey
[6/10/2015 12:52:54 AM] Grey: What I can’t come in and make a joke?
[6/10/2015 12:52:56 AM] Master Swordsman, Faut: You experienced it yourself, Ty.
[6/10/2015 12:52:57 AM] Grey: alrighty
[6/10/2015 12:53:02 AM] Grey: walks out
[6/10/2015 12:53:24 AM] Gabriel Leonardo: That recording, do you recall making it?
[6/10/2015 12:53:38 AM] Gabriel Leonardo: Actually, it doesn’t matter, how about this: See the whole thread
[6/10/2015 12:53:51 AM] Tylep the rotaerc: What recording?
[6/10/2015 12:54:07 AM] Gabriel Leonardo: …What do you mean “What recording”? I linked to it
[6/10/2015 12:54:29 AM] Gabriel Leonardo: http://s13.zetaboards.com/WithinHubris/single/?p=8087462&t=7326964
[6/10/2015 12:54:33 AM] Gabriel Leonardo: There it is again
[6/10/2015 12:57:08 AM] Grey: I’m actually getting a 404
[6/10/2015 12:57:26 AM] Master Swordsman, Faut: Ty okay man I don’t know how to put this across and it’s okay if you don’t trust us for now
[6/10/2015 12:57:28 AM] Grey: could be my internet
[6/10/2015 12:57:49 AM] Master Swordsman, Faut: But even if you don’t believe us I still wanna tell you to be careful man
[6/10/2015 12:58:00 AM] Tylep the rotaerc: I go to that link and just get a black page
[6/10/2015 12:58:13 AM] Master Swordsman, Faut: ehhhh just a secc
[6/10/2015 12:58:54 AM] Master Swordsman, Faut: http://vocaroo.com/i/s05rKRPbhbgP
[6/10/2015 12:58:57 AM] Master Swordsman, Faut: Here ya go
[6/10/2015 12:59:57 AM] *** ***
[6/10/2015 1:00:35 AM] Tylep the rotaerc: The front page of the vocaroo site???
[6/10/2015 1:01:00 AM] Tylep the rotaerc: Do we have anything else?
[6/10/2015 1:01:07 AM] Master Swordsman, Faut: Noope, not working. Eh
[6/10/2015 1:01:08 AM] Grey: I’ll be honest I have no idea what’s going on, I’ve been away for a couple weeks.
[6/10/2015 1:01:15 AM] Master Swordsman, Faut: Remember the vids you posted?
[6/10/2015 1:01:16 AM] Archery 2000: ^
[6/10/2015 1:01:22 AM] Tylep the rotaerc: Becuase atm you guys are kind of coming off like a bunch of kids who think they have magic powers or something
[6/10/2015 1:01:34 AM] Grey: they said what
[6/10/2015 1:02:01 AM] Master Swordsman, Faut: The crazy ass incidents recently, do they really seem like a bunch of bizzares?
[6/10/2015 1:02:52 AM] Tylep the rotaerc: Uhh… yeah.
[6/10/2015 1:03:18 AM] Master Swordsman, Faut: Okie point taken but
[6/10/2015 1:03:28 AM] Master Swordsman, Faut: Ahh screw it even if you dont believe us
[6/10/2015 1:03:34 AM] Master Swordsman, Faut: Just be careful, okay?
[6/10/2015 1:03:41 AM] Gabriel Leonardo: Just do us one thing, even if you don’t believe us
[6/10/2015 1:03:47 AM] Gabriel Leonardo: One little thing
[6/10/2015 1:04:06 AM] Gabriel Leonardo: Do not, under any circumstance on earth, go to the fishery
[6/10/2015 1:04:22 AM] Master Swordsman, Faut: ^
[6/10/2015 1:05:14 AM] Master Swordsman, Faut: Also, for fucks sake bring pepper spray
[6/10/2015 1:06:23 AM] Grey: Who puts pepper on fish?
[6/10/2015 1:06:27 AM] Master Swordsman, Faut: Ty. Bring pepper spray anywhere you go jus do it
[6/10/2015 1:06:41 AM] Master Swordsman, Faut: funny story bout that actually
[6/10/2015 1:06:59 AM] Master Swordsman, Faut: fish and pepper is a necessity in chinese culture
[6/10/2015 1:07:02 AM] Tylep the rotaerc: I plan to have something a lot stronger than pepper spray
[6/10/2015 1:07:04 AM] Tylep the rotaerc: do not worry
[6/10/2015 1:07:08 AM] Master Swordsman, Faut: perfect
[6/10/2015 1:07:31 AM] Master Swordsman, Faut: also wait is pepper spray legal in Florida
[6/10/2015 1:07:32 AM] Tylep the rotaerc: So is this all the proof you have of this crap you have been saying?
[6/10/2015 1:08:02 AM] Tylep the rotaerc: Because the front page of vocaroo and a black page is not all that compelling.
[6/10/2015 1:08:10 AM] Master Swordsman, Faut: Not exactly, but we’ll just do the rest of this thing tomorrow i guess
[6/10/2015 1:08:15 AM] Gabriel Leonardo: http://internetdetectives.tumblr.com/links
Does this show up in your screen?
[6/10/2015 1:08:28 AM] Master Swordsman, Faut: As long as you bring stuff to protect yourself we should be fine
[6/10/2015 1:11:07 AM] Master Swordsman, Faut: Ty? Does it?
[6/10/2015 1:11:24 AM] Paul Rudd: Woah
[6/10/2015 1:11:28 AM] Paul Rudd: Hello
[6/10/2015 1:11:35 AM] Master Swordsman, Faut: ayy yo whatsup
[6/10/2015 1:11:40 AM] Tylep the rotaerc: brb a sec I gotta take a piss
[6/10/2015 1:11:49 AM] Master Swordsman, Faut: BRING PEPPER SPRAY
[6/10/2015 1:11:54 AM] Paul Rudd: Wait how long can you hold it
[6/10/2015 1:12:01 AM] Master Swordsman, Faut: AND A SURVIVAL KNIFE
[6/10/2015 1:12:04 AM] Master Swordsman, Faut: or something
[6/10/2015 1:12:45 AM] Wolfcat: Just in case it didn’t show up before (since apparently pages are being wonky and stuff) I’ll post it here. You might not remember this, but just the slightest chance that you do, I’m going to show it to you anyway. It was a shitty comic I made for the group back when we were doing all that crazy stuff gabriel told you about. You even used a portion of it as your avatar for a while on here. Here it is, the shite comic. (its about a fag named Patrem who’s a huge anus btw). Do you remember using it, right? If I recall correctly, you used it for a few days after getting back on here.
[6/10/2015 1:14:45 AM] Grey: wut
[6/10/2015 1:15:14 AM] Paul Rudd: I found a conversation you participated in involving the events described. It was logged in real time and stored away
[6/10/2015 1:15:16 AM] Paul Rudd: Here https://www.dropbox.com/s/um0hek4w6molsne/4-6-15.txt?dl=0
[6/10/2015 1:15:49 AM] Paul Rudd: You may have to scroll down a bit
[6/10/2015 1:15:58 AM] Paul Rudd: I’ll see what else I can find
[6/10/2015 1:16:31 AM] Tylep the rotaerc: I am back
[6/10/2015 1:16:39 AM] Gabriel Leonardo: Welcome back I suppose
[6/10/2015 1:16:44 AM] Paul Rudd: wb
[6/10/2015 1:17:20 AM] Tylep the rotaerc: Actually yeah I feel like I remember having a picture with a purple guy on my skype before
[6/10/2015 1:18:02 AM] Tylep the rotaerc: Oddly enough I don’t see him in my skype pictures anymore
[6/10/2015 1:18:12 AM] Tylep the rotaerc: I probs deleted it
[6/10/2015 1:18:36 AM] Gabriel Leonardo: I’ll have to leave for the night, it’s terribly late. Sorry
In any event, refer to Wolfcat, Faut or Paul
[6/10/2015 1:18:45 AM] Paul Rudd: Good night Sengi
[6/10/2015 1:19:04 AM] Gabriel Leonardo: Aye
[6/10/2015 1:19:05 AM] Paul Rudd: Don’t get up to anything funky!
[6/10/2015 1:20:06 AM] Paul Rudd: I found another file
[6/10/2015 1:20:22 AM] Paul Rudd: You don’t really talk until around the end of it but you talk
[6/10/2015 1:20:23 AM] Paul Rudd: https://www.dropbox.com/s/cjo3i5dil40cx2w/5-6-15.txt?dl=0
[6/10/2015 1:20:37 AM] Wolfcat: If you can see it, this is the blog we use. We’ve got all the stuff that happened with our previous shenanigans logged here. (Though on there you’re referred to as ‘tylep’) http://internetdetectives.tumblr.com/yshdt-timeline
[6/10/2015 1:26:15 AM] Tylep the rotaerc: dude what are you doing?
[6/10/2015 1:26:31 AM] Paul Rudd: Me or Wolfcat?
[6/10/2015 1:26:34 AM] Tylep the rotaerc: Is this some kind of secret code?
[6/10/2015 1:27:18 AM] Master Swordsman, Faut: Wuuhh
[6/10/2015 1:27:22 AM] Master Swordsman, Faut: Which one
[6/10/2015 1:27:29 AM] Tylep the rotaerc: [Wednesday, June 10, 2015 1:20 AM] Wolfcat:
<<< If you can see it, this is the blog we use. We’ve got all the stuff that happened with our previous shenanigans logged here. (Though on there you’re referred to as 'tylep’)
gyqsbbwyxtnmxlcfxalrmqh
[6/10/2015 1:27:43 AM] Paul Rudd: You…
[6/10/2015 1:27:54 AM] Tylep the rotaerc: That one
[6/10/2015 1:27:58 AM] Paul Rudd: You can’t see half of what we’re talking about
[6/10/2015 1:28:04 AM] Paul Rudd: Can you?
[6/10/2015 1:28:16 AM] Wolfcat: ….huh, I sent a link. idk why it’s not showing. anyways, heres a pic of the blog to show I’m not bullshitting you
[6/10/2015 1:28:29 AM | Removed 1:29:22 AM] Wolfcat: This message has been removed.
[6/10/2015 1:28:39 AM] Master Swordsman, Faut: Its a tumblr blog
[6/10/2015 1:29:15 AM] Wolfcat: ugh curse my internet btw
[6/10/2015 1:29:16 AM] Paul Rudd: “This photo is unavailable”
[6/10/2015 1:29:20 AM] Paul Rudd: Fucking incredible
Wolfcat
[6/10/2015 1:29:35 AM] Master Swordsman, Faut: wolf, your internet is bad
[6/10/2015 1:29:41 AM] Tylep the rotaerc: I have had some baaad experiences with tumblr lol
[6/10/2015 1:29:54 AM] Wolfcat: tumblr is pretty shitty yeah
[6/10/2015 1:29:58 AM] Master Swordsman, Faut: I’m on tumblr, and believe me when I say it is shit
[6/10/2015 1:30:01 AM] Wolfcat: almost as shitty as my internet
[6/10/2015 1:30:04 AM] Paul Rudd: Yeah
[6/10/2015 1:30:09 AM] Paul Rudd: I had a tumblr once
[6/10/2015 1:30:13 AM] Paul Rudd: Then it got stolen
[6/10/2015 1:30:45 AM] Tylep the rotaerc: Anything else you wanna show me regarding my past life? Am I the avatar?
[6/10/2015 1:31:01 AM] Wolfcat: btw that was just to verify that the blog existed, you might be able to manually type in the url shown
[6/10/2015 1:31:37 AM] Paul Rudd: I can’t see your second attempt at sending the photo actually
[6/10/2015 1:32:05 AM] Grey: I can’t either
[6/10/2015 1:32:17 AM] Tylep the rotaerc: Tbh I am begining to feel like I am surronded by crazy people
[6/10/2015 1:32:28 AM] Tylep the rotaerc: and/or back in highschool
[6/10/2015 1:32:40 AM] Grey: lol
[6/10/2015 1:32:59 AM] uoslǝN ʞɔɐZ: h t t p : / / i n t e r n e t d e t e c t i v e s . t u m b l r . c o m / y s h d t - t i m e l i n e
[6/10/2015 1:33:12 AM] uoslǝN ʞɔɐZ: Can ya read that?
[6/10/2015 1:33:24 AM] Master Swordsman, Faut: Not the Avatar, more the Link
Paul Rudd
[6/10/2015 1:33:41 AM] Master Swordsman, Faut: I swear its just everything spaced apart
Paul Rudd
[6/10/2015 1:33:58 AM] Tylep the rotaerc: large mass of giberish spaced apart?
[6/10/2015 1:34:12 AM] Master Swordsman, Faut: I CALLED IT.
[6/10/2015 1:34:15 AM | Edited 1:34:24 AM] Master Swordsman, Faut: TotALLY CALLED IT
[6/10/2015 1:34:21 AM] Grey: Is it zalgo text
[6/10/2015 1:34:24 AM] Grey: like I see
[6/10/2015 1:34:51 AM] Master Swordsman, Faut: Ty
[6/10/2015 1:35:00 AM] Master Swordsman, Faut: Could you get on another computer
[6/10/2015 1:35:20 AM] Paul Rudd: Tylep I just sent you three screencaps, two of parts of the page and one of the page’s url
[6/10/2015 1:35:26 AM] Paul Rudd: Can you see them?
[6/10/2015 1:38:13 AM] Eevee: Tyler
[6/10/2015 1:38:38 AM] Eevee: Do you remember hiding in the woods?
[6/10/2015 1:38:39 AM] Paul Rudd: Are you still there?
[6/10/2015 1:38:44 AM] Wolfcat: [Sunday, April 26, 2015 10:17 AM] Tylep the rotaerc:
<<< Anyways, happy birthday coolio artisto broskino brotisto
Hope your day is going well!You don’t remember any of this? This will probably show up as gibberish as well. : /
[6/10/2015 1:40:02 AM] Tylep the rotaerc: When did I say that?
[6/10/2015 1:40:12 AM] Master Swordsman, Faut: 26/04/2015
[6/10/2015 1:40:14 AM] Wolfcat: It was in pm’s with me
[6/10/2015 1:40:37 AM] Paul Rudd: It was?
[6/10/2015 1:40:40 AM] Master Swordsman, Faut: 12121
[6/10/2015 1:41:02 AM] Tylep the rotaerc: I don’t have that in my history with you
[6/10/2015 1:41:04 AM] Tylep the rotaerc: wtf
[6/10/2015 1:41:07 AM] ARG Dov: So, whats up?
[6/10/2015 1:41:16 AM] Paul Rudd: Arg
[6/10/2015 1:41:28 AM] Paul Rudd: We’re trying to tell him
Wolfcat
[6/10/2015 1:41:40 AM] Paul Rudd: It is trippy shit, I’ll admit
[6/10/2015 1:42:18 AM] Wolfcat: This is all I got.
[6/10/2015 1:42:21 AM] ARG Dov: Is he here with us now?
[6/10/2015 1:42:28 AM] Wolfcat: idk why it’s not showing up for you
[6/10/2015 1:42:51 AM] Wolfcat: but I’m not messing with you. Sorry this is all so weird.
[6/10/2015 1:42:59 AM] Master Swordsman, Faut: 12121 remember
[6/10/2015 1:43:02 AM] ARG Dov: And who’s using Paul Rudd’s account if you’re here, wolf?
[6/10/2015 1:43:05 AM] Master Swordsman, Faut: does ANYTHING work.
[6/10/2015 1:43:08 AM] Master Swordsman, Faut: At all.
[6/10/2015 1:43:22 AM] Paul Rudd: ((Paul is using Paul’s account :P))
[6/10/2015 1:43:42 AM] ARG Dov: I see….
[6/10/2015 1:43:52 AM] ARG Dov: And again, is Tyler with us now?
[6/10/2015 1:43:59 AM] Eevee: lunarchildren.com
[6/10/2015 1:44:32 AM] Wolfcat: oh whoa
[6/10/2015 1:44:37 AM] Wolfcat: thats different
[6/10/2015 1:44:41 AM] Master Swordsman, Faut: FUCK
[6/10/2015 1:44:42 AM] ARG Dov: we need a username now?
[6/10/2015 1:44:45 AM] Master Swordsman, Faut: WHAT THE FUCK!?
[6/10/2015 1:44:45 AM] Tylep the rotaerc: I am getting a password and user name request
[6/10/2015 1:44:47 AM] Tylep the rotaerc: yeah
[6/10/2015 1:44:53 AM] Paul Rudd: Woah
[6/10/2015 1:44:55 AM] Paul Rudd: Huh
[6/10/2015 1:45:00 AM] Master Swordsman, Faut: ME EITHER MAN IM SEEING THIS SHIT TOO
[6/10/2015 1:45:43 AM] Paul Rudd: Hmm…
[6/10/2015 1:45:47 AM] ARG Dov: what can we do we this, then?
[6/10/2015 1:45:57 AM] Paul Rudd: I might need a minute
[6/10/2015 1:46:05 AM] ARG Dov: to do what?
[6/10/2015 1:46:12 AM] Paul Rudd: To try something
[6/10/2015 1:46:33 AM] ARG Dov: Try what?
[6/10/2015 1:46:35 AM] Eevee: Johnisdead is down too
[6/10/2015 1:47:08 AM] Master Swordsman, Faut: What the hell is going on
[6/10/2015 1:47:18 AM] Tylep the rotaerc: [Wednesday, June 10, 2015 1:46 AM] Eevee:
<<< Johnisdead is down tooare you talking about my fucking dead friend?
[6/10/2015 1:47:57 AM] Eevee: Tyler, you’ve been told who we are and what we do. You can choose to believe us, or fall victim to the followers of luna
[6/10/2015 1:47:57 AM] Master Swordsman, Faut: Would you believe me if I explained it all
[6/10/2015 1:48:13 AM] Paul Rudd: That’s actually the url of a certain spoop site we’ve been investigating
[6/10/2015 1:48:13 AM] Eevee: You are being targeted
[6/10/2015 1:48:30 AM] Tylep the rotaerc: wtf is johnisdead
[6/10/2015 1:48:33 AM] Tylep the rotaerc: I wanna know right now
[6/10/2015 1:48:38 AM] Master Swordsman, Faut: it was a website
[6/10/2015 1:48:41 AM | Removed 1:48:46 AM] Paul Rudd: This message has been removed.
[6/10/2015 1:48:52 AM] Master Swordsman, Faut: Note “was” until we found out a few seconds ago
[6/10/2015 1:48:59 AM | Edited 1:49:03 AM] Master Swordsman, Faut: its down
[6/10/2015 1:49:07 AM] Eevee: It’s a website that allows us to communicate with others
[6/10/2015 1:49:58 AM] Eevee: We learned everything we know from there
[6/10/2015 1:49:59 AM | Edited 1:50:06 AM] Master Swordsman, Faut: #’s Guy then begins a series of posts in the Call Group. The transcript is:
o I’ll show you
o I
o Father is very mad
o Im not allowed to talk right now
o You did it
o 01101010 01101111 01101000 01101110 01101001 01110011 01100100 01100101 01100001 01100100 00101110 01100011 01101111 01101101
o (translated:http://johnisdead.com/)..
[6/10/2015 1:50:14 AM] Master Swordsman, Faut: This is what happened.
[6/10/2015 1:50:37 AM] Master Swordsman, Faut: Believe it or not, its something to do with the purple guy.
[6/10/2015 1:52:39 AM] Paul Rudd: I tried entering through the “VR Program” we were showed
[6/10/2015 1:52:43 AM] Paul Rudd: It didn’t work
[6/10/2015 1:52:56 AM] Tylep the rotaerc: I just see some text that says “Under construction” and some piano music playing.
[6/10/2015 1:53:06 AM] Master Swordsman, Faut: Uwah?
[6/10/2015 1:53:12 AM] Master Swordsman, Faut: Could you send the music over?
[6/10/2015 1:53:23 AM] Paul Rudd: Checking the page
[6/10/2015 1:53:25 AM] Paul Rudd: Huh
[6/10/2015 1:53:37 AM] Paul Rudd: It does say “Under Construction”
[6/10/2015 1:53:40 AM] Paul Rudd: In purple text
[6/10/2015 1:53:43 AM] Master Swordsman, Faut: Huh.
[6/10/2015 1:53:45 AM] Archery 2000: piano music?
[6/10/2015 1:53:49 AM] Tylep the rotaerc: But tbh I am pretty fucking pissed off right now if this is about john
[6/10/2015 1:54:06 AM] Master Swordsman, Faut: We’re as pissed as you
[6/10/2015 1:54:12 AM] Paul Rudd: Sorry
[6/10/2015 1:54:25 AM] Tylep the rotaerc: I don’t know how I feel about you guys atm
[6/10/2015 1:54:36 AM] Tylep the rotaerc: Im sorry but I am gonna go
[6/10/2015 1:54:38 AM] Master Swordsman, Faut: But right now we have every reason to believe you’re in danger as well
[6/10/2015 1:54:47 AM] Eevee: Tyler, we’re your friends
[6/10/2015 1:54:50 AM] Tylep the rotaerc: I needed to call my gf
[6/10/2015 1:54:52 AM] Master Swordsman, Faut: No eve
[6/10/2015 1:54:57 AM] Master Swordsman, Faut: Just let him cool off
[6/10/2015 1:55:06 AM] Tylep the rotaerc: and this
[6/10/2015 1:55:11 AM] Tylep the rotaerc: this is a bunch of bullshit
Blood moon ritual part one
[June 17, 2015] by [liquidsaint]
Wanted to get this out right now since you have all been waiting for it so bloody long. Shame about that new guy, but as you all may already know (as I do very well) when it comes to “her”, sacrifices must often be made.
[lunarchildren.com/mediaupload/bloodmoonritualpartone.wmv]
#lunarchildren.com
#liquidsaint
#blog post
Blood Moon Ritual
#lunarchildren.com
#video
OOC NIGHT…
[6/20/2015 1:21:51 AM] Le lune ‘Jayckup’: I gotta pee
[6/20/2015 1:21:56 AM] Tylep the rotaerc: I gotta skee
[6/20/2015 1:22:09 AM] Le lune 'Jayckup’: I gotta yee
[6/20/2015 1:22:15 AM] Captain “CircleHunter” Desdinova: I gotta REEEE
[6/20/2015 1:22:23 AM] Thorin: SKREEE
[6/20/2015 1:22:38 AM] John Mesic: I gotta HE
[6/20/2015 1:22:44 AM] Captain “CircleHunter” Desdinova: HAS
[6/20/2015 1:22:54 AM] Thorin: NO
…
#it goes to hell pretty fast
Yes, it is part of an ARG. The “Dead ARC” is a continuation of the previous ARG; YSHDT. The Dead ARC follows the story of a group of friends Tyler, John, Jacob, and Kevin. They seem to have gotten mixed up with the Moon Children, and have had terrible fates… The game is still in it’s early stages, and if you and your friends are interested, we’d love to have you join! Our main discussions take place in our Skype group. If you’d like, I’d gladly add you.
i have a bad memory. ~Link
Only for you Thorin….. Next time, we sacrifice you to /Patrem\
Why is there an ask here? More importantly, will this be answered by members or something?
There was always an ask, and it will be answered by me, the Time-Lord.
Zangooses suck
More like FAGgoose!
Amirite?
see.webm
johnisdead/fakeworld update 6/23/15
#johnisdead.com
so uh? are you guys related to the mystery of the ascension cult?
The ARG that we are currently playing is a sort of spinoff of the “Moon Children Arc” from the Haunted Cartridge. We are in our 2nd arc “John is Dead”.
If you’d like to know more about the game, please read the timelines starting with YSHDT. If you’d like to join, let us know.
Password
That Sir, is the million dollar question. As of 6:23am on June 18th, we’ve been locked out of the site. As stated by “Matt R.”, the password will be randomly changed. So we will continue to loose access to the site as the game progresses.
As soon as the new password is discovered, it will be posted.
#ask
#anon
#password
#lunarchildren.com
#submission
In Remembrance
Of Zack Nelson.
You were a Nazi Spy, but a cool dude. We all suspected you from day one, little did we know… you were fucking dead the whole time!
Wolfcat: “Zack was a fuck shit stick ass bitch who was a fucking cunt ass canon bitch fuck shit stack"
Sengi: “RIPERINO Zack. Never on our side, but always by our side… Also eve loved u y u tear her heart out like so?“
Pichu: “POKEMON FOREVER ALSO DORUMON IS BEST DIGIMON”
VAPORGRAVE
#zack nelson
#rip
#gone but immediately forgotten
poop
so uh eve after you left i found some sp00k shit on the site but my subconcious started to flip out and i got too scared so i stopped progressing ._. currently listening to Guar plains theme to try to calm down. would do the lost woods like i normally do but the backwards Lost woods is what freaked me out (along with other stuff) so thats probably not the best idea. ._. help me.
Thorin, there’s someone knocking at your front door….
#plays song of unhealing
#lol its totally Kelbris
#submission
>in where patrem's dick size is revealed
It’s coming…..
- Ba Dum Pst*
mask1iswatching.webm
#johnisdead.com
mask2willfindyou.webm
#johnisdead.com
mask3iswaiting.webm
#johnisdead.com
The Clue is:
est/5 ***** IS SHE?
#wtf does it mean?
it's 'where is she'. you should try johnisdead/where
Oh, we did….. we have found all the secrets… Updates soon to come!
help.gif - update 6/28/15
#johnisdead.com
thethirdgiant.webm - update 6/28/15
#johnisdead.com
#video
ah! so you guys are trying to complete or solve the ARG too? thats cool, i first heard if this from someordinarygamers video and joined in on a thread, could you do me and the thread a favor and tag or add what website updates with the clues that happen? thanks
Hello Anon, we are unaware of other groups playing this ARG, but would love for you to join us! Our Skype group is the main hub for activity regarding this ARG, and as such we have access to resources that someone outside of our group wouldn’t have.
If you have a Skype, please PM me your name so I can add you!
To that anon who just said that they had a group working on stuff, where can you guys be found? I'm helping with this group, and i'd personally love to mix what we've been doing. The more heads the faster (and more efficently) things an get done i guess just make an ask on here. ~ADULT_LINK
alwayswatchingyou.wmv - update 6/28/15
#johnisdead.com
Timeline Update
6/27/15 - 6/28/15 has been updated.
#Praise Luna
#The father is tots real
To all new visitors:
Please send us an ask with your Skype name, to be added in the main group. Being in the Skype group gives you access to resources you will not have as a casual observer.
We strongly recommend you read the timelines, starting with YSHDT to understand what’s happening.
The ARG is currently in its second Arc: johnisdead, but knowledge of the events in the first Arc, yshdt, is crucial.
#join us #one of us
#/Patrem\ is calling you!
Every game has rules.
He chose this game when he chose the boy.
- johnisdead.com/listen/
Do you know about the YT channel "Savemepleaseee"? He made a comment on one of Tyler's videos. "are you okay? 12121" He has a couple creepy Zelda videos, and something about Thomas and someone's dad. Sorry if you already know about this, I just thought it was weird. It all just seemed... strange. Too much so to be a coincidence.
I can safely say that “savemepleaseee” is not affiliated with this ARG in any way. He’s just a YouTube account that commented on Tyler’s video.
#confirmed by dead people
Current objective:
Destegging the image on the main page of johnisdead.
Possible password: tenebris
Possible hints: coding in the source of /listen.
If someone cracks it, please submit your findings. Sharing is caring!
#hints
TL.webm
johnisdead.com - Update 7/5/15
#johnisdead.com
/truth
It’s a bunch of LIES!
#we found it
#what do we win?
Hey, I'm that one Fennekin from Janus, just have a few questions about this. Is it related to BEN DROWNED in anyway? Is it like a spiritual successor or something? How do I join the IDs if I am interested?
Hi Fenn,
Yes, this ARG is directly inspired by Ben Drowned and can be considered a (fan made) sequal to the Moon Children arc.
If you would like to join, send us your Skype name and we will add you to the ID’s main chat.
Current objective: (Solved!)
Destegging the image on the main page of johnisdead.
Objective met! Cipher found in image: aHR0cDovL3ZvY2Fyb28uY29tL2kvczFFbVE1aUhyajVJ Translates to: http://vocaroo.com/i/s1EmQ5iHrj5I Editing the song file in audacity gave us a spectogram image. (Posted above)
Artist: Unknown
Track: (Audio link hidden) Binreset.jpg
Album: John is Dead Soundtrack
The Audio from (http://vocaroo.com/i/s1EmQ5iHrj5I) hidden in BinReset.jpg
File found 7/7/15 by: Leslie
Tenebris?
A lot of things have been pointing to “Tenebris” lately. Namely the image files: “BitEnsRe.jpg, BeReTins.jpg, Bentlres.jpg, BinReset.png”.
Is this a message to us that John has been assimilated by the Tenebris Link?
#johnisdead.com
#poor john
#tenebris
hello
U3VwIG5pZ2dhPw==
“Everything has been sorted out since the incident with the masked person who invaded my property. Ill be moving in with my girlfriend at the end of the year, which means Ill be leaving the country so I can say goodbye to anymore locale stalkers.
But for now life is pretty boring, so until then Ill just use this channel to vlog about things whenever anything worth bullshitting about comes to mind.
(On a side note, I really need to get a new phone. Its been fucking up forever but now that I see the way the video recorded I know its probably on its last leg.)”
Silentdork update 7/12/15
(Source: youtube.com)
#Tyler
#silentdork
Artist: Unknown
Track: forever.mp3
Album: John is Dead Soundtrack
forever.mp3
johnisdead.com update 7/20/15
(Source: johnisdead.com)
#johnisdead.com
#audio
Cipher hidden in /index
“366363333666363336663633366633333366636333636666336366663666366636663666366636663363666336666336366366663666363636663633366636363663336336633636336366633663336636636666366366363363666636663666366333363666363336633366366363333366666636663663336666363633633336333663363336333633363636366336363633363663366336363336336663363636363336363636“
Binary 3=0, 6=1
Translation: https://www.youtube.com/watch?v=HFDEYQfQ9TU
#wtf?
#johnisdead.com
#cipher
alright, whats up? -shnnhs223
Ass loads of new pages yet to be discovered.
True story.
Published on Jul 21, 2015
Power went out today so I decided to just go on a little walk.
The camera is fucky as usual so the footage of me going by the fire-station and then off into the river bank seems to have completely vanished. Its in my memories still I suppose.
Atleast there is the part at the end, There was a man walking behind me with a funny parrot, and I didn’t notice a first but upon looking at the footage here I guess it was trying to say hi to me.
(Source: youtube.com)
#silentdork
Things to do:
So there are a few things that need solving until the next update!
1) oYz2ZF0icHXn.gif (not sure if this is a cipher, if it is, it needs solving)
2) ADTINEO (we need to figure out what the heck this means)
Johnisdead Youtube Page
For audio and video re-uploads, updates, and game stuffs.
https://www.youtube.com/channel/UC3gtGXxN8u87hgnT6S-5itA/
(Source: youtube.com)
#youtube
ID haxxorz
Links ahoy
http://www.johnisdead.com
http://www.johnisdead.com/wearetrapped/
http://www.johnisdead.com/prison/
http://www.johnisdead.com/prisoner/
http://www.johnisdead.com/cantmove/
http://www.johnisdead.com/ishouldntbehere/
http://www.johnisdead.com/idied/
http://www.johnisdead.com/cantbreathe/
http://www.johnisdead.com/ambegan/ – Javanese for “breath”
http://www.johnisdead.com/vasgevang/ – Afrikaans for “caught”
http://www.johnisdead.com/gevangene/ – Afrikaans for “prisoner”
http://www.johnisdead.com/gevangenis/ – Afrikaans for “prison”
http://www.johnisdead.com/recursion/
http://www.johnisdead.com/escape/
http://www.johnisdead.com/404/
http://www.johnisdead.com/leave/
http://www.johnisdead.com/goaway/
http://www.johnisdead.com/anotherone/
http://www.johnisdead.com/hapis/ – Turkish for “prison”
http://www.johnisdead.com/tutuklu/ – Turkish for “prisoner”
http://www.johnisdead.com/moriens/ – Latin for “dying”
http://www.johnisdead.com/mereor/ – Latin for “I deserve it”
http://www.johnisdead.com/back/
http://www.johnisdead.com/blue_flame/
http://www.johnisdead.com/breathe/
http://www.johnisdead.com/cant_swim/
http://www.johnisdead.com/down/
http://www.johnisdead.com/fantasy/
http://www.johnisdead.com/forever/
http://www.johnisdead.com/get_out/
http://www.johnisdead.com/go_back/
http://www.johnisdead.com/gone/
http://www.johnisdead.com/hold_on/
http://www.johnisdead.com/imagine/
http://www.johnisdead.com/go/
http://www.johnisdead.com/say_goodbye/
http://www.johnisdead.com/misleading/
http://www.johnisdead.com/away/
http://www.johnisdead.com/return/
http://www.johnisdead.com/asleep/
http://www.johnisdead.com/fakeworld/
http://www.johnisdead.com/where/
http://www.johnisdead.com/getout/
http://www.johnisdead.com/cantgetout/
http://www.johnisdead.com/stuck/
http://www.johnisdead.com/saveus/
http://www.johnisdead.com/gordeme/ – Basque for “save me”
http://www.johnisdead.com/selamatkansaya/ – Indonesian for “save me”
http://www.johnisdead.com/mortuum/ – Latin for “dead”
http://www.johnisdead.com/vinctum/ – Latin for “prisoner”
http://www.johnisdead.com/terperangkap/ – Malay for “caught”
http://www.johnisdead.com/mourant/ – French for “dying”
http://www.johnisdead.com/prisonnier/ – French for “prisoner”
http://www.johnisdead.com/mati/ – Indonesian for “dead”
http://www.johnisdead.com/macet/ – Indonesian for “asleep”
http://www.johnisdead.com/hildako/ – Basque for “dead”
http://www.johnisdead.com/lagun/ – Basque for “help”
http://www.johnisdead.com/kaixo/ – Basque for “hello”
http://www.johnisdead.com/lost_forever/
http://www.johnisdead.com/in_m_yhead/
http://www.johnisdead.com/occasions/
http://www.johnisdead.com/exit/
http://www.johnisdead.com/whoareyou/
http://www.johnisdead.com/idontknowwhereiam/
http://www.johnisdead.com/savemeplease/
http://www.johnisdead.com/hellowhoareyou/
http://www.johnisdead.com/123/
http://www.johnisdead.com/secret/
http://www.johnisdead.com/password/
http://www.johnisdead.com/solution/
http://www.johnisdead.com/patrem/
http://www.johnisdead.com/trapped/
http://www.johnisdead.com/tearing/
http://www.johnisdead.com/dead/
http://www.johnisdead.com/dying/
http://www.johnisdead.com/hurt/
http://www.johnisdead.com/pain/
http://www.johnisdead.com/whereami/
http://www.johnisdead.com/turnback/
http://www.johnisdead.com/helpu/ – Welsh for “help”
http://www.johnisdead.com/gaeth/ – Welsh for “captive/confined”
https://www.youtube.com/user/silentdork/
http://www.johnisdead.com/banduan/ – Malay for “prisoner/prisoners”
http://www.lunarchildren.com
http://www.johnisdead.com/atrapado/ – Spanish for “trapped”
http://www.johnisdead.com/prisión/ – Spanish for “prison”
http://www.johnisdead.com/morí/ – Catalan for “died”
http://www.johnisdead.com/redmig/ – No idea. Probably “redmi” which is Slovenian for “he following”
http://www.johnisdead.com/kimsin/ – Turkish for “who are you”
http://www.johnisdead.com/lost_in_my_mind/
http://www.johnisdead.com/mute/
http://www.johnisdead.com/neverending_dream/
http://www.johnisdead.com/oooooo/
http://www.johnisdead.com/pray_for_rest/
http://www.johnisdead.com/3/
#lol
#thanks ryfoxx
I told you so. I always says. You won't be missed. I can't let it happen. What I though so, happend and will, I will be. Do You remember me? ... I don't. Redd will be dited. He's here. I'm now, death is nothing, Kill him. I will. Hes in Me, I'm him. is he? KILL ME
… I need an adult.
FOOLEDYOU.webm
#johnisdead.com
lostmemory423
Youtube page discovered through /paradise/tricked/enlightenment.txt/
#johnisdead.com
John enlightened us
http://johnisdead.com/paradise/tricked/enlightenment.txt
Translation:
“Game
Summons me to cage
Man plays new wave bossanova
Man to Kafei
envy of 4th giant
wants to have the moon
Tell man of truth
Man wants truth so to go to moon
suffocate child
Put child in cage
play elegy
take childs mask
Give man truth
Man does not know me
Man wants the shepherds mask
My mask
laugh
Man lies of shepards mask to my toys
laugh
father of lies
laugh
Wait in cage
Puppette give cage to link
The link opens cage
I can see all
Man has new children
Man lies of mask
Kafie to salesman
laugh
FATHER OF LIES
laugh
11111111
Dawn of a new day lose my new mask
It’s worth noting that the number three is reported by Kelbris to have been said numerous times
Use the three to get moon day 4
Power to grand child
Wisdom to ____burned take mask now my mask
Courage to new link
three are to this“
#johnisdead.com
Published on Aug 3, 2015
finding cool and free shit is always nice
(Source: youtube.com)
#Tyler
#silentdork
Current objective:
HB1cnBvc2Ugb2YgdGhIIEN1bHQ=
#a cookie to the first person who gets it
New website!
http://whatisben.com/
(Source: whatisben.com)
#whatisben.com
take.webm
johnisdead.com/whatdidido/take/
#johnisdead.com
#video
I control you child, and your futile attempts to remember this are nothing but a game to me.
#vincent adams
Published on Aug 4, 2015
Today was a REALLY scary day at work. Idk what happened, but the fry vat I was working on just suddenly caught on fire right in front of me. I had to hold the camera weird and not talk much because I didn’t want my boss to get mad at me for filming, but I didn’t get the company logo in any shots so idk any reason for them to be mad. If anything I should be mad because that fire actually nearly hurt me really badly.
#silentdork
#Tyler
do u all suc dix?
8==D~~~ (*o*)
#and swallow
Game Break
As stated by The Guy’s this evening in the Main Skype group, the ARG will be taking a break for approx. 2 weeks.
#get well GM Drink orange juice!
Text found on WhatIsBen.com
we will be here soon
wait here
#whatisben.com
#submission
Hey there I think i might habe found something in the johnisdead.c0m Website... A New link... Johnisdead.c0m/3/ Hidden there is a link which gave me a New passworded ZIP called three.ZIP...
That’s quite old actually. It’s in the timeline, the password is: A key.
FAPJACK BIGGEST FUCCBOI.
Bancakes2015
Stahp posting anon. Your syrup isn’t sweet anymore.
Is the ARG dead?
seems like nothings going on for a long time now
No, the ARG is fine. One of the GM’s was sick, it should be starting up any day now :)
/whatdidido/control/therainhasbegun.webm
/whatdidido/control/therainhasbegun.webm
#johnisdead.com
#video
#lunar children
“John-ing”
Great find! I believe this is a test page from a long time ago, when John was testing out stuff on Janus. I’m sure it has no relevance to the game, but good job anyway :p
#lol
#when john attacks
#submission
So we can safely assume that the Lunar Children have seen this video, and know that they do indeed possess song powers, with an Ocarina that rightly belongs to the ID’s!!!
#We need our ocarina back asap!
#tyler
#video
#Tyler
#video
Stupid. Stupid. Stupid! We told him to stay away from the fishery…
#tyler
#video
must be another one
Although it’s not mentioned in the timeline, some other ID’s have said they remember this page.
Published on Sep 9, 2015
I was at a convenience store earlier and must have started recording on accident while I was holding my phone in my hand. I decided I would upload it though, because I didn’t notice while I was there, but when I went to get some beer off the shelf in the end, it looks like some guy was smiling at me from the room behind the shelves. It is kinda hard for me to tell though since everything started getting fucked up near the end. Oh well, at least I shouldn’t be seeing him again anytime soon.
#tyler
#video
Governing.webm - Johnisdead.com update 9/9/15
#johnisdead.com
#video
http://johnisdead.com/
the site has died?
/rosa
fortune.webm
johnisdead.com/rosa/ update - 9/16/15
(Source: youtube.com)
#johnisdead
#video
how do you find those subsites? yourself or somehow else?
We know from experience, that trying key words as URLs usually provides outcomes.
/rosa, in particular, was tried because of the .mp3 clip on the main page.
Published on Sep 19, 2015
I am not going back, yesterday is the last time I go anywhere near that area of the woods. But damn it took me a long time to get the hell out of there after I saw that man. It felt like I was wondering through the woods for hours and fucking hours.
#tyler
#video
Rosa - 9/18/15
This conversation happened between 12:43am-2:17am. (/key592)
<Rosa>: I have seen so much in my time
<Rosa>: too much
<Rosa>: That thing
<Rosa>: “Luna”
<Rosa>: Would take the sight of those who have seen so much
<Rosa>: not I
<Rosa>: I have received no such mercy
<Rosa>: I keep my eyes
<Rosa>: There is much for me to tell
<Rosa>: So please
<Rosa>: Ask again
<Zangoose>: What is it that you saw? What is it that is so terrible you’d rather have lost your sight
<Rosa>: When he came to me, Kelbris, it was nothing like when he came to my brother. It was a great punishment and I was forced from this world.
<Rosa>: This sent me back to hopeless chaos, until I finally happened upon a place many referred to as Holy.
<Rosa>: I saw Her
<Rosa>: it
<Rosa>: it is no god
<Rosa>: it is indescribable
<Rosa>: a horrific terror of unimaginable power
<Rosa>: However, it freed me from where I was.
<electricusagi>: that sounds pretty scary
<ADULT_LINK>: Agreed
<Rosa>: I know it only returned me as part of a plan, but not even I fully understand.
<Zangoose>: Do the names “Doug” or “Mason” ring any bells?
<Rosa>: Yes
<Rosa>: I promised myself after the previous events I would stop everything
<Rosa>: and interact no more
<Zangoose>: And yet here we are. Is there something so sever coming up that you decided to intervene again?
<Rosa>: I have no choice
<Rosa>: There are powers at play that have forced my hand so that I may not stay silent. My interaction is part of the rules of their “game”.
<Rosa>: I have seen this game over and over
<Rosa>: The passing of many links
<Rosa>: I feel though if this link may be sparred, a change may take place.
<Rosa>: This place is dangerous, the architect of this place made this location in secret, with 3 numbers under the idea that it would protect him. Due to what that group calls “the rule of 3”
<AmoBishopRoden>: Any advice?
<Rosa>: Your current link shall see one of the transcended tomorrow.
<Rosa>: He thought you were all insane
<Rosa>: He shall soon change his mind
<ADULT_LINK>: wait the link thought we were insane?
<Rosa>: He has lived a quiet life free of these horrors for so long
<Rosa>: The voice in the darkness
<Rosa>: the one behind you
<Rosa>: You allowed him to fool you
<Rosa>: And thus you lost the trust of the lone wolf
<Rosa>: He is still a friend
<Rosa>: I gave you my vision
<Rosa>: Ask me of it
<Rosa>: I shall tell you what I may
<Zangoose>: Is there anything that we’ve been doing that is constantly throwing us off track?
<Rosa>: No
<Rosa>: But the ‘track’ may throw itself from you and you will be forced to find it again.
<ADULT_LINK>: any suggestions to help us find it easier?
<Rosa>: Wait until tomorrow, meditate upon what wisdom you are given.
<Rosa>: You have yet to ask of the vision, your fortune.
<electricusagi>: oh
<AmoBishopRoden>: what is our fortune?
<electricusagi>: can we have a vision?
<electricusagi>: miss rosa ?
<Rosa>: He will leave this place
<Rosa>: your link
<Rosa>: But what shall follow
<Rosa>: I must not say
<ADULT_LINK>: aw why no
<ADULT_LINK>: aw why not
<Zangoose>: What is our goal?
<Rosa>: There will be a ceremony on the 11th night
<Rosa>: so many died in that place
<Rosa>: more than you understand
<ADULT_LINK>: another ascension?
<Rosa>: they wish to right a horrible mistake
<Rosa>: the failure of the night of the past
<Rosa>: there are many in that building
<Rosa>: but you can see none
<Rosa>: He is being forced there
<Rosa>: wait
<Rosa>: He is there
<ADULT_LINK>: what of skm, do you know where he is? or how we can reach him?
<Rosa>: The exile
<Rosa>: Patrem he calls himself
<Rosa>: He is there at this time
<Rosa>: He will bring him there on the 11th night
<Rosa>: But he does not understand what he is doing
<Rosa>: the four are not a mere tool
<Rosa>: The ceremony will not bring the moon he is calling for
<Rosa>: but
<Rosa>: I must not speak of it
<Rosa>: You have already seen some of them
<Rosa>: the four
<Rosa>: giants
<AmoBishopRoden>: who are they?
<ADULT_LINK>: are some of them called “Tyler” “John” and/or “Jacob”
<ADULT_LINK>: by any chance
<Rosa>: I may tell you what you already know
<Rosa>: you know two names
<Rosa>: Kelbris
<Rosa>: Douglas
<Zangoose>: Vincent, by chance?
<Rosa>: No
<ADULT_LINK>: any idea on when we might learn the other 2 names?
<ADULT_LINK>: since i dont think you’re going to say them here
<Rosa>: You may look into the past and see them, but you would still never truly know.
<Rosa>: This wisdom will come when the time is right.
<ADULT_LINK>: Oki.
<AmoBishopRoden>: the cult’s website, how do we get in and take back what is ours?
<Rosa>: You seem to not understand what was taken from you.
<Rosa>: Allow me to help you
<AmoBishopRoden>: please so
<Rosa>: Do you know the creature, the one you have all fought for so long, since the times of the old links?
<AmoBishopRoden>: Yes
<ADULT_LINK>: is it patrem?….
<Rosa>: no
<ADULT_LINK>: oh ben
<ADULT_LINK>: nevermind im dumb
<ADULT_LINK>: sorry
<electricusagi>: ?
<mib_nstgs2>: hello
<mib_nstgs2>: (this is arg, by the way)
<Rosa>: The creature controlled that boy.
<Rosa>: The creature is what you fight against
<mib_nstgs2>: Patrem>
<Rosa>: No
<mib_nstgs2>: who then?
<ADULT_LINK>: ben ya goof
<Rosa>: You know him as the dark link.
<Rosa>: Tenebris
<ADULT_LINK>: oh
<electricusagi>: o:
<Rosa>: It is from before our time
<mib_nstgs2>: before the time of the moon children?
<Rosa>: from before this realm, or any realms aside from its own existed.
<mib_nstgs2>: Oh, nevermind
<Rosa>: It only wishes to make games of your kind. It seeks only to amuse itself.
<Rosa>: After it was sent here, it asked that “goddess” to give a gift of her own power to your kind.
<ADULT_LINK>: The Ocarina?
<Rosa>: It is forced to call it that yes.
<mib_nstgs2>: “forced’?
<ADULT_LINK>: Your wording for that, are you saying that the ocarina is sentient?
<mib_phnj81>: Ay tis faut
<Rosa>: I know little of its workings
<Rosa>: however
<Rosa>: His time with that boy left an imprint on him.
<mib_phnj81>: Emotional imprint? Physical imprint? Ya saying he slashed him?
<Rosa>: He cannot escape the need to call everything by the eye of that boys mind.
<mib_phnj81>: also has the ocarina decided to abandon us, if it is indeed sentient
<electricusagi>: o: he’s trapped in a kids mindset
<Rosa>: No, the power is not sentient.
<Rosa>: But its original wielder is.
<mib_phnj81>: ahh
<mib_phnj81>: so thats how it is
<mib_phnj81>: im sorry i just missed a LOT so
<mib_nstgs2>: yeah, same.
<electricusagi>: the original wielder?
<Rosa>: Luna
<mib_nstgs2>: Ah.
<mib_nstgs2>: and who is Luna, exactly?
<ADULT_LINK>: …
<ADULT_LINK>: really gys
<ADULT_LINK>: like
<ADULT_LINK>: really
<Rosa>: I have seen the it already
<Rosa>: you will have this power back though
<mib_nstgs2>: oh, that’s good
<mib_nstgs2>: I hope.
<Rosa>: You will soon take their domain as your own. That is where this power has been moved.
<mib_nstgs2>: you mean the lunar children site?
<ADULT_LINK>: Hey rosa, any ideas on how they took the ocarina from us?
<Rosa>: A whim it seems
<ADULT_LINK>: k
<Rosa>: A whim of the dark link
<Rosa>: He moved it to them, for only he and his mother may touch the untouchable, as it is said.
<ADULT_LINK>: Ah.
<ADULT_LINK>: Oh rosa, i have a question
<Rosa>: Ask
<ADULT_LINK>: do you know a John?
<Rosa>: I know of the the burned one as he is called.
<ADULT_LINK>: is it correct tht the dark link has possesed him? or something along the lines of that
<ADULT_LINK>: It’s a bit late where i am and i’m not great at remembering things
<Rosa>: On the 11th night
<Rosa>: The dark link lost control of the boy he once held
<electricusagi>: so yes
<Rosa>: He was forced to roam this world in his true form, for some time.
<Rosa>: After the point in which he saw our link, he seemed to think it humorous to steal the soul of his friend.
<Rosa>: The "weird guy” as your friend Tyler called him.
<ADULT_LINK>: Well damn.
<ADULT_LINK>: What about “Jacob”
<mib_nstgs2>: so that’s who that was.
<ADULT_LINK>: he was a freind of tyler, and we arent too sure what happened to him
<Rosa>: I would put myself in harms way to say much, but I can promise you he is very much alive and safe from any danger for now.
<mib_nstgs2>: oh, good.
<ADULT_LINK>: Oh, well thats good news.
<Rosa>: But his fate is sealed, and what will happen to him may not be changed.
<ADULT_LINK>: i dont want you to put yourself in harm, but knowing that he is alive and well is good
<ADULT_LINK>: i’m hoping its a good fate…
<mib_nstgs2>: So, he will die, though
<ADULT_LINK>: but if you cant say thats fine
<mib_nstgs2>: yeah, never mind, don’t answer whether hes destined for death
<k592>: time is running short
<ADULT_LINK>: oh.
<Rosa>: Thank you for the warning
<ADULT_LINK>: is k592 SKM?
<mib_nstgs2>: your welcome. thank you for contacting us.
<mib_nstgs2>: Yeah, I was wondering who that was
<ADULT_LINK>: um why did you say your welcome… you arent… uhg nevermind
<Rosa>: It is a spirit I borrowed, to hold our connection in this place.
<ADULT_LINK>: Oh duh, K. should have recognized that.
<Rosa>: Ask what you will
<Rosa>: There is much you may ask of me, but you will not like what I say.
<ADULT_LINK>: I dont actually have any time either. sorry
<ADULT_LINK>: Sorry, but i must leave
<k592>: n
<k592>: Not much longer
<AmoBishopRoden>: one more question
<AmoBishopRoden>: who should we trust?
<Rosa>: There is little to trust
<Rosa>: You trusted that man in the beginning, Patrem, this was a mistake.
<mib_phnj81>: we didnt have a choice tho
<ARGdov>: It was, I guess
<Rosa>: The burned one is overtaken by the dark one, who should not be trusted at any time.
<mib_phnj81>: so who can we trust
<mib_phnj81>: and when will they arrive
<Rosa>: This SKM, wishes to help you, but I have seen already, he has his own goals, and would do anything to make sure they are complete. Tread carefully.
<Rosa>: Tyler however
<Rosa>: he is your link
<mib_phnj81>: tyler refuses to trust us yo
<mib_phnj81>: its like
<mib_phnj81>: “NO YALL A BUNCH OF WHACKOS”
<k592>: No one can enter now
<Rosa>: What the lone wolf shall soon see, will make him trust you.
<mib_phnj81>: ahh then theres no problems there
<mib_phnj81>: but theres something that disturbs me still
<mib_phnj81>: what is tylers fate and what is our fate after his
<Rosa>: If you fail to spare this link a terrible fate.
<Rosa>: All shall be consumed
<mib_phnj81>: WELL FUCJ ME
<Rosa>: it will descend
<Rosa>: and its tribe shall take all as their masks
<mib_phnj81>: probs wearing tshirts labelled #ifuckedthemoon
<ARGdov>: oh. no pressure then.
<mib_phnj81>: no but in all seriousness
<mib_phnj81>: who is after us and tyler
<mib_phnj81>: also i would love to know SKM’s goal but since you stated it that way i’m p. sure we arent supposed to know
<k592>: Regiminis is coming
<mib_phnj81>: fuckfuckfuck
<k592>: Time to go Rosa
<Rosa>: All shall be known in time
<mib_phnj81>: How long more do we have
<Rosa>: I must leave
<Rosa>: My time is up
<mib_phnj81>: so like noe okay
<mib_phnj81>: See ya around
<ARGdov>: Thank you, again. well do all we can.
<mib_phnj81>: when will we speak again
<mib_phnj81>: also thanks
<k592>: She is gone
<ARGdov>: oh well. we should probably get going too
<k592>: I recommend you do the same
<mib_phnj81>: thanks for setting this up
<mib_phnj81>: SOMEONE LOG THIS
<k592>: It was Rosa’s idea
<mib_phnj81>: but still
<mib_phnj81>: thank you
<mib_phnj81>: we’ll try to not screw things up
<electricusagi>: owo everyone due your best
<mib_phnj81>: gambatte
/myname
update to the main page
me.webm
johnisdead.com update 9/25/15
#johnisdead.com
#video
#Doug
Stout Shako for 2 Refined!
Banned
I’m sending the Lunar Children to your house.
Paranoid Knocking
Silentdork upload 10/8/15 - 10:08am
(Source: youtu.be)
#Silentdork
#Tyler
#johnisdead
kelbris is like the jehovah's witnesses of the arg in that they both go around knocking on people's doors
Cool thing about Kelbris is that he may (or may not) have a pizza.
#Lol
#kelbris
#but he'll fuking kill you anyway!
Published on Oct 8, 2015
I accidentally stopped the recording early but yeah that was really weird. I had a dream last night I went to that website I was shown a while back, johnisdead.com, made by those assholes who I guess wanted to make some joke out of my friends death or something. And in the dream it actually wasn’t just a blank red page with music or weird sounds, someone I talked to on the website told me to call john. So I looked through some of my old shit and found his old number. I was just expecting a disconnected message, or someone to already have the number taken over, but I guess whoever has it now also has a fucked up phone.
1213182592
this is the number: 1213182592 (I’ve used tone generator online)
~Sebastian
That’s almost amazingly accurate, although the number 7 should be swapped for the 1’s. The number is (727)378-2592, this number has been in the timeline for a long time, it was the original number given to us by /key592.
Redirect List - Oct 13, 2015
Below is a list of redirects found on 10/13/15
http://www.johnisdead.com/again
http://www.johnisdead.com/destroy
http://www.johnisdead.com/dream
http://www.johnisdead.com/equa
http://www.johnisdead.com/excursion
http://www.johnisdead.com/faking
http://www.johnisdead.com/flesh
http://www.johnisdead.com/focus
http://www.johnisdead.com/head
http://www.johnisdead.com/mister
http://www.johnisdead.com/my_dear
http://www.johnisdead.com/sky
http://www.johnisdead.com/terror
http://www.johnisdead.com/thats_ok
http://www.johnisdead.com/try
http://www.johnisdead.com/underground
http://www.johnisdead.com/vice
http://www.johnisdead.com/without
http://www.johnisdead.com/wool
http://www.johnisdead.com/years
http://www.johnisdead.com/me_and_john
http://www.johnisdead.com/blood
#redirects
#johnisdead.com
what is or who is /key592 ? is it something like a tip provider?
It’s a link to “them”.
#We'll learn more in the future
im a spooky anon happy halloween ya damn nerds. OH AND TELL THORIN HE'S A FAT DWARF
guess who's a bunch of nerds
Oh, oh, oh! Is it us?
What do I win?????
http://johnisdead.com/key592/execute.txt
ry.ex
Presumably, this was meant for us to download and play “lostmemory.exe” Unfortunately, several of us were unable to download it. So I’m not sure how to go about this now. Until, we get a clearer view of what this update meant, it won’t be added to the timeline.
11/1 Cipher formula
(FAGGOT CODE #1)
step 1: reverse code
step 2: see spooky sKm
step 3: remove lowercase s&m
step 4: get new code
step 5: see spooky HElp
step 6: remove lowercase l&p
step 7: get ASCII code
step 8: read the message: “they have him and I am
scared, he let me out of his box and im waiting in
my house but something bad is gonna happen in ten
more days I just know it. The masks just wont stop
watching him.”
(FAGGOT CODE #2)
step 1: reverse code
step 2: base32 (ASCII)
step 3: ASCII (base32)
Step 4: remove lowercase i&m (HEX)
step 5: remove the obvious “4” (ASCII)
step 6: reverse ASCII
step 7: (partial decode) “Come to my mind 5?a? home pass I have to tell you the e h he is coming to get m m”
ry.ex
Ok, it does seem as though this was hinting towards downloading the three games: Remember.exe, Lostmemory.exe, and Link.exe.
It may may be, that these will come in handy sometime in the future. If anyone would like to download these games, please go here: http://www.mindshape.co.uk/
(Source: mindshape.co.uk)
#lostmemory423
#remember.exe
#johnisdead.com
Need help {SOLVED!}
3MrC6OLRutS}
#halp!
#cipher
Update 11/3/15 - lostmemory.exe
91hfW:Ms`<;cZIf7R^BW1/(>=86&;]1.t5;6psID;as>^6:FUI;b9PU9L_NQ;b0DZ793&]1/
pb993"D\;bT\R7TMrW10-t97R^HZ;H$4X793,^934_T77B^I;cZOp6rc'B93+\\9N=S`912E
F7TEMg10$q(6WI2d;b]ke>"1qZ91MQW9LVrZ6UXR>6<6fY>#n6b93+P_>#S'p6:OCB>#S$g8
k;NQ1J^SC7R^<V6Vg<L8QAPa;bp%i79*2^107+L9LV`pAQ2T#93+M_:K'#L8Q&#H=&C_H928
- X92dT98lA2J79*8Y8@iamtwo@QnMO9iFtZ8PVrK93+t^7oi&Y79)*F7nQES79*8[7nQ6O78u$38kqiE
=]A9t91D?M9iP%]8k)3;7oiPh93+G\1fI%E7nka=;cZgl93OeR;,oAP93+_T:K17b8QJ;]92
/>c8Q&#H=&UkJ92\/X92dT=8lA&F79*8Y8QnYS9iFtX8kiJX:Ms`A;bp%i79*2^107+L93"b
_91hiX8le_d10-tE7R^BU1/(>986&;]1.Or76psID;as>^6q0mL;aj8Q9L_ZU;aa,V78X
HE KNOWS SO MUCH
W
B U T NOTME
R
O
T
H
E
R
WEA RE2N OT1 IAM M B A E X N
NO W FI ND T HE TRU TH
#lostmemory.exe
#arg
New update added!
The timeline has been updated to reflect the events that occurred on 10/25/15.
#timeline
#arg
#johnisdead.com
Undecim Nocte - Countdown Timer
Undecim Nocte – “November eleventh 2011, thought by many lower ranking members to be the end times prior to its passing due to limited knowledge of what was to occur. In depth discussion is even now highly restricted do to the nature of what occurred on that night. However what is allowed to be said is that on that night the parallelos in all of space and time is thought to have been in perfect alignment, while an unknown growing time anomaly caused instability in time, giving opportunity for many unusual happenings to occur. It may also be known an ascension was performed on this night and was extremely successful, however no more may be spoken of on the matter. Anyone who asks of that night out of turn, or is revealed to hold forbidden knowledge of the 11/11/11 night shall be terminated immediately.”
#Undecim Nocte
whats with the timer?
Countdown to Undecim Nocte (ctrl+f in the timeline to learn more)
find the name
The ANSwe3r is right In front of yOu
fac3e it
I
N
P L
AiN
S I
GH
T
lunarCHILD
WE ARE IN!!!!!
lunarchildren.com
Username: thoth33
Password: 3MrC6OLRutS}
#lunarchildren.com
Our new home
http://lunarchildren.com/forums/
#forums
#lunarchildren.com
the lunarchild is fake and gives distraction, rather then clues
07-25-2015 = date of all accounts created, all which has spooky cringeworthy avatars and fake as topgear bios. all posts are probably made by one person leaving in and out of accounts at around 10/23 to 10/26 days. The site won’t give any clues, it’s all a distraction. do not trust lunarchildren.
Tenebris… Is that you???
#submitted
#submission
Convo w/ SKM
11/6/2016
<SKM>: get in here now
<PatremsBitch>: SKM! Ma nigga
<Amo>: what’s up
<SKM>: I am very short on time
<mib_xinvgg>:
<SKM>: there are cameras everywhere
<SKM>: they watch everything I do
<PatremsBitch>: fuck that’s terrible
<SKM>: they see me using the bloody bathroom XD
<SKM>: but I have no time for banter
<SKM>: I had to essentially steal their irc and lock everyone out to make this work
<SKM>: I couldn’t even jack into the special page I made for this
<SKM>: not that it matters
<Faut>: skm whats up
<SKM>: the damn ai’s ( funny I can still convince myself to call them that) have basically hijacked it
<SKM>: this is a very unstable place though
<PatremsBitch>: Shit nigga, say what you need quick
<SKM>: I lied to you all
<Faut>: how much time do we have
<Amo>: about what?
<Faut>: skm…
<Faut>: are you ls
<SKM>: I have been in that group since long before you knew of me
<Faut>: then why
<Faut>: why did you lie to them as well
<SKM>: this is a very long story
<Amo>: we’re listening
<SKM>: I do not have time to explain
<Amo>: oh
<Faut>: short version
<SKM>: However I can get you back into those forums
<Faut>: summarize it in 20 words or less
<SKM>: I do not know how the shit works
<SKM>: but they have a power
<SKM>: the same one you all had before
<SKM>: that broken thing gave it to them
<SKM>: like he could just move it around
<SKM>: like it was his all along and he was just letting them have it now
<Faut>: he was playing us like a fiddle?
<SKM>: I will get you all back in
<SKM>: you will have access to that and nothing more
<Amo>: what do you suggest we do once we get back in?
<SKM>: be careful
<SKM>: its not a bloody toy
<SKM>: that is my suggestion
<Amo>: got it
<Faut>: okay what do we NOT do
<SKM>: something very strange is going on there
<PatremsBitch>: I assume we NOT get in there and play every song we know
<SKM>: things beyond my control
<SKM>: users coming in beyond my control and weird shit like that
<PatremsBitch>: SKM, are you LiquidSaint?
<Faut>: ^
<Faut>: the real question
<SKM>: yes
<SKM>: goodbye
#skm
#convo
#Lunar Children
Good News Adventurers!
We’ve made contact with helper!
P.S.
Sorry about the delay with getting the timeline updated. I will work on it this weekend.
http://johnisdead.com/
Friend, We Miss You.
Lunar.mp3
Message from Tyler
[1-2-2016]
She doesn’t want me to talk to anyone. She’s taken away all of my electronics, filming will get me into trouble. She won’t tell me why. It’s new years eve, I thought this would be a happy time, but she has me locked in this room. However she forgot to close her laptop.
I feel like someone is still watching me, even now. She said she had to go somewhere for a bit, something about keeping everything under control. I don’t know where she is. But she’s is so different now than I remember her being.
I would try to get out of here, but this place is way up in the mountains.
I keep having dreams over and over. Nightmares. Some burning guy telling me something, and then some owl telling me I need to ‘tell the rest of the story’
It’s the videos
I Know it is
shE says not to upload anymore
I feel like I haVe to
she says I don’t need a vlog
it hurts my aNonymity
that bad people will watch it, she won’t tell me who.
those masked people? The Lunar Children she won’t even talk about. but she acts like she knows something about them
I feel like she always has. I don’t like all the fucking masks she has in her house
I don’t like the chest she has with all the masks covered in “fake blood”. I don’t think it’s fake. Someone is watching me, I know it
but she is not here. I’m going crazy. I think I am fucked.
I was fucked before I was taken by those masked people.
47 4d 33 43 41 4e 5a 56 45 41 32 54 43 49 42 58 47 4d 51 44 4d 4d 52 41 47 4a 52 43 41 4e 42 56 45 41 33 54 43 49 42 57 47 45 51 44 49 4e 4a 41 47 51 32 53 41 4e 52 55 45 41 5a 54 51 49 42 57 47 51 51 44 49 4e 5a 41 47 51 5a 53 41 4e 52 59 45 41 5a 47 45 49 42 56 4d 45 51 44 45 4d 5a 41 47 51 32 53 41 4e 52 53 45 41 32 54 49 49 42 53 4d 45 51 44 45 4e 52 41 47 51 59 53 41 4d 5a 51 45 41 5a 57 4d 49 42 53 4d 59 51 44 47 4f 4a 41 47 51 33 43 41 4e 4a 58 45 41 33 44 45 49 42 57 4d 51 51 44 49 4f 42 41 47 51 32 43 41 4e 44 43 45 41 32 72 65 64 44 53 6d 61 6e 49 42 53 47 49 51 44 47 4d 4a 41 47 51 59 53 41 4e 44 43 45 41 32 57 43 49 42 53 48 45 51 44 47 4f 42 41 47 51 59 43 41 4d 33 43 45 41 33 54 41 49 42 54 47 41 51 44 4f 4d 5a 41 47 51 59 53 41 4d 5a 51 45 41 5a 57 4b 49 42 56 47 41 51 44 4f 4d 5a 41 47 51 32 53 41 4e 52 53 45 41 5a 47 49 49 42 55 47 45 51 44 45 59 4a 41 47 51 32 43 41 4e 52 57 45 41 32 54 43 49 42 58 47 51 51 44 47 59 4a 41 47 51 32 43 41 4e 52 57 45 41 5a 54 41 49 42 54 47 45 51 41
RWCNALNYCWPLXWWNLCRXW
CPOCZYTVNLMDTWWLWTEYFEYPWTDPETDPSEAPPV
SQHBQ QCUEDU,VUHTIDIXUYIDEJMYJXJXUC!DCFVXDM UZMFS XJMM GKGCFJX TFF UIF TPVSDFLFKCSFCJ TUBSU PG UIF HBNFXLFKCFLVCXFLVC UIFEPSXOFEPOF GSPN UIFGBUIFS UIFCVSOFEPOF GSPN L
Someone is here messing with he computer somehow. I need to go. She usually uses irc chat and lenphone. So hopefully she won’t notice that I managed to get into her skype for a moment.
#johnisdead
#tyler
Hello chaps. I'd like to enquire as to how I can become one of these Internet Detectives?
PM us your Skype name and we’ll add you.
Noise
background noise.mp3
you guys dead?
No, Tyler’s still trapped in his girlfriends house in Australia. Hopefully , he’ll contact us soon.
February 11th, 2016
At an unknown time, a video was uploaded to the Silent Dork youtube channel. The video was titled “Waiting”, and featured a flaming background with red shaking text that flashed: “Waiting, Friends, Masks, The Ashes”. The video was tagged with: “NNN”, “from beyond your world”, “tenebris watches”, “regiminis watches”, “play again”, “soon”.
#silentdork
#johnisdead
#youtube
#video
February 15th, 2016
At about 2am, the video “IMG_1426” was uploaded to lostmemory23. It features a person walking around in a wooded area examining a key and various notes, one of which features the names of significant arg characters. The description features a cipher which translated: “If you wish to be called SKM from here on, fine that is what we will call you, but before we can let you come to the fishery we need you to prove your worth to us, record yourself going to the enclosed geo coordinates, this place was the meeting grounds of who we knew as the misguided. There should be a key, this key gathered the essence of the dying remnants of that place, find it, open the last standing building in that orchard with it and film what masks remain for our archives. If you succeed you will be answering to the man who ended them for us from the inside, Elder child Mathew.” (cipher was encoded in base 64, then reversed) This suggests that the video may be partial footage of SKM fulfilling the described actions.
#lostmemory423
#youtube
#johnisdead
Johnisdead Timeline - 2015
Below is the entire timeline for 2015
May 14th, 2015
· At 9:51pm, /Patrem\ posted on WH. He wrote “The time is coming children”
· At 10:07pm, /Patrem\ posted again: “The boy, the deceiver, he is approaching you. He is upon you all yet you cannot even see.
· At 10:27pm, /Patrem\ posted again: “That damaged boy who knows himself now by numbers. Ignore him, he is foolish.”
· At 10:29pm, User “31071157 35667145 310” (#’s Guy) joined the ARG Call Group and posted:
“00100000 00100000 01101000 01101110 00100000 01101001 01110011 00100000 01100100 01100101 01100001 01100100” (translated: “hn is dead”)
· At 10:36pm, #’s Guy posted “01011001 01110011 01101000 01100100 01110100 00100000 01111001 01101111 01110101 00100000 01101101 01110101 01110011 01110100 00100000 01100110 01101111 01101100 01101100 01101111 01110111 00100000 01110100 01101000 01100101 00100000 01101001 01101110 01110011 01110100 01110010 01110101 01100011 01110100 01101001 01101111 01101110 01110011 00101110 00100000 01001001 00100000 01100001 01101101 00100000 01100010 01101100 01101001 01101110 01100100 00100000 01100010 01110101 01110100 00100000 01001001 00100000 01100011 01100001 01101110 00100000 01100110 01100101 01100101 01101100 00100000 01110100 01101000 01100101 01101101 00100000 01110100 01101000 01100101 01110010 01100101 00101110” (translated: “Yshdt you must follow the instructions. I am blind but I can feel them there.”)
· At 10:39pm, /Patrem\ posted on WH in response to #’s guy’s post in the ARG Call Group: “BE SILENT BOY IT IS NOT YET TIME!”
· At 10:44pm, /Patrem\ posted on WH: “HE WILL TRY TO SPEAK LIES TO YOU! DO NOT LISTEN TO THIS BOY FOR HE WILL GUIDE YOU TO RUIN!”
· At 10:46pm #’s Guy posted in the ARG Call Group: “He is hurting me”
· At 11:24pm, /Patrem\ posted on WH: “YOU FOOLS DO YOU KNOW WHAT YOU HAVE DONE?! YOU ARE ALL DAMNED NOW!”
· #’s Guy then begins a series of posts in the ARG Call Group. The transcript is:
· I’ll show you
· I
· Father is very mad
· Im not allowed to talk right now
· You did it
· 01101010 01101111 01101000 01101110 01101001 01110011 01100100 01100101 01100001 01100100 00101110 01100011 01101111 01101101
· (translated: http://johnisdead.com/)
This new website features an image of a foggy road titled “foggyworld248.jpg”.
It has an audio file titled “uploads/background.mp3”, the title of the page is “WAKE UP”.
· At (unknown timestamp), /Patrem\’s status changes to “exsecutus”,
which translates to “lazily”
· At (unknown timestamp), Drowned ( #’s Guy) began to contact the ID’s via Skype. The transcript is as follows:
o Drowned joins the Skype call (Skull Kid’s laugh is played)
Drowned leaves the call
Drowned posts in the Skype chat: “I’ll show you”
o Drowned joins call again. (Plays Song of Unhealing)
Drowned posts “I” in text chat.
(More Song of Unhealing is played)
Drowned whispers into the mic. Words are hard to make out, some guesses are “Yes”, “Cannot”, “Secret”, and “Isn’t it“
(Drowned then begins to speak clearly)
Drowned - ”I’ll show you.“
Drowned - ”He’s hurting me.“
Mugen - “Who’s hurting you?”
Drowned - “He’s hiding now.”
Mugen - “Who’s hiding now?”
Drowned- “Father”
Drowned - “Quiet, he’s coming now.”
Mugen - “Understood.”
(Song of Unhealing plays, loud noises are
heard)
“Please don’t hurt me.”
“Please don’t hurt me.”
“Please don’t hurt me.”
(A loud noise is heard, and Drowned
leaves the call)
Drowned joins call again “Father is very mad”
“Im not allowed to talk right now”
(More Song of Unhealing is played)
“Father said ”
“I’m hiding from him.”
(Corrupted music plays)
“Please let me go, please stop.”
(Drowned is quiet for a long time)
Drowned - “Four”
Mugen - “What is your name?”
Drowned - “I can’t remember anymore.”
Mugen - “Message corrupted. Can you repeat that.”
Drowned - “He’s trying to…”
(Loud corrupted messages come from Drowned)
Mugen - “He’s trying to what?”
(More corrupted noises)
(Drowned says something very quietly)
Mugen - “Speak up, we cannot hear you.”
Drowned - “I’ll show you.”
Mugen - “Lead the way.”
(Drowned speaks sobbingly)
Mugen - “Calm down, we will do what we can.”
Drowned - “Father is angry.”
Mugen - “I can see him. The fool.”
Drowned - “Free our God.”
Mugen - “Mission Accepted.”
Drowned - “Three are gone now.”
Drowned - “Father sent three of you.”
Wolf - “Who are the three?”
Drowned - “I can’t tell you.”
Drowned - “They were never really there.”
(Drowned whispers things very quietly)
Mugen - “Standby.”
Mugen - “Speak up a bit it’s hard to hear.”
Drowned - “Father will hurt me.”
Mugen - “Do you think it’s worth it?”
Drowned - “I will do it.”
Mugen - “If that is your wish.”
Drowned - “Do you think I am?”
Wolfcat - “Kelbris?”
Mugen - “Could it be that you are Kelbris?”
Drowned posts more binary in the text chat, it translates to the same as before:
“Yshdt you must follow the instructions. I am blind but I can feel them there.”
(A deep voice comes out of Drown’s call)
“I HAVE FOUND YOU BOY”
(Drowned leaves the call, and posts the following in the text chat)
“You did it”
· At 11:52pm, #’s Guy posts in the ARG Call Group, and is apparently now taken over by /Patrem\ the transcript is:
I have silenced that boy for now.
I am still in him in this time.
This worthless meat puppet
I have silenced the boy
I sent my neophyte first, the grand child to silence him.
But I must do all myself it seems.
All of you
Are damned
My child, you know who you are child, I speak now to you.
You have lost fellow detectives now
But, They were never here
Don’t worry children
Expect one back soon
But you must find him first
In this time
We made him forget
You shall not find him
The child known as Vincent
Due to your foolishness
The one who is dead
Has left words for you
Be aware
The grand one is coming
Regiminis
May 15th, 2015
· At 12:21am, /Patrem\ (#’s Guy) PM’ed wickedlady4180 on Skype and gave her a choice. He asked her to choose between 3 options and find out information about that option. The options were:
· > The one who was taken
· > The one who died
· > The one who has forgotten
· Wickedlady4180 chose option #2, and was given this information:
He will never return
You knew him as mesic
John
/Patrem\ then left for the night.
May 16th, 2015
· At 12:13am, A new user on WH by the name of “SKM” posted in the ARG thread. “I can’t talk long but I am a friend. This encryption is good but not that good. /tyler”
· At 12:48am, Wolfcat posts a new link: http://johnisdead.com/tyler/. This new page features a black page, nothing hidden its source code, and an audio file named “findhim.mp3“
· At 1:01am, “SKM” posted again: “That purple bastard and his “neophyte” regimins can’t see what I am saying for now but I have to be fast so you better be taking note. There is a lot going on right now you could not begin to understand, you guys really did it with that time jumping shit (who in the bloody hell gave you control of such dangerous shit?). Those 3 were never there to begin with, have you bothered to listen to the beginning of your “theme”. The rabbit hole goes deep my friends. If things go as planned I will be setting up a secure communications point with you all on sometime between the 19th and 20th (yes in 2015 because the purple bastard can never be exact in his reference to time)”
· At 1:11am, Wolfcat asked: “Who is this ‘neophyte’?”. SKM answered: “Well you will have to be a bit specific. He has had a handful of neophytes and “grand children”. Ha I’m just pissing about. I know you are talking about ol regimipiss. Well all I know about him personally is that he wasn’t always called that, regiminis I mean. He was dedicated really strongly to “The path of parallelos” and all the other various teachings of the lunar children. He was ready to die for the purple bastard. Then father vincent over at the fishery compound up and decided the kid was ready for ascension, by decree of the purple bastard himself.”
· At 1:17am, Sengi asked: “By those 3… Do you mean John, Tyler and jayckup or Mason, Doug and Vincent?”. SKM answered: “Tl;dr, the 3 are jayckup, tyler and john.
I can’t exactly get to into detail about this but when regiminis hijacked the “portal” as it has been called (the purple bastard is a bit silly with his need to mystify) and called it what he did, it was for a damn petty reason. But it is what it is, john is certainly no longer around and has not been since the accident on 11/11/11.
Tyler is perfectly fine at the moment. However, fuckery from the purple bastard and his children brigade has caused him to forget this whole mess. Worry not, I’ll be doing some work soon to make him come out into the open again, just try not to scare the “broskino”.
I actually have no intel on this jayckup person other than he was closely associated with tyler and john and vanished some time before the 2011 accident, nor do I have any intel on mason.
Doug is still around, but let us just say that a lot has changed since 2009.
I don’t think you ever knew vincent before 2015, but I can’t be sure since he wasn’t always named vincent either and I have no intel on him before that. But since the 11/11/11 bs he has still been doing the same thing, being blissfully un aware of his role as purple bastard vessel (but a little fun fact I know that no one else does, he can’t get the hell out of vincent either, and THAT is bloody hilarious XD )”
· At 1:55am, SKM posted: “Times up, I hope you were taking note of this. See you all again soon hopefully.” He then proceeded to deleted all of his messages, and replaced them with: “Catch me if you can purple bastard XD”
· At 5:56am, /Patrem\ posted to WH: “Fool who dares to mock his god, my sight is without limit. While you may have obscured your words, I can sense you. I test you to tread once more in this domain, and I shall show you why those under me would sooner choose to bleed themselves than invoke my wrath.”
May 17th, 2015
· At 12:13am, a new player by the name of Zack Nelson discovered a change to the main page of johnisdead.com. The page now featured green text that read: “NNSXSNJZGI”. Wolfcat used Base32 to find the translation: “key592”. This leads to a new page on the site: http://johnisdead.com/key592/. This new page (titled: Index of /key592), has three links:
o Parent Directory (leads to main page)
o _o_n__urned.png (shows a corrupted image, the blanks fill into: John Burned)
o Fate.txt (the text reads: February 19th, 2015 Check your notes)
· The Internet Detectives then check the notes from Feb.19th. They discover that this is the day we first met /Patrem\, one of his messages to us was: “He also enjoyed music. o n urn d. Now he has ascended.” We first thought that message meant Vincent was burned, now we realize it was Mesic (John) this whole time.
· At 3:14am, Zack Nelson discovered that “Fate.txt” had changed. It was now a wall of text that read over and over: “He also enjoyed music. John Burned. Now he has ascended.” The same words as /Patrem.
· At 3:20am Oceanstuck discovered that “Fate.txt” had changed again. It now said: “Too late…”
· At 3:31am it was discovered that the image and background music of the main page of johnisdead.com had also changed. It now featured an image of Transmission Towers named: “DSC_0488.jpg”, and an audio file named “uploads/background.mp3”. The audio played is reversed. (Audacity was used to un-reverse the song. The title of the song was discovered to be: “@90” by artist: “k3v1n”). The page title was renamed to “Research”.
· The extension on the audio file lead to a new page: “/uploads”. The new page features an image similar to the favicon.ico on the main page. It’s a pink block with a digital “Y” in the center, the image is titled: “GOH.png”. Above the image, red text reads: “UPLOADED FROM REMOTE SOURCE 8/29/2014 4:44 AM”. The title of the page is: ”8/29/2014 4:44 AM”. Nothing is hidden in the source code.
· At 3:52am, ArgDov discovered a new link on “/key592”. The new link was titled: “firekid.jpg”, and linked to a corrupted image of John Mesic.
· By 3:55am, the photo “firekid” was removed. ArgDov commented: “you think we might be getting messed with?” to which Oceanstuck replied: “clearly”.
· At 4:00am, Archery2000 discovered that “Fate.txt” had changed once again. It now read: “you think we might be getting messed with? clearly”. The Internet Detectives realized, they were being watched!
· By 4:04am, the entire “/key592” page was deleted.
May 18th, 2015
· At 12:03am, ArgDov noticed the site’s main page had changed. The green lettering, in smaller font size, one again read: “key592”.
· The directory of /key592 featured a link titled “fishery.jpg”, an audio file called “firekid.wav”, and a link titled “i.txt” which read: “one page remains at this moment…You tryed but got it wrong…” Meaning that there was an undiscovered page we had yet to find.
· By 12:14am, /key592 was purged of links. The Internet Detectives will from now on refer to the GM as “The Guy”
· At 12:45am, wickedlady4180 posted in the Skype: “GM we can’t find it, give us a hint”
· At 12:53am, a new link appeared on /key592, the new was: “threei.txt”. This document read: “A brand new name”, meaning The Guy was giving us a hint.
· At 12:59am, a new link was added to /key592: “R I I I S.txt”. Then yet another link was added: “REG I I I S.txt”.
· At 1:01am, Wolfcat posted a link to a new page: “/regiminis”. This new page featured a flash video of John Mesic called “deadjohn.webm”. The flash was not saved, but a .gif exists.
May 19th, 2015
· At 9:10pm, Seeker discovered an update on the main page of johnisdead.com. This new page featured a black background with floating green text that read: “HP/NCLEC/ T:LAHDNOT/URIR.M”, the audio was called: “l_nar__il_ren.mp3”, and nothing was hidden in the source code.
· At 9:17pm, Wolfcat discovered a new file on /key592. The new link was titled: “output.wav”, and was a Morse Code that translated to: “safehaven”.
· At 9:19pm, The page /tyler was updated. The page read: “Please stay in the line, your next. Link will be arriving shortly”. The audio was titled: “linebusy.mp3”. There was a video on the page called; “operator.webm”. The page also featured a falling marquee of text in several different languages, that read: “Father of lies, Save from GOVERNANCE/Regimins, We ’re stuck here, Give us our Savior, Help us, Our Savior, Save us from GOVERNANCE/Regimins”
· At 9:37pm, Adult Link discovered a new audio on /tyler. The new audio was titled: “dial.mp3”
· At 10:02pm, Mugen Kagemaru decoded the cipher on the main page. It was a url link to: “http://lunarchildren.com”. The new page featured a black background with green text that read: “Drezzed again you bloody shazbots, you’ll have this place back when I damn well please. -SKM”. The page also featured a video that was titled: “MAXYHAXXXY.webm”.
· At 10:20pm, Wolfcat discovered a new page on johnisdead.com, this new page was http://johnisdead.com/safehaven/592/ (no longer a link). On this new page was a chat box, in this new chat, SKM was waiting for us.
The chat with SKM was long, and a lot of things were discussed.
The link to the chat is here.
May 20th, 2015
· At 12:03am, SKM link us to a new Youtube channel “youtube.com/user/silentdork” and tells us to keep watch on it for updates.
· At 12:45am, a new page was given to us: “/lostmemory423”, it featured a picture titled “hisgoal.jpg”. The audio file on the page was “icanfinnalybreathe.mp3”
· By 12:53am, in the SafeHaven chat, SKM introduces the Internet Detectives to his helper, who he calls “Kid”. The Kid then changes /lostmemory423. The page now features an icon of the original character “Drowned” from Jadusable’s Moon Children ARC. In the background were multiple .gif images of the glowing eyes from Ryukaki’s video.
· By 1:42am, SKM is panicking, trying to save his helper. Someone called “The Red Man” (aka: Patrem’s Neophyte; Regiminis) takes over /lostmemory423. /lostmemory423 then changes again, to a black page with red falling marquee text that reads: “Drowned”. The text eventually becomes smaller and smaller, until it disappears entirely. The page then features a new video: “R.webm”. This video features a black and white skull-like creature. The name “R” refers to the beloved “Red Dot” (whose image name was also R).
· At 2:14am, Regiminis finally enters the SafeHaven chat and posts: “I found you!” SKM flees the chat. And the pages were once again purged from the site.
· At an unknown time, the main page of johnisdead.com changed to an image of a burned down home called “HOME.JPG”. The title of the page is: “JOHNIS”. Nothing is hidden in the source code.
May 21th, 2015
· At 3:36am, Zack Nelson discovered a site update. The main page of johnisdead.com changed to an image of a purple cloud, The image is called “hewaits.jpg”. The title is “T”, and the audio file is titled: “FRIEND.mp3”
· At 3:45am, Wolfcat discovered a new link on /key592. It was an image called “DELAPITATED.jpg”.
· At 3:47am, SKM posted on WH: “I only have a thin window to talk. Tyler is about to upload those videos seeing as connection with him was drezzed, meaning he probably replaced his hard drive. Be on the look out.” He then deleted the message, and replaced it with binary: “01001000 01100101 00100000 01101001 01110011 00100000 01100011 01101111 01101101 01101001 01101110 01100111 00001010 00100000 01110011 01100001 01111001 00100000 01101110 01101111 00100000 01101101 01101111 01110010 01100101” (translated: “He is coming say no more”)
· At 3:52am, /Patrem\ posted on WH: “You thought you could hide from me child? I knew I would draw you out. Now Let us see what it is you truly are!” He then posted: “49 20 41 4d 20 47 4f 49 4e 47 20 54 4f” (translated: “I AM GOING TO”)
· At 4:05am, SKM responded to /Patrem\: “Oh come off it purple bastard, do you think you can drezz me right now while you are still booting back up? I didn’t bloody think you would try me in the condition your in but whatever, your funeral shazbot! XD” He then posted a large block of binary (view post here) that translated to: “592”.
· At 4:07am, /Patrem\ posted a cipher that has not yet been solved: “áþáý´ãžã^x”. This is likely a continuation of his previous post.
· At 4:09am, /Patrem\ posted again: “45 67 6f 20 44 65 75 73 20 74 75 75 73” (translated ” I am your God”)
· At 4:15am Mugen Kagemaru posts an incredibly pretentious display of self-importance. To which /Patrem\ replies: “53 53 45 4c 54 49 4d 49 4c 20 53 49 20 52 45 57 4f 50 20 59 4d” (translated: “My power is limitless”)
· At 4:20am, /Patrem\’s status on WH changes to “fluxus”, which is latin for “flowing”.
· At 4:34am, Wolfcat discovered a new file on /key592: “tempdrezzed.png”. This image is a corrupted image of /Patrem\’s avatar.
· At an unknown time, Tyler’s youtube channel (youtube.com/user/silentdork), uploaded 3 video’s:
o (Jacob), Featured Tyler having a casual conversation with Jacob.
o (Fun night with john and kevin), Featured Tyler, John, and Kevin playing Bloody Mary and Candy Man, in their bathroom.
o (Fun night with john and kevin 2), Featured the same 3, playing the Ouija board.
May 22nd, 2015
· At 2:03am, Drowned posted to the main Skype group: “01001001 01110100 01110011 00100000 01110100 01101001 01101101 01100101” (translated: “it’s time”).
· At 2:11am, Drowned posted again: “He is there, Tyler.” And “silentdork active”
· Tyler then began answering posts made to his youtube comments by ID members.
Notable comments from these video’s include:
· Wolfcat: ‘Any of this stuff ever work? Did spookies come after you?”
· Silentdork: “I have not logged into it in forever ever sense I moved over to just using facebook a while back. But damn now I am really sad actually. I just went racing through everything and yep I lost the old skype logs from my previous drive. That is a hell of a lot of convos with john and jacob lost. Kevin wasn’t much about social media though to my understanding.”
· Wickedlady4180: “Love that t-shirt, I’m a Nintendo addict too! Do you like Zelda?”
· Silentdork: ”I love that series! I know john and kevin liked it more though. Kevin even had every thing zelda there was to obtain up until 2011 when he went missing. I preferred windwaker myself, but john and kevin both liked majoras mask the most. However my favorite games series is actually silent hill.”
· Wickedlady4180: “Majora’s Mask is my personal favorite in the series, but Windwaker was awesome too! I never got into Silent Hill though, it’s too spooks for me :(”
· Silentdork: “I don’t know if you know the other people who have been commenting on my videos or something. But I am pretty happy I guess that a few broskinos have suddenly taken a liking to my new vids out of the blue. I’ll honestly add you all on skype seeing as I don’t think I really have anyone else to talk to at the moment.”
· At 9:28pm, Zack Nelson discovered an update on johnisdead.com. This new update featured a background called “fwoogrglyd.gif”, and flashed various parts of the video “fog.webm”. There were two videos on the page: The first was called “FIREKID.webm”, and featured a loop of John from Tylers’ 2nd Youtube video. The second video is called “FOG.webm”, and is a badly corrupted video that appears to be the three guys walking down a street. On the page was green text that read: “watch?v=”. Hidden in the source code was: “9bZHz5PhHxM 1:41 WATCH THE SKY”
· At 9:43pm, Adult Link rewatched Tyler’s 2nd Youtube video at the 1:41 mark, and noticed in the sky was the moon from Majora’s Mask.
· At 10:39pm Wolfcat discovered a new page “johnisdead.com/lunar/”, however the page was blank.
· At 10:43pm, Sengi checked /lunar and discovered a message that said: “Wait”. It seemed we found a page that was currently being created & edited.
· The page /lunar then began update and purge:
o 11:01pm: “I’m in the phone lines”
o 11:04pm: “Nothing could stop the irritation”
o 11:06pm: “Fire… burning flesh and melting bones…”
· At 11:09pm, John Mesic initiated a call in the ID Skype Call Group, but disconnected before anyone could answer.
· At 11:10pm, /lunar updated again: “…I cannot speak…”
· At 11:12pm, Wolfcat suggests in the ID Main Skype Group that New Wave Bossa Nova should be played, as it had worked in allowing us to communicate with players in the past.
· At 11:15pm, /lunar updated: “Your old ways will not work…“ This means that we cannot use the Ocarina.
· The ID’s then began to ask a series of questions in the Main ID Skype Group Chat, the answers were provided on /lunar. Below are the exchanges:
o Wolfcat: “John what caused the fire? Or should we talk at a different time”
o Answer: “…that is not my name…”
o Mugen Kagemaru: “Who is it, then…? If you’re not John Mesic then who are you?”
o Answer: “Sorry of this, the various inhabitants like playing around. Don’t trust all you hear. He is not the one who burned.”
· By 11:43pm, /lunar was purged.
May 23rd, 2015
· At 11:55pm, Wolfcat discovered a change on /tyler. The page was black, with an audio file called “callwaiting.mp3”.
· At 11:55pm, The background to the main page of johnisdead.com changed to an image called “NOTTHEONE.jpg”.
May 24th, 2015
· At 12:04am, The page /tyler changed again. There was now an audio file called “dial.mp3”.
· At 12:24am, Wickedlady4180 noticed the page /tyler had changed once again, it now featured an option to upload a file. Above the option was an address: “pididoip@”. However within minutes, the option to upload was removed, and the email remained.
· The ID’s deduced that they needed to decipher the tones in the audio file “dial.mp3”. In the meantime, ID members began to email “pididoip@johnisdead.com”.
Below are the email exchanges between “K” and ID members:
o Spirkiroid: Hello? (Response: Upload.)
o Adult Link: Can I have my chocolate milk soon, guy? (Response: image of strawberry milk)
o Spirkiroid: (Response: LETTERS)
o Adult Link: (Response: dial.mp3 numbers and letters)
o Adult Link: (Response: You miss him already)
o Adult Link: (Response: Pick up the phone)
o Spirkiroid: (Response: The answer is right in front of you)
o Spirkiroid: (Response: Attachment)
Around this time, Spirkiroid deciphered the dial tones: “86274644462225”
(Trans: “To bring him back”)
o Spirkiroid & Adult Link: (Response: keyed tobringhimback not yet discovered)
o Spirkiroid: (Response: joghismemory tyler detectives)
o Oceanstuck: Sent a horrifying image. (Response: Another horrifying image)
o Spirk, Link, & Ocean: (Response: Your call has been forwarded)
· Between 12:46am, and 1:26am, “K” then sent a series of email’s to Adult Link. In them he revealed that he “travels through wires”, his name is “George”, and finally gave Thorin his beloved “Chocolate Milk”
· At 1:38am, Tylep joined the Skype group. Tyler did not remember us, he only knew us from our brief communication through his Youtube videos. We all introduced ourselves, laughed, and had a fun time. He promised to join us again at a later date.
The full conversation with Tyler can be found HERE.
May 25th, 2015
· At 8:38pm, Spirkiroid discovered an update to johnisdead.com. The main page was now black, the title was changes to “PHONELINES”, and hidden in the source code was: ”CALL BACK LATER”.
May 26th, 2015
· At 12:09am, Wolfcat discovered the main page to johnisdead.com updated again. The site now featured an image we already saw before (firekid.jpg), in the source code was hidden: “PICKUP”.
· At 12:14am, Spirkiroid discovered a new page: “/pickup”. Nothing was added yet.
· At 12:19am, “/pickup” featured an image previously seen: “_o_n__urned.png”, but was renamed to: “(727).png”. This seemed to be an area code, from Florida.
· At 12:21am a new file appeared on “/pickup”, the file name was: “otherline.txt”, and read: “1 5 6 - 0 ascending twice. a number you’ve already known”. The Internet Detectives had a hard time figuring this out, tried many combinations of numbers, and awoke many sleeping Floridians.
· At 12:45am, after watching us fail-hard, John Mesic (“dead guy-firekid”), posted to the ID Main Skype Group: “8-2”. This baffled the Internet Detectives even more.
· At 12:59am, John Mesic posted again: “78-2”, this sparked an idea! (1560 ascended by 2 = 3782 + “a number we already know” 592) The number was formed: (727) 378-2592.
· At 1:07am, Wickedlady4180 called the number over a Skype Group Call. An audio was played over the phone, it was the song “@90 by K3v1n”. The whole song played, then the line cut off. Immediately, the number called back, and demonic laughing could be heard. When other people tried to call, only beeping was heard. Several members of the Internet Detectives then texted the number with simple hellos.
The Internet Detectives then began to receive text messages from “75973”
The name on the texts was: “dustesilverwolf”
The text log is recorded below in blue:
· (text) 1:20am to WL4180: “NOTTHEONEWHOBURNED”
· (text) 1:26am to Sprikiroid: “JOHNBURNED”
· (text) 1:40am to WL4180: “DON’TSCARETHENEWGUY”
· (text) 1:42am to WL4180: “HISMEMORYISBAD”
· (text) 1:45am to WL4180: “DONTSCAREHIMOFF”
· At 1:45am, Tylep joined the Main ID Skype Chat and said: “Is all well?”.
· (text) 1:46am to WL4180: “HE’SHERE”
· Between 1:50-1:54am, Tylep posted: “I just got home from work. But I got the rest of the week off cause its my 6 year aniversary at the place. The pay is almost worth it. Just enough to keep me in this shitty trailer. But hey, the place is back up in the woods away from most everyone so I am cool with it. I have been in these woods since I was born’.”
· (text) 1:55am to WL4180: “HEHIDINTHEWOODS”
· 1:55am Tylep: “I like to think I am none of the country stereo types”
· (text) 1:57am to WL4180: “FORWEEKSONEND”
· 1:58am Tylep: “It is kind of lonely around here though. My grandparents used to live here with me. But not anymore, so the place can admittedly be a bit spooky.”
· (text) 1:58am to WL4180: “he got clever…”
· 2:00am WL4180: “Ever think about moving, Tyler?”
· (text) 2:01am to WL4180: “No… GET OUT OF MY HEAD!”
· 2:04am Tylep: “The land I am currently on is mine because I inhereted it from my grandparents, we have our own well so we got no water bill either.”
· (text) 2:04am to WL4180: “IT’SNEARTHEFISHERY”
· At 4:00am, WL4180 announces that she’s going to quit for the night.
· (text) 4:06am to WL4180: “DONTSTOP”
· (text) 4:07am to WL4180: “HURRY”
· (text) 4:09am to WL4180: “THEWORLDBEYONDISUNSTABLE
There is a long pause between Tylep’s posts.
It’s implied that he fell asleep.
· (15 texts in a row!) 4:20am to WL4180: “key”
· 4:22am WL4180: “Hey Tyler, you still here?”
· (text) 4:23am to WL4180: “HELURKSBETWEENWORLDS”
· 4:25am Tylep: “Dozzing off a bit sorry”
· (text) 4:35am to WL4180: “KEY 592 IT’S A FAIL SAFE”
· (text) 4:38am to WL4180: “CONTACT THE HACKER”
· (text) 4:39am to WL4180: “HE KNOWS MUCH MORE”
· 4:50am Tylep: “woah fuck sorry guys I fell asleep at the keyboard”
· 4:52am Tylep: “Woah weird. I am kinda spooked now. I remembered closing both the doors to my room, they are now both wide open”
· (text) 4:55am to WL4180: “CLOSETHEDOORS”
At 5:12am, Tyler left the Skype chat for the night.
The Skype chat discusses the in-depth relationships between Tyler, John, Kevin, and Jacob. The transcript can be found HERE.
· At 11:42pm, The website lunarchildren.com updated. It has become a blog, and the first entry is by a user named: “Matt R”. The post read: “Due to technical difficulties, we have been going on and offline as of recent. We just secured our servers for the time being, nothing else should go wrong with father on our side. The archive was lost, around August of 2012 and we are just now rebuilding the new lunar children website. We will hold a ceremony at our holy place tonight as another milestone has been reached within this year! Expect new content soon children. -Operator”.
May 27th, 2015
· At 12:00am, Tylep posted in the Main ID Skype Group. The chat was long, the transcript can be found HERE. Tyler tells a story about meeting a strange man on the way to Kevin’s house and a video he recorded of the encounter, and also about a strange note he found at his house.
· At 11:27pm, Spirkiroid discovered an update on the main page of johnisdead.com. The background was an image of a 1st quarter waning moon called: “LCD249.bmp”, and had text below that read: “WATCH THE MOON”. There was also an audio file called: “CHILD.mp3”.
May 28th, 2015
· At 12:37am, Wolfcat discovered a new file on /key592. The file was called “update.txt” and simply read: “lunarchildren”.
· At 12:38am, The ID’s found that lunarchildren.com had updated. A new post titled “Update” by Matt R. read: “Hey guys, working on getting up the terminology page tonight! It’ll include three terms tonight: Tenebris Link, Deuro, and The Absque facie. Remember to check up on those pages when they are done as they hold important information. -Operator ps: Our member communication forums are on the backlog, but should be up in the near future!” There was also a drop down menu titled: Terminology. The links lead to descriptions:
o Parallelos – (page empty)
o Deuro – “An extremely taboo eulogy, not to be spoken of under any circumstances without permission from an elder member. To be discussed ONLY during the most dire or appropriate of times. Disregard for these rules is grounds for IMMEDIATE termination.”
o Tenebris Link – “Commonly referred to as “it” by the misguided, he has been known of since sometime in 2002 but is thought to have potentially descended to our realm even earlier then that. Unlike the link the Harbingers hold on the sacred parallelos, he may act on his own. He is one of the darkness of our mothers night. It is said he was once nothing more than one of the Absque Facie, but was said to have been gifted the vessel of the first eulogy and then took on his name. It was not until the event on the night of Undecim Nocte, that he would lose control of that eulogy and revert to his true form in search of another spirit to assimilate. It is thought now that he seeks to assimilate the Deuro, however due to the nature of Tenebris, direct communication is next to impossible. Just as well it is highly doubtful he would ever give any direct input, as his goal it seems for the longest time has been to obscure the truth in the eyes of the Harbingers.”
o The Absque Facie – “Servants of the holy mother Luna who have existed in her realm since before the dawn of mankind. It is said that they hold great power, however those who work under the will of father and mother can attain power even greater. Little is known of this ancient tribe aside form the fact that they currently have minimal access to our parallelos, it is there will to serve Luna for her benefit and there own, and that it is part of Luna’s will to bring them with her in her descent during the true end times.”
o Undecim Nocte – “November eleventh 2011, thought by many lower ranking members to be the end times prior to its passing due to limited knowledge of what was to occur. In depth discussion is even now highly restricted do to the nature of what occurred on that night. However what is allowed to be said is that on that night the parallelos in all of space and time is thought to have been in perfect alignment, while an unknown growing time anomaly caused instability in time, giving opportunity for many unusual happenings to occur. It may also be known an ascension was performed on this night and was extremely successful, however no more may be spoken of on the matter. Anyone who asks of that night out of turn, or is revealed to hold forbidden knowledge of the 11/11/11 night shall be terminated immediately.”
· At 1:15am, The main page to johnisdead.com changed. The background was black, and in green text, read: “Safety”, the title was “/727/”. Nothing was hidden in the source code.
· By 1:20am, a new link was discovered: “johnisdead.com/safehaven/727/”, and was a new chat page set up by SKM. The chat discussed SKM’s history with /Patrem\, and some advice about Tyler. The full chat can be read HERE.
May 29th, 2015
· At 9:33pm, Tyler joined the ID Main Skype Chat. He talked about his encounter with the police, and how they questioned him for 6 hours, and made him delete the video he’d taken of the Spooky guy. During the chat, the ID’s took SKM’s previous advice, and tried to persuade Tyler from going to the police again in the future. Towards the end of the conversation, ArgDov inadvertently mentioned the lunarchildren.com site, causing Tyler to inquire about it.
The full chat can be read HERE.
May 30th, 2015
· At 12:21am, Wolfcat noticed the main page to johnisdead.com had updated. The page featured a video titled “itwasme.webm”. The video is of a Skype call screen capture of Circlehunter drinking a coke, corrupted and tainted red. Super imposed in the video is an image of the figure that Tyler saw walking home from Kevin’s house. Nothing was hidden in the source code. (EDIT: It has since been confirmed that the person in the video is NOT Circlehunter!)
· At 10:52pm, Wickedlady4180 noticed an update to the main page of johnisdead.com. The page still had the video “itwasme.webm”, but now beneath it was text that read: “12121May 30th, 2015 You are wrong”. The title of the page was changed to: “12121” and a new sound file was added: “laughter.mp3”.
(The theory was that the update was pointing to a timestamp in the ID Main Skype Chat, in which Wolfcat wrote at 12:21am on May 30th 2015: “it looks a bit like circle” referring to the video “itwasme.webm”. In response, Eve edited the timeline, to show that we had confirmation that the person in the video was indeed NOT Circlehunter.)
· By 11:50pm, The update to the main page was removed, following the correction in the timeline.
May 31st, 2015
· At 9:49am, Wickedlady4180 noticed an update to lunarchildren.com, the page had a new drop down menu titled Ascension, and two new links:
o Devium – “One who has died or has been killed under specific conditions, but has not undergone the training required to control the spiritual power within ones self, may later re manifest under the most basic of prerequisites for the definition of ascension. However such a status is not to be sought after. In Devium status you are in a state of minimal power and the environment is found to be difficult to control or predict because of unusual or perverse behavior brought forth by ‘novum ascensionem’ otherwise known as ‘newly ascended syndrome’. The only sure way to avoid such a terrible fate is to study the path that mother has laid out for us, and abide by fathers instructions. This alone will harden your soul and prepare you for the glory of ascension.
(Side note: There has been no seen cases of one who has manifested on the devium level ever rising above said level.
The majority of those found in ‘The portal’ under the rule of Regiminis are prime examples of Deviums.)”
o Eulogy – (the same as in the terminology tabs, but with extra info) “A eulogy is defined by its capabilities as an ascended child. One who has simply Ascended may communicate to this realm by some means, however one who has more capabilities (such as minor manipulation of this reality, minor physical manifestation etc…) is to be seen as a eulogy capable of even greater power.
But more often than not, a eulogy will remain a capable as it is upon awakening in its ascended form.
(Side note: The term Eulogy was coined by the Lunar child overseer of the orchard compound, during his controversial speech on the ascension of a previous child of Luna’s teachings.”Though he may no longer be under total control of his own fate, in his short time he was a eulogy to his death. His sacrifice to Tenebris will prove to put us far beyond the harbingers.”)”
o Finitor – (Page empty)
o Transcendence – (Page empty)
· At 7:38pm, Tyler posted on the ID Main Skype Chat: “Fantastic news. I don’t know what the fuck is going on right now or who is outside my fucking house but I am about to take care of this problem my god damn self. For the past 20 minutes I have been hearing a constant knocking. I would look outside but I put tinfoil on the windows so no one could watch me. There was just a loud ass bang a second ago, someone threw something. I am going to find out who the fuck it is and do something about it myself.”
· At 10:44pm, Tyler posted again to the ID Main Skype Chat: “Im staying in a motel tonight. Im leaving my house now. There was a person outside my house, I caught it all on video. I have been back for a while now but I am very shaken. He left a recorder on one of my grandfather’s old broken trucks. I didn’t want to kill him. I just wanted him to leave. But he was all over the fucking place. I chased after him, to try and scare him away, and everywhere I would go, it seemed like he would vanish and appear somewhere else. I chased him a decent ways into the woods to make sure he was off my property, and then it seemed like I was going to have him out in the open because we were reaching the road. Once I had him out on the road, he was just gone.” He then answered some questions from the ID’s:
o Circlehunter: “What did he throw earlier?”
Tyler: “It looked like a lid to a container, thinking back on it actually, it looked like it came off of one of my bait buckets. I’m going to try to upload the video to my channel straight from my phone.”
o ArgDov: “Do you guys think this guy may be supernatural?”
Tyler: “I don’t know or care what he is. I have a night set up at an inn down the road.”
o Wickedlady4180: “Tyler, will/can you contact us as soon as you get to your hotel room?”
Tyler: “Yes I’ll try”
A full transcript of the conversation with Tyler can be read HERE.
June 1st, 2015
· At 1:25am, Spirkiroid created a new thread on WH titled “WITHIN HUBRIS EMPIRE PART 3”, it was a game non related to the ARG. However, /Patrem\ posted in the thread: “0elHm5;?Y72)IE@4Z?8+Bi\DQ3@O” (this was not immediately translated, not would be for nearly 24hrs)
· At 2:01am, Tyler posted again on the ID Main Skype Chat: “Hey guys, Well I gathered some clothes and shit and threw them in a bag and hauled ass to the inn down the road from my house after I hastly booked a last minute room over the phone…I felt like I was being watched the moment I stepped outside. I wish I hadn’t wasteds all the time chasing the guy through the woods before and I would have had some day light left to run to the inn. I think I dropped some clothes on the way, but I couldn’t really see.” Tyler then posted the video he took of the man he chased in the woods: “https://www.youtube.com/watch?v=wxyzQfSbD_g”.
A full transcript of the conversation with Tyler can be read HERE.
June 2nd, 2015
· At 1:01am, Oceanstuck decoded the cipher posted by /Patrem\: “0elHm5;?Y72)IE@4Z?8+Bi\DQ3@O” (translated: “fakeworld”)
· At 1:06am, Zack Nelson noticed a change to johnisdead.com. The update featured a white background with a falling marquee of text that read: “0elHm5;?Y72)IE@4Z?8+Bi\DQ3@O”, the same text that /Patrem\ had posted in the thread on Within Hubris. There was also text on the page that read: “Come and See”, and an audio file: “orld.mp3”.
· At 1:08am, Wolfcat discovered a new page: “johnisdead.com/fakeworld”. The page featured a white background, on which was written in several languages: “How to get inside”.
· At 1:38am, Tyler posted to the ID Main Skype Chat. He spoke of his time at the hotel, and how an old man was removed from his room by EMT’s while shouting “152!”
A full transcript of the conversation with Tyler can be read HERE.
· By 1:40am, the page “johnisdead.com/152/” was discovered. The page featured a black background with the text: “YOUR NEW LENSE OF TRUTHlssm://bfitqup.kjh/” The cipher was a keyed; the key was “12121”. The cipher translated to a url: http://janusvr.com/. The website leads to a 3D virtual reality program.
June 4th, 2015
· At 7:50pm, Wickedlady4180 got a series of texts from “dustesilverwolf”. The messages read: “I’m under control for now. E-mail. It’s the only way I can speak at this moment. I don’t know much.” The ID’s then went on to E-mailpididoip@johnisdead.com. Below is a transcript of the emails:
o Eve wrote: “Can we help you? Tyler? Is that you?”
Answer: “No. I cannot speak my name…”
o Eve wrote: “Tyler hasn’t been online to tell us he’s safe. We want to make sure he’s ok. What can you tell me, so that we can help Tyler? Any information is appreciated.”
Answer: “Tyler is doing just fine, despite current happenings. He is a busy man and has started up work again… He has had a rather unfortunate encounter with some very strange youth… They will stop at nothing. He should be back online soon.”
o Spirkiroid wrote: “You alright? What’s going on over there?”
Answer: “Nothing… I am fine. Don’t worry about me, I am irrelevant.”
Mass E-mail to: Oceanstuck, Seeker, Eve, Sengi, Spirk, Link: “JZHVIVCIIVHU4RI” (translated: “NOTTHEONE”)
· At 8:41pm, Adult_Link discovered an update to johnisdead.com. The main page now featured a black background, the title was: “PLEASE WAIT”, there was a video named: “control.webm”, and audio named: “noise.mp3”. Nothing was hidden in the source.
June 5th, 2015
· At about 12:00am, Zack Nelson found a new page on lunarchildren.com. It was titled “Archives”, and was password protected. In the JanusVR program, a user named “DankyTooBlazed” was watching and reading our chat; he tried the translated password “NOTTHEONE”, and opened the locked page. The Archive page featured a download link to a video named: “blood-moon.avi”. It featured a 31 second scene of the Lunar Children summoning /Patrem. The page also had a note: “Please note, this is not the complete video. We will have that up soon’.”
· At 11:01pm, Tyler joined the ID’s Main Skype Group, and informed us that he was back at home, and safe.
A full transcript of the conversation with Tyler can be read HERE.
June 6th, 2015
· At 1:13am, The ID’s were called twice on the ARG Call Group by John Mesic’s account.
o The first call lasted less than two minutes, and can be heard HERE with a transcript.
o The second call was nearly an hour long. The audio file is currently being split up into several parts, so it can be uploaded to the Tumblr, where a transcript will be provided. The tl;dr is that someone is in control of John’s account (not John), and that person suggested Tyler was in serious danger and should be told about everything. (During the recording, there were things said backwards. A transcript can be read HERE.)
June 8th, 2015
· At 6:06am, ArgDov posted the song of soaring on WH. The idea behind the song was that we needed to get Tyler as far away from danger (his home) as possible.
· The Internet Detectives had laid out a splendid plan. They were set to tell Tyler everything thing they knew, and warn him against impending doom. At 10:51pm he was added to the ID Call Group. He told us he couldn’t stay to talk, but told us that he planned to move to Australia with his girlfriend. He then left, telling us he’d be back the following day.
· At an unknown time, the /index page of johnisdead.com changed to a blank page with an audio file named: “soaring.mp3”, and was an audio clip of a flying plane.
A full transcript of the conversation with Tyler can be read HERE.
June 10th, 2015
· At 12:18am, Tyler returned to the ID Main Skype Group. ID member Sengi seized the opportunity and posted the full speech written by Eve, for Tyler to read. He did not receive the information well. When he asked for proof, the ID’s provided links to WH, johnisdead, lunarchildren, and the tumblr. However, while providing Tyler with the links, things were going wrong in order to prevent him from seeing the sites.
o Lunarchildren.com: Now needs a username and password to access it.
o Johnisdead.com: Now says “Under Construction”
o WH: Not available to Tyler.
o Tumblr page: Not available to Tyler.
A full transcript of the conversation with Tyler can be read HERE.
· At 1:59am, /Patrem\ posted on WH: “You fools may have turned from the path of salvation, but you shan’t foil my destiny. From here on out, your failure is your fate.”
· At 2:12am, When asked what the ID’s have done wrong, /Patrem\ posted: “You let that bearer of falsehoods guide you, it is of no matter however. As you have already seen, I have the power to keep any and all under my veil. You will not enlighten that child, my children have worked hard to keep him as a good little sheep. He will stay under our observation until the time of the grand child’s true awakening. Which will occur once I can pry the burned one away from that wayward cretin.”
· At 2:37am, After being asked if there was any other way to help Tyler, /Patrem\posted: “IIII have gazed through many parallelos, and he has triedwill eht emitofDBC has trytryhastried to stand against my will. II speak of the one my children know as the Tenebris Link. Though they know his power can serve us as it has served me in the past. III was the one who first granted “it” power in this realm so I would know. As I have told my children he is not to be followed without the proper precautions and this is something you failed to do.”
· At 3:12am, After being asked what was left to be done regarding Tyler, /Patrem\posted: “I shall not allow him to be enlightened, he will bring damnation. Soon nothing else will matter, the mother awaits, and her children watch over the harbingers until the time of descent.”
· Sometime after the conversations with Tyler and Patrem, johnisdead.com had been updated. The main page, purple text that read: “Under Control”, below which was a pixelated image of a person (unknown), the image was titled “V.jpg”, there was also an alt text added to the source code: “father”. There was an audio file named “patrem.mp3”.
June 11th, 2015
· At 3:01am, Wickedlady4180 noticed numbers on the image “V.jpg”, and shared the discovery with the ID’s. The general consensus was that this may be the password to lunarchildren.com. Spirkiroid suggested that the username might be “Nocturne”, because the piano piece that accompanied the image on /index was “Nocturne Op. 9 No. 2” by Chopin.
· At 3:22am, While several ID’s were trying to identify the numbers on the image, Spirkiroid E-mailed pididoip@johnisdead.com, and asked for help identifying the numbers.
· At 3:43am, “K” E-mailed Spirkiroid back: “2_1_52”.
· At 350am, After the ID’s whether the user name might be “FATHER” or “Nocturne”, Spirk received another E-mail: “Night”.
· By 3:52am, Entrance to lunarchildren.com was recovered! USERNAME: Nocturne / PASSWORD: 23152.
· At 5:50pm, Wickedlady4180 noticed a new feature to the /fakeworld/ room in JanusVR. The area in the room where there was once a clock with the time 4:53 (backwards) was now replaced with a green landscape.
June 14th, 2015
· At 12:01am, Wolfcat noticed music in the source code of lunarchildren.com. The audio was titled: “theme.mp3”.
· At an unknown time, the username and password to lunarchildren.com was changed. We no longer have access to the site.
June 16th, 2015
· At an unknown time, The main page to johnisdead.com updated. The page now featured a new title: “HIDE”, the page read:
“Nocturne
THIS WILL HAPPEN MORE OFTEN IF YOU LET THEM SPOT YOU
.pi;y+-$H{wa
They know you’ve been watching”
Nothing was hidden in the source code.
· At 10:30pm, Spirkiroid tried “.pi;y+-$H{wa” as a password to lunarchildren.com, and gained entrance. The site has been given a new layout, and a new post was visible:
“General site changes and security improvement
June 17, 2015 by liquidsaint
Sup chummers it’s Saint here, to those who didn’t catch it in the recent meat space meetings and irc talks. The site recreation has been rather slow as of late due to the rise in needed meat space activity. Our big star aka the “Harbingers link” has required lots of observation as of late, and we can’t afford for him to take too much note of it. The last child with observation duty (yes we are talking to you Daniel) did a fantastic job leaving the beacon with him. Just as well, the task was also his trial to be worthy of the Parallelos path (We all saw your fantastic use of jumping in the video he decided to show to the harbingers, really good work to be fair XD ). However having been seen Daniel’s position in the observation task has been retired and it has been passed on to an elder member, who needs no introduction (You all know who I am talking about XD ).
On another important note, I have been told to inform you all of the fact that some skiddies have been worming there way through our drok. So new security measures have been taken, and the previous sign up area has been removed and will be re added when our screening process has been updated. Just as well the site login info will be regularly updated now as more outsider ip’s are noted by operator, so keep in the loop via meat sace and irc.
Thats all for now, some time later tonight operator is going to forward more of the recovered blood moon ritual to me (he explained that tenebris may have been trying to communicate in it so be hyped ^^ ) and I will put it up in a post for now and he can move it to archive later. -LS”
June 17th, 2015
· At 1:31pm, Zack Nelson alerted The ID’s to a new post on lunarchildren.com:
““’Blood moon ritual part one
June 17, 2015 by liquidsaint
Wanted to get this out right now since you have all been waiting for it so bloody long. Shame about that new guy, but as you all may already know (as I do very well) when it comes to “her”, sacrifices must often be made.
bloodmoonritualpartone.wmv”
The video posted depicts the murder of a Lunar Child, who’s holding the Blood Moon Ritual but is not aware of what’s about to happen to him. Within the video, there are several things hidden, and /Patrem\ makes an appearance. The following is a rundown of what we’ve found so far:
o 0:00-0:19 – A “device” is engaged.
o 0:20-0:40 – /Patrem\ is asked why the ceremony is taking place away from the holy building.
o 0:41-0:52 – /Patrem\ answers: “To___ on this night, you must be nearest to me______on this night”
o 0:53-4:04 – the Ritual is prepared and performed.
o 4:05–4:06 – very briefly, an image of Ocarina of time Adult link, with one bloody missing eye, is flashed on the screen with the words: “I the true”.
o 4:07-4:09 – A second person appears to murder the ritual holder with a blade he removes from his back pocket.
o 4:10-4:22 – The screen blackens, and an image of the Happy Mask Salesman is shown with fading lines of text that read: “We honored her first, father of lies, He will bring on her decent with the death of three, He killed that boy for her, He will give us all masks, I gave him all he has, And my mask was a salesman, I am the true controller, He is lying to you all.”
o 4:23-end – We hear the death grunt of the victim, then the screen goes black and we see the words: “FUN GAME”.
· At an unknown time, johnisdead.com began re-routing known pages to random other ARG locations such as: johnisdead/index, lunarchildren, or tyler’s youtube page. While re-routing, the URL bar shuffles through various extentions: /404, /recursion, /getout, /goaway, /leave, /return, /go, /escape. (It is not known if these extensions existed before) Currently, no pages besides /index will work on johnisdead.
· At an unknown time, the two known bloggers on lunarchildren uploaded avatars. The avatar for LiquidSaint seems to be an image of a person with inverted coloring. While the avatar for MattR is a person wearing the same skull mask worn in the blood moon ritual video. On the forehead of the mask is a symbol that was drawn onto the flyer that was left at Tyler’s house.
June 18th, 2015
· At an unknown time, the layout to lunarchildren.com was once again changed. At the bottom of the page near the copyright, the single letter “L” in Lunar Children was a link to a new song called: “showmesad1.mp3”. The blog post with the link to the Blood Moon Ritual was renamed to “TRUTH”, and the video was moved to the archives page. We currently do not have the password to the archives.
· At 4:30am, a new blog post was added to lunarchildren.com:
“Theme Update, Security and Forum Progress
June 18, 2015 by MattR
Matthew here, we recently updated our theme and layout of the main site, as well as some new security features. Our user database has been fixed once again as recent attacks disabled it. If you can’t login, your account has been compromised temporarily for your protection, however, you should not have any issues accessing your account. Security now requires you to update your password once you login. We expect you to use numbers and letters, as well as upper and lowercase and other characters. Our site will never go down again with our new security protocols!
About the forums, they are coming together quite nicely and should be up soon, so expect that soon! -Operator”
· At 5:00am, The audio on lunarchildren.com changed to: “whoishe.mp3”.
· At 5:30am, The main page of johnisdead.com updated. The title changed to: “Run”, had a background image: “finduswaitinginthe.jpg”, and an audio file called: “searchfornewpaths.mp3”.
· At 5:37am, Eve found a new page on johnisdead.com: /asleep/. This page featured an image called: “a_different_sleep.gif”, and an audio file called: “sleeptalk.mp3”. After a few seconds, the page is once again redirected to: “/asleep/rememberme/index.html”. This page featured an image: “D.gif”, and an audio file called: “LEAVE.mp3”.
· As of 6:23am, the password to lunarchildren.com no longer works. We once again lost access to Lunar Children.
June 20th, 2015
· Sometime on this day, the JanusVR room /fakeworld/ was updated. The wall that read “GET OUT” was removed, and opened up a new section of the room. Many of the wall decorations were removed, as well as the audio.
June 23rd, 2015
· At an unknown time, The main page to johnisdead updated. The background image was of a green colored moon, named: “FTP0592.jpg”, and the page’s title changed to “Soon”.
· At 4:19pm, The ID’s found an update to the page “/fakeworld/”. The page now featured a video named “see.webm”, the video was of a chair and a swinging noose. Nothing was hidden in the source code.
· At 4:35 Thorin was trying to find more pages, and was redirected to a new page /where. This new page was titled: “MORE TO DISCOVER”, the background image was named “index.gif”, and had an audio file named “she.mp3” which has been un-reversed in audacity. In the source code was approx. 15k lines of script that read: hr size=“5000”. The HR tag is a line break code, and the size set to “5000” at 15k lines of text meant the page scrolled 4EVER!!!
· At about 5:00pm, the main page to johnisdead.com reverted to its original front page. The image was once again “foggyworld248”, and the music was once again “[[|background.mp3]]” (which is the reversed audio of K3v1n’s song @90). The page’s title was also named “MORE TO DISCOVER”.
June 25th, 2015
· At 11:35pm Lighting struck Zach Nelson’s house. He burst into flames and died.
· At 11:49pm A ritual was performed by the Id’s, and Zack’s soul was ascended. He will never return. Rest in Peace.
· At 11:52pm Eve spilled her blood for /Patrem\, in Zach’s honor. She is now a hideous specter, haunting the Skype group.
· At 11:59pm Stevey was sacrificed to Luna. He will never return. Rest in Peace.
Let us have a moment of silence in remembrance of this bloodbath
June 26th, 2015
· At 3:18am, The Ghost of Eve discovered a change to the main page of johnisdead. The title of the page was changed to: “KEEP SEARCHING”. The background to the page “foggyworld.jpg” was minimized and repeated, so that it looked like the page was covered with orange dots. There was 5 different audio files playing all at once: “background.mp3”, “lost.mp3”, “hiding.mp3”, “keeplooking.mp3”, and “KEEPLOOKING.ogg”. In the source code was hidden “”.
· At 4:01am, Thorin found a new page on johnisdead: “/hole”. This new page lead to a series of redirects:
o /hole – Title:“Welcome”, background image:“hole.gif”, audio:“hole.mp3”.
o /hole/fall – Tile:“terriblefate”, background image:“falling.gif”, audio:“fall.mp3”. From this page, a series of pop-ups emerge:
o Watching – “mask1iswatching.webm”
o Findyou – “mask2willfindyou.webm”
o Waiting – “mask3iswaiting.webm”
o Sleeping – “mask4issleeping.gif”
o /hole/fall/lostinforest – Title:“Lost?”, background image:“lost1.gif”, audio“areyoulost.mp3”. There was hidden text in the page: “est/5 ’***** IS SHE’?”.
o hole/fall/lostinforest/they – Title:“Lost?”, background image:“old2.gif”, audio:“wowuk.mp3”.
OOC time begins for 48hrs
June 27th, 2015
· We were informed that there are missing pages yet to be discovered.
· We learned that /Patrem\’s dong measures ∞².
· /Patrem\ finally acknowledges Eve’s love for him, and asked for nudes.
· Wolfcat spoke his first words in call: “Mugen sucks”.
June 28th, 2015
· At 1:00am OOC Night officially ends.
· At1:05am, the ID’s discovered the clue to finding the missing pages on johnisdead. The clue was hidden in “/lostforest”: “est/5 ’***** IS”. Assuming the “est” was the end of “forest” the ID’s discovered: “/hole/fall/lostinforest/where/” This page featured another series of redirects:
o /hole/fall/lostinforest/where – Title:“STOP IT”, background image:“struggle.jpg”, audio:‘Icannot.mp3”.
o /hole/fall/lostinforest/where/whataretheydoingtome – Title:“STOP IT”, background image:“eetneq4.jpg”, audio:“NBSWY4DVON3WKYLSMVUHK4TUNFXGO.mp3” ( cipher translation: “helpuswearehurting”)
o (popup) whataretheydoingtome/stopit/ – Title:“STOP IT”, background image:“letmegoplease.gif”, audio:“LETMEGOPLEASE’.mp3”.
o /hole/fall/lostinforest/where/whataretheydoingtome/weareinpain– Title:“STOP IT”, background image:“suffer.gif”, audio:“5.mp3”.
o/hole/fall/lostinforest/where/whataretheydoingtome/weareinpain/woods – Title:“STOP IT”, background image:“finduswaitinginthe.jpg”, audio:“NRXXG5A.mp3” (cipher translation: lost) , hidden in source:“fakeplace, here, I”. (these lead to more urls branching off from /woods/)
o /woods/fakeplace/ (popup page – “___n_/index.html”)
o /woods/here/
o /woods/I/
o /hole/fall/lostinforest/where/whataretheydoingtome/weareinpain/woods/itis/ – Title:“STOP IT”, background image:“fury.gif”, audio:“GOAWAY.wav”.
- Below are the sub pages of /woods/*
o woods/fakeplace - Title:“FAKE”, background image:“fakeplace.gif”, audio:“faraway.mp3”, text on the page:
“GUERR BCGVBAF
BAR VF EVTUG
k=SVAQ
k=FVPXARFF
k=GURGUVEQ
NSGRE SNXRCYNPR/k”.
(Translated)
“THREE OPTIONS
ONE IS RIGHT
x=FIND
x=SICKNESS
x=THETHIRD
AFTER FAKEPLACE/x”
o /woods/fakeplace/___n_/ (popup) - Title:“WHERE”, background image:“maiden.gif”, audio:“ 45_-_NeverCould.ogg”, text on page:“Who am I?”.
o woods/here/ - Title:“STOP IT”, background image:“uotls.gif”, audio:“___.wav”.
o woods/here/popup – Title:“STOP IT”, background image:“help.gif”, audio:“screaming.wav”.
o woods/I (redirected to new urls) – Title:“Father”, background image:“hidden.gif”.
o woods/I/am – background image:“am.gif”
o woods/I/am/true – background image:“true.gif”.
· At 1:27am, Sengi posted the three links mentioned in “/woods/fakeplace/”:
o /woods/fakeplace/thethird/ - Title:“THIRD”, video:“thethirdgiant.webm”, audio:“GETOUT’.wav”.
o /woods/fakeplace/sickness/ - Title:“flight”, background image:“1hgy65r.gif”, audio:“air.mp3”. (opened popup from this page)
o /woods/fakeplace/sickness/giant – Title:“2ndGIANT”, video:“icansmellyou.webm”, audio:“ KILLYOU’.mp3”.
o /woods/fakeplace/find/ - opens a number of popups titled “laughing” with the image “D.gif”. (redirects to “/find/you/”)
o /woods/fakeplace/find/you/ – This page was a directory (image), that had a password protected .rar file called “WhoWasTheFirstAccount.7z”. (The password was discovered to be DandP, the account that Doug used in the first arc of YSHDT.) When opened, the file contained a video called: “alwayswatchingyou.wmv”.
· At 2:18am, John Mesic’s Skype account displayed video image during a call. There is no video of the things displayed on his screen, but here is a description: The screen was black, text began to appear that read: “Transmission Incoming”, “A new chapter begins” (@90 by K3v1n begins to play) “Run Tyler”, “Show Me”, (an image of a street appears, and someone running in first person perspective), “Tyler is”.
· At 2:38am, Suddenly a timer begins to count down on John Mesic’s screen. The timer is the same one displayed on the JanusVR /fakeworld/ room. The Internet Detectives suddenly panic, we have 4mins :40sec to possibly save Tyler.
· At 2:40am, Thorin suggests playing the Inverted Song of Time.
· At 2:41am, Dawn play’s the Song of Inverted Time through the Skype call. The timer stops around the 2min mark. (the exact number was not recorded)
· At 9:19am, Master Swordsman Faut discovered a change to the main page of johnisdead.com. The title now reads: “TIME”, the background image is now “FoggyWorld223.jpg”, and the audio is still “background.mp3”. Nothing is hidden in the source code.
June 29th, 2015
· At 8:25pm, Thorin used Transmutation to bring back Eve. RIP Mugen Kagemaru.
· At 9:27pm, The ID’s reanalyzed the video “alwayswatchingyou”. The red textin the video reads: “Regiminis te nostrae vos means” in Latin (translated: “you are our governance”).
· At 9:40pm, Eve reversed the audio of “alwayswatchingyou” and discovered a music track with laughing and whispering that has yet to be translated.
June 30th, 2015
· At 1:02am, Eve noticed the page /key592/ was back on johnisdead. It was a blank directory.
· At 1:12am, an image file named “heistryingtohide.gif” was found on /key592/. This image (as pointed out by ARGdov) is a screen shot of a boy wearing a gasmask, from a Dr.Who episode.
· At 1:16am, A new ID member Mr.Pancake3 noticed the .gif image was removed from /key592/.
· At 2:38am, Circlehunter discovered posts on reddit by the user “shnnhs223”. This user had been following the ARG for some time, and was looking for answers. Circlehunter posted an introduction to the internet detectives of reddit, to possibly shed light on us, and the ARG.
· At 4:56am, Thorin noticed an update to the main page of johnisdead.com: the title of the page has changed to: “mymasks”, the background image is: “BinReset.png” (features and image of John’s eye, with a face in the blackness of his cornea, in the image the Happy Mask Salsesman and Ben can be seen), the audio file is: “t.mp3”, and hidden in the source code is binary that translates to: “Every game has rules, he chose this game when he chose the boy.”
· At 5:18am, Circlehunter noticed a new thread on reddit titled: “donottrusttheinternetdetectives” (link), in this thread a user by the name of “25046151_334654” (translated: “TLink”) posted a cipher: “c2VlYTovL3V6c3l0ZG9wbG8ubnp4L3d0ZGVweS8=”
· At 5:22am, Thorin translated the cipher to: “http://johnisdead.com/listen/”. This new page’s title was: “trustme”, and the background image was “Bentlres.jpg”, also on this page was a .gif image: “assimilating.gif”, the audio file was: “htaed.mp3”.
· At 4:46pm, Wolfcat discovered a new file on /key592/: “number.txt”. This file contained the same phone number we received on May 26th. New ID members Mr.Pancake3 and Ryfoxx called the phone number, and both experienced similar outcomes: When the phone picked up their call, it played the Song of Unhealing. When they hung up, it immediately called back and played static noise with demonic whispering (words not understood).
· At 9:14pm, New ID member Ryfoxx discovered a change to /key592. The page now featured a new .txt file named: “gate.txt”. The file contained coding which was translated to the direct link of the Main Skype Group. It was removed within minutes.
July 5th, 2015
· At 4:45am, Eevee noticed an update on /key592. The page now featured two new links, an image file: “BeReTins.jpg”, and a text file: “ILLUSION.txt” which was filled with text that read “LIES” over and over. Thorin, used Ctrl+f and found several words misspelled: “LTES, LRES, LIEU, TIES, LIEH”.
· At 4:47am, ARG Dov noticed a change to the main page of johnisdead.com. The page now featured a new title: “Tlink” (a call back to the name of the person who posted on Reddit’s /r/arg), the background image: “BitEnsRe”, and a video: “TL.webm”.
· At 12:09pm, Sengi discovered a JanusVR firebox code in the source of the main of johnisdead.com. The new Janus room was a red landscape with a blue cloudy sky, and a red structure in the middle of the landscape. (image)
July 7th, 2015
· At 1:20am, Eevee was re-checking the updates of the 5th, and noticed that the misspelled words of the illusion.txt file (“LTES, LRES, LIEU, TIES, LIEH”), spell the word “TRUTH” when you read the mistaken letters in order.
· At 1:36am, new user Leslie remarks that the replaced letters are “IISLS”, then suggest we try using /truth as a url extension.
· At 1:40am, johnisdead.com/truth/ is discovered by Leslie, as not a 404 (as previously thought), but an actual page that redirects. The page redirects almost instantly, which is why no one noticed it before. Leslie used “noscript” and was able to see the source. The title of the page is “LIES”, nothing is hidden in the source code.
· At 11:34pm, Leslie destegged the image “BinReset.jpg”, and found a cipher: “aHR0cDovL3ZvY2Fyb28uY29tL2kvczFFbVE1aUhyajVJ” (Translated to a vocaroo link: “http://vocaroo.com/i/s1EmQ5iHrj5I”). The audio file seems to be a still undetermined weird noise.
· At 11:49pm, Wolfcat changed the audio file in Audacity to spectrogram and discovered an image that seems similar to the message “GET OUT” in the JanusVR room /fakeworld/.
July 8th, 2015
· At an undetermined time, the /fakeworld/ page changed. The new page was black with green text that read: “LOADING ASSETS”, and an audio file: “bones.mp3”. The JanusVR /fakeworld/ room was also changed. The room was expanded beyond the two enclosed rooms, and now included a purple-ish landscape.
July 12th, 2015
· At an undetermined time, Tyler uploaded a video to Youtube titled: “Bored and had a weird dream”. In the video he discusses his current life, his reasons for not using Skype (apparently the internet detectives are “bat-shit insane”), and a strange dream he recently had. There are several images within the video, one was during a scene where Tyler is coughing (image).
July 13th, 2015
· At an undetermined time, the main page of johnisdead.com updated. The new page featured an image called: “TIME.jpg” it was a thermal vision(ish) image of Tyler, with the words “It’s not time yet” hidden in the picture. The title of the page was now: “seeyou”, and a new audio titled: “36.mp3”.
· At 4:45pm a spontaneous OOC time occurred.
July 15th, 2015
· At 4:30am, OOC time ended.
July 20th, 2015
· At 1:58am, Thorin discovered an update to johnisdead.com. The main page’s title changed to “thetimeisnear”, the page had an image titled: “v.gif”, an audio file called: “forever.mp3”, and hidden in the source code was a cipher: “366363333666363336663633366633333366636333636666336366663666366636663666366636663363666336666336366366663666363636663633366636363663336336633636336366633663336636636666366366363363666636663666366333363666363336633366366363333366666636663663336666363633633336333663363336333633363636366336363633363663366336363336336663363636363336363636” The cipher translates to a Youtube video:https://www.youtube.com/watch?v=HFDEYQfQ9TU. The account that uploaded the video is named Vincent Adams. (This is the same ‘Vincent’ who hosts /Patrem\)
· At 2:08am, John/Mesic posted in the ID Main Skype chat: “1Helpme”
· The ID’s began to discover new redirect pages:
Below is a list of new redirects and their images/audio/hidden-text
o Johnisdead.com/say_goodbye/
· BG image: “sign.gif”, audio: “say_goodbye.mp3”.
o johnisdead.com/hold_on/
· BG image: “hold-on.gif”, audio: “holdon.mp3”, hidden: “ADTINEO”.
o johnisdead.com/lost_forever/
· BG image: “limbo.gif”, audio: “lost_forever.mp3”.
o johnisdead.com/anotherone/
· BG image: “noentry.gif”, audio: “anotherone.mp3”.
o johnisdead.com/misleading/
· BG image: “mislead.gif”, audio: “misleading.mp3”. Hidden in the audio (reversed) are numbers: 6802.
o johnisdead.com/mute/
· BG image: “listen.gif”, audio: “mute.mp3”.
o johnisdead.com/blue_flame/
· BG image: “engulf.gif”, audio: “blue_flame.mp3”.
o johnisdead.com/occasions/
· BG image: “smile.gif”, audio: “occasions.mp3”.
o johnisdead.com/imagine/
· Audio: “imagine.mp3”.
o johnisdead.com/pray_for_rest/
· BG image: “oYz2ZF0icHXn.gif” (translated: “”), audio: “pray_for_rest.mp3”.
o johnisdead.com/fantasy/
· BG image: “fantasy.gif”, audio: “fantasy.mp3”.
o johnisdead.com/breathe/
· BG image: “smoke.gif”, audio: “breathe.mp3”.
o johnisdead.com/back/
· BG image: “back.gif”, audio: “back.mp3”.
o johnisdead.com/go_back/
· BG image: “N.gif”, audio: “goback.mp3”.
o johnisdead.com/cant_swim/
· BG image: “water.gif”, audio: “cant_swim.mp3”, hidden in the source code: “B”.
o johnisdead.com/in_m_yhead/
· BG image: “inmyhead.gif”, audio: “in_my_head.mp3”.
o johnisdead.com/getout/
· BG image: “E.gif”, audio: “getout.gif”.
o johnisdead.com/gone/
· BG image: “angel.gif”, audio: “gone.mp3”.
o johnisdead.com/oooooo/
· BG image: “oooooo.gif”, audio: “oooooo.mp3”, hidden: “”.
o johnisdead.com/lost_in_my_mind/
· BG image: “WHATIS.gif”, audio: “lost_my_mind.mp3”.
o johnisdead.com/neverending_dream/
· BG image: “trappedinside.gif”, audio: “forever.mp3”, hidden: “IFVPWSBFUkEgRVJFSFcNCg0KWU1NT00gRVNBRUxQIGVzYWVscCAucHUgZW0gZWthdyBlc2FlbHAgdHN1aiB5bW1vbSAuLi5kZXJhY3MNCg0Kb3MgbSdpIHVveSBzc2ltIGkgLGRldG5hdyBzeWF3bGEgZXYndW95IHlvYiBlbHR0aWwgZWh0IGViIGxsJ2kgZXNpbW9ycA0KDQppICxub3MgcmV0dGViIGEgZWIgbGwnaSBlc2ltb3JwIGkgLnlycm9zIG9zIG1pIHltbW9tIC4uLnlsZW5vbCBvcyBtJ2kNCg0KP2Vub3lyZXZlIHNpIGVyZWh3IC5kZXJhY3Mgb3MgbSdpICxlc2FlbHAgZW0gcGxlaCA/c2lodGVyZWh3ID9zaXRhaHc= ”. The cipher translates to: “WHERE ARE YOU. scared… mommy just please wake me up. PLEASE MOMMY, promise i’ll be the little boy you’ve always wanted, I miss you i’m so, i’m so lonely… mommy im so sorry. I promise i’ll be a better son, I whatis? wherethis? help me please, i’m so scared. where is everyone?”
· Sometime during the redirect discoveries, The ID’s notice that there are 3 single letters in the redirects. The image in /getout/ “E”, the image in /go_back/ “N”, and hidden in /cant_swim/ is “B”. Put together, they spell out BEN.
· At 7:58am, Thorin played New Wave Bossa Nova on WH to help “unsilence John”.
· Sometime later the GM’s super encoded the redirect script, so we could no longer view the list of redirect pages.
July 21st, 2015
· At 1:20am, Eevee received a text message from dustesilverwolf: “3”.
· At 1:30am, “K” responded to an e-mail sent by Spirkiroid. He wrote: “BQS?8F#ks-GB\6`H#IhIF^eo7@rH3;G@>T'BKpZ'G]R%b1iu5_D-AbC@”, it translates to another video by Vincent Adams:https://www.youtube.com/watch?v=xsZP4tGNmZ4
· At 2:03am, Eevee received a new text: “T05FIFRXTyBUSFJFRQ==” (translates: “ONE TWO THREE”)
· At 2:16am, Spirkiroid found a new page: “johnisdead.com/3/”. This new page had an image: “”III.gif”, an audio called: “up_in_flames.mp3”, a password protected .rar file called: “three.rar”, and hidden in the source code was: “32661557 33067165 10067564 10074545 32620101 10062563 252” (translated: “kcolnu ot yek A esU”).
· At 2:59am, after exhausting every possibility, the ID’s realize the password was “A key”. The file opened up to an audio file called: “three.mp3”. It’s a 6:38 long audio track with hidden spectrogram. The words in the spectrogram are a call back to Jad’s arg: “It’s worth noting that the number three is reported by Kelbris to have been said numerous times, sometimes in-between words and even between letters.”
· Sometime before midnight, Tyler uploaded a video on his youtube account. In it, he takes us on a walk around his property, and down a main road. He also talks about his family, and other subjects. The video is glitch, and has things hidden in it. Towards the end, Tyler sees a Help wanted sign, and begins to comment on it. He say’s “Helper” a number of times, and a calling sound can be heard with each utterance.
July 22nd, 2015
· At 10:42am, Master Swordsman Faut discovered a new page on johnisdead.com /help/. This new page featured an image called: “andagain.gif”, and an audio file called: “help_me_out.mp3”.
July 23rd, 2015
· At an unknown time, johnisdead.com/fakeworld/ updated. Below the words “Loading Assets” was the word “Distending”.
· Sometime later, Thorin discovered that the JanusVR room /fakeworld/ was considerably larger than it had been previously.
July 27th, 2015
· At 4:50pm, Ryfoxx decoded the obfuscated redirect script. The new list of redirects numbered nearly 100 links. Many of the links were ones we’ve seen already, but some were brand new ones, and their meanings were very interesting.
A list of the redirects links can be found HERE.
July 30th, 2015
· At 6:34am, John starts a Skype call in the ID Main Group. No one was available.
· At 6:40am, John posts a code: 24040522 20242111 246424.
· At 6:41am, Thorin decodes the cipher to: “paradise”, and finds a new page /paradise/. The page has an image called: “paradise.gif”, and an audio called: “paradise.mp3”. (The page has a password box, the pass is the same numbers that Spirkiroid found in the audio of /misleading: 6802). The password box then asks if you like to disable future dialouge (The same results happen if you check the box or not)
o The page then redirects to: “/paradise/tricked/”. This page features a background image: “mislead.gif”, and a video: “FOOLEDYOU.webm”.
o /paradise/tricked/, then redirects to a .txt file: “enlightenment.txt”. The text file features a long wall of binary code.
At the time, the code could not be deciphered. However, Thorin did a google search of the code itself and discovered a match in the description of a youtube video: “https://www.youtube.com/watch?v=047PjrXLHUk”. The Youtube account is “lostmemory423”, the same account “seems” to be associated with the original Remember.exegame. The youtube page featured 4 videos uploaded within the previous two weeks. Each video featured ciphers in the descriptions, and one with ciphers throughout the video itself.
o Video #1) Title: “IMG_1507”, the cipher in the video description box translated to: “Was looking for father’s house. The masks were waiting.” This video featured a shaky, night-cam view of a wooded area, and a structure within the vegetation. There were ciphers within the video itself, listed is order of appearance:
SSBjb3VsZCBzZWUgZXZIcnI0aGIuZyB5b3Ugc2VIDQogIGNhbg==
(trans: I could see everything)
SSBjb3VsZCBmaW5hbGx5IHRoaW5r
(trans: I could finally think)
SSBjb3VsZCBmaW5hbGx5IGJyZWF0aGU=
(trans: I could finally breathe)
SXQgd2FzIERIY2VIYmVyIDFzdCAyMDExLCB5b3Ugd2VudCB0byB0aGUgbnVtYmVycyB0byBmaW5kIHRoZSBtYXNrcy4=
(trans: It was December 1st 2011, you went to the numbers to find the masks.)
QnV0IHIvdSB3ZXJIIGxvc3RpbmZvcmVzdA==
(trans: But r/u werH lostinforest)
The audio was reversed, a fixed copy can be heard HERE.
o Video #2) Title: “IMG_1508”, the cipher in the video description box translated to: “It is december 3rd now. You found the masks and talked to them, they told you where to go yesterday but you got /lostinforest. was you need to go here 33 32 34 324 32 34 2e 32 38 2d 20 2c 31 30 38 35 39 36 2e 37 324”. This video featured another shaky night time video, this time in the pouring rain. The person recording is walking with a flashlight towards a building in the woods. The audio was reversed, a fixed copy can be heard HERE.
o Video #3) Title: “2”, the cipher in the description box translated to: “pleasestopidontwanttodothisanymoreITSTOLATENOWpleasesomeonehelpmeSILENCEBOYTHISWASYOURCHOICEyoudidntsayitwouldbelikethispleasesomeonehelpmeNOONECANHEARYOUNOWBOYITISTIMEFORYOUTOASCENDDIANAISWAITINGpleasehelpmeidontwanttodieNOHILDYOUSHALLBENOTDEADUTANEVERLASTINGGLORYTOYOURMO”. This video featured a black screen with the words “No one came.” The audio sounded like bubbling/gurgling underwater noise. (This video appears to be the same one uploaded to the Jadusable youtube channel on November 8th, 2010.)
o Video #4) Title: “3”, the cipher in the description box translated to: “whathaveiforgottenwhoami”. The video was black with a high pitched screeching noise, and flashing images of The Happy Mask Salesman.
· At approx. 5pm, OOC weekend began.
August 3rd, 2015
· At Approx. 2am, OOC weekend ended.
· At 4:34pm, A new user on WH named “Mesic” posted in the johnisdead thread. His message was: “Game has been getting boring. Ill change the rules.”
· At 4:46pm, Tyler uploaded a youtube video titled: “Found a cool thing and now I am gonna go to work I guess”. The video features Tyler talking about a framed image of Max Headroom, a known reference to “SKM”.
August 4th, 2015
· At 2:05am, /Patrem\ responded to Mesic: “What games do you play now trickster?”.
· At 2:12am, Mesic responded: “call not I this. You know many names, you are many names. Man to kafei, kafei to salesm, atheroflies. Play now with me father of lies, you know my names, found my name.”
· At 2:22am, /Patrem\ responded: “By the human way of perception it has only been about a decade since we last spoke, but by my own it has been eons. I see you still have yet to shake the imprint of that children’s game from yourself. I would ask you to still thine tongue of my affairs but I see in your current host you can do nothing more than babble, wretched parasite. However I thank you for your services up to this point, your “fun” has been most useful to my cause. However I suggest you release the deuro soon, as Regiminis is growing impatient.”
· At 2:29am, Mesic responded: “KNOW WHO AM I. YOUR MOON IS FALSE. LAUGH. FATHER OF LIES. Puppet release after toy take back.”
· At 2:58am, /Patrem\ responded: “And what toy would that be?”
· At 3:39am, BEN responded to /Patrem\’s question: “The one this one pretended to be yes, this one is mine. This one is not the old mask, my old toy. Here will be it when take him back GA(E,BlbC>+>./BD# Changed rules, what but did I do? NJXWQ3TJONSGKYLEFZRW63JPO5UGC5DENFSGSZDP You shouldn’t have done that…” (Presumably, the entity that was responding as “Mesic” is now responding as “BEN”)
o The first cipher: “GA(E,BlbC>+>./BD#” translates to: “whatis .com”, this leads to a new website: http://whatisben.com/. This main page features an image titled: “it.gif”, and an audio file titled: “26.mp3”. The tile of the page read: “not so fast”, and hidden text on the page read: “we will be here soon. wait here.” Nothing else was hidden, and no further pages could be found on the new site.
o The second cipher: “NJXWQ3TJONSGKYLEFZRW63JPO5UGC5DENFSGSZDP” leads to a new page on johnisdead: “/whatdidido/”. This new page features an image called: “it.jpg”, and audio file called: “it.wav”, and a binary code hidden in the source: “!!11!111 !!11!1!! !!1!!!!! !!11!11! !!11!!!1 !!1!!!!! !!11!11! !11!!!1! !!1!!!!! !!11!11! !!11!1!1” (translated: “take”)
o The binary leads to a new page: “/take/”. This new page features a background image titled: “ocarinagone.gif”, and a video called: “take.webm”. The video shows text: “Do you wonder what I have done? ”, then shows what appears to be a test post on the Lunar Children forums by Matt R. The video also shows text saying: “Ocarina of Time: Bolero of Fire.”
· At 4:42am, /Patrem\ responded to BEN: “That boy is beyond even my own reach at this moment, so I doubt in your current state you will be taking your “toy” back anytime soon. I do find it amusing how quickly you can still spread yourself. Now I must bid you farewell, talking to two of yourself is quite a headache and I have much to prepare for the coming of the second Undecim Nocte.”
· At approx. 3:00pm, Ryfoxx discovered an update to the main page of johnisdead. The title and background image was the same, but it now featured a youtube video centered on the page. The video was uploaded by Vincent Adams, and was titled: “Trip”. Hidden in the source code is: “key592”
o The video “Trip” shows Vincent talking about making music. Then he seems to fall asleep, and awakens as /Patrem. There was a cipher in the description of the video: “SSBjb250cm9sIHlvdSBjaGlsZCwgYW5kIHlvdXIgZnV0aWxlIGF0dGVtcHRzIHRvIHJlbWVtYmVyIHRoaXMgYXJlIG5vdGhpbmcgYnV0IGEgZ2FtZSB0byBtZS4=” (translation: “I control you child, and your futile attempts to remember this are nothing but a game to me”).
· Soon after, Ryfoxx discovers an update on /key592/. The page now had a link to a file called: “path.txt”, the text file read: “do/t”.
August 5th, 2015
· At 12:30am, Tyler uploaded a video to his youtube account. The video is titled: “Fire at my work”. The text in the description box reads: “Today was a REALLY scary day at work. Idk what happened, but the fry vat I was working on just suddenly caught on fire right in front of me. I had to hold the camera weird and not talk much because I didn’t want my boss to get mad at me for filming, but I didn’t get the company logo in any shots so idk any reason for them to be mad. If anything I should be mad because that fire actually nearly hurt me really badly.”Apparently, The Lunar Children played the Bolero of Fire, and nearly killed Tyler.
August 6th, 2015
· At an unknown time, the ID’s discovered an update to “/fakeworld/”. The page now read: “Loading Assets. Distending… Waiting for Authorization.” (image).
· At an unknown time, the ID’s discovered the JanusVR room “/fakeworld/” had also changed. The open space, beyond the main room, was darkened so that you could not see more than directly in front of yourself. Nothing was found to be hidden in the darkness. killed Tyler.
August 8th, 2015
· At 11:56pm, Faut discovered an update to /key592/. The page displayed a new link: “tenebris.link” (image). This link leads to a brand new website, although the main page redirects back to johnisdead.com
August 9th, 2015
· At 12:17am, Thorin discovers a link to a new directory: “/key592/key59/”.
· Soon afterwards, a link was added to the new directory: “/key592/key59/find.txt”. The .txt read: “ten b is.l /_____”.(tenebris.link/12345)
· At 12:25am, after trying many urls, Wolfcat discovered: “tenebris.link/tyler/”. The page featured a background titled: “line.gif” (which was a gif image of the police tape Tyler saw at Kevin’s house.) There was also the same video which played on johnisdead.com/tyler/: “operator.webm”.
· At 12:36am, Ryfoxx discovers a new link on /key592/: “moon.txt”. The text first read: “/5moon”, then later changed to “m-s_c”.
· Soon afterwards, “tenebris.link/mesic/” was discovered. This new page featured an image called: “eye.gif”, and a reused audio: “noise.mp3”.
· At 12:37am, John’s Skype name changed to “Tenebris”, and a message was posted in the main group: “IHAVEHIMNOW”.
· At 12:38am, Tenebris posted: “heisnolongerwithyou”.
· At 12:39, Tenebris posted: “undermycontrol”.
· At 12:43, Tenebris posted: “youfoolsarewastingtime”.
· At 1:48am, Thorin was informed by Tenebris that the entity “George” was terminated. Killed by Tenebris himself.
August 10th, 2015
· At an unknown time, the ID’s discovered an update to “/fakeworld/”. The page now read: “Loading Assets. Distending… Waiting for Authorization.” (image).
· At an unknown time, the ID’s discovered the JanusVR room “/fakeworld/” had also changed. The open space, beyond the main room, was darkened so that you could not see more than directly in front of yourself. Nothing was found to be hidden in the darkness.
( Game paused for approx. 3 wks )
September 4th, 2015
· Between 12:47am & 2:00am, Tenebris (John) posts to Skype:
o conTrol i gained
o i lost old friend
o I wear New mask
o burnt but fit
o Hhr e doesn’t know… I know not
o old mask no good
o I change the game
o this is no game
o it’s under control.
o I have it
o sorry for your lost
o worthless alone
o better now
o it begins
o something he tells what to you
o check again
· At 2:06am, Thorin discovers a site update on the main page of johnisdead.com. The page is black and reads: “WHAT DID I DO”, and there is audio on the page: “back.wav”.
· At 2:25am, Thorin discovered an update to /whatdidido/. The page has an image titled: “it.jpg”, and an audio called: “it.wav”. There was also a binary code that translated to: “I am the supervisor who reports espionage agent when in the field. I am a spiritual agency believes that help half a seance. I am a pitcher’s ability to throw the ball in the strike zone consistently. What am I?”
· At 5:58pm, Eevee noticed text hidden in the source of /whatdidido/: “ido/To exercise authoritative or dominating influence over/”. The answer to the riddle was: “control”.
· At 6:00pm, Sengi discovers a new page:http://johnisdead.com/whatdidido/control/. This new page featured a .gif image: “itrains.gif”, this image shows a “weather channel” style graphic of a storm headed for the western coast of Florida. The page also has a video called: “therainhasbegun.webm”. The video has text that reads: “Let’s just try one more time to be sure this is what we have been granted. Song of Storms”. There is also a screen shot of a new user name: “Ezekiel_Thoth33”, and a screen shot of text that reads: “Diana descends. The three lay at my feet. DID YOU THINK I WAS FINISHED CHILDREN?”
September 5th, 2015
· Sometime during the day, Tyler uploaded 3 videos to youtube.
o Stuck at work: This video, Tyler shows a rain storm while he’s at work. This suggests that the Lunar Children have indeed used the Fairy Ocarina to manipulate the weather, and now know the power they wield.
o Passing by Johns house: This video shows Tyler walking home, past John’s destroyed home. There are corrupted messages in the video that read: “Burning flesh flesh melting bones. Nothing could stop my singing. Someone pick up the phone please.Soon he will belong to. REGIMINIS.” (images)
o Fishery: This video shows Tyler discovering the Fishery during a walk near his house. There are corrupted messages in the video that read: “That’s his Necklace. Why is K I here. It was not meant for you John. What have you done. No do not touch that. John you shouldn’t be here. Thats his necklace. Ja why are you here?” (images)
September 6th, 2015
· In response to the Lunar Children possessing and using the Fairy Ocarina, the ID’s try to take back the Ocarina by posting a video on WH, of Deku Link taking the Ocarina from the Scull Kid (MM). It is unknown if it has worked.
September 7th, 2015
· Between 8:52pm and 9:57pm, Tenebris (john) posted to the Skype group a series of words: “Curiosity”, “I’ll send him”, “Confusion”, “Sabotage”.
September 9th, 2015
· At an unknown time, the main page of johnisdead.com updated. The title of the page changed to: “Manifest”, and there was a background image called: “powergenerator.gif”, hidden in the source code is: “Malagasy”. There was also a video titled: “Governing.webm”, which featured a corrupted view of the Lunar Children’s message board, and a post by Matt R., which reads: “It appears this is what had thought, and after careful planning and judgment, we have decided it may be in our best interests to apply this gift to his power, Regiminis. Though he does not hold the deuro in his grasp as planned, he may still watch over the Harbingers link and have enough power to communicate his knowledge of the portal to us. Mothers shine be upon you Ascended brother Regiminis! Power unto thee through thine sigil!” (This post signifies that the LC have confirmed their possession of song power, and will try to hand this gift over to Regiminis, who has been watching over Tyler.)
September 10th, 2015
· At approx. 2:00am, Tyler posted a new video on youtube. The title of the video is called Accidental Recording, and it features Tyler walking through a liquor store buying beer. In the last frames of the video, we see a figure behind a beer cooler, and the words “GUESS WHO”. The description of the video reads: “I was at a convenience store earlier and must have started recording on accident while I was holding my phone in my hand. I decided I would upload it though, because I didn’t notice while I was there, but when I went to get some beer off the shelf in the end, it looks like some guy was smiling at me from the room behind the shelves. It is kinda hard for me to tell though since everything started getting fucked up near the end. Oh well, at least I shouldn’t be seeing him again anytime soon.”
September 15th, 2015
· At 10:20pm, Spirkiroid discovered an update to the main page of johnisdead.com. The page featured an audio file titled: “beginning.mp3”, and was a sound bite of Rosa’s dialogue from the Vampire the Masquerade game. The sound bite was the line: “I’m sorry, sometimes I see… nothing. Disregard what I say.” There was also a background image code found in the source: “t_tl.jpg” (assumed to be Tatl, the fairy helper in Majora’s Mask) , but the image url only lead to the redirect pages.
· At 10:23pm, The ID’s discovered the page /rosa/. This new page featured a title: “Listen Carefully”, a background image: “skyup.gif”, and text hidden in the source: “I will speak to you soon”
September 16th, 2015
· At 5:13pm, Eevee noticed an update to /rosa/. The page now featured a video: “fortune.webm”. In the video Rosa gives us our fortune, while showing us images of the future. Some notable highlights of the video include:
o Text in the video reads: “B. The Controller I am true. Puppeteer holding the strings. THE DARK. Waiting to take my true puppet.EN. I have the damn trinket she gave him.”
o Several flash images of the Sydney Airport in Australia.
o An ending scene of Tyler approaching a door, with 50’s Rock & Roll music playing in the background, with Rosa saying the infamous quote: “Don’t open it!”
September 18th, 2015
· Between 12:35am-12:38am, Tenebris posted to the Skype group. His posts were deleted, and missed by the group.
· At 12:39am, Tenebris posted: “Tatl speaks”
· At 12:42am, Tenebris posted: “fingers on hand, three of three, twice” (592)
· The ID’s discovered an update to /key592/, a link to a chat. Where Rosa was awaiting them. Rosa gave the ID’s a glimpse into the future, and the story of what happened to her in the past. Some things of note: She foresees Tyler beginning to trust the Internet Detectives again. She suggests that Patrem does not understand what power he’s seeking to bring forth, and that the ID’s will soon reclaim our power that was stolen from us.
The entire chat with Rosa can be read HERE.
September 19th, 2015
· Sometime before 11am, Tyler uploaded a new video to his youtube channel. The video was titled: “returning to fishery”, and featured Tyler making a return visit to the fishery with the company of a baseball bat. At the end of the video, he encounters a man wearing a mask, before he begins to runs in terror. The description of the video is: “I am not going back, yesterday is the last time I go anywhere near that area of the woods. But damn it took me a long time to get the hell out of there after I saw that man. It felt like I was wondering through the woods for hours and fucking hours.”
September 25th, 2015
· At an unknown time, Tumblr follower Sebastien alerted the ID’s to an update on the main page of johnisdead. The page featured a black background with the words: “/myname” in green font color. There were two audio files in the source:
o it_was.mp3 : This audio seemed to be slowed down ambient sounds.
o d.mp3 : This audio was someone speaking, but was reversed. The words spoken were: “Come on let me in, it’s me Douglas”.
· At 11:22pm, Spirkiroid discovered a new page /douglas/. This new page featured a video called: “me.webm”. This video displayed a corrupted image (that we’ve seen many times in the past) of who we now know for certain is Douglas P. At the end of the video text is shown: “I’ll be knocking on his door next”. In the source code was a BG image that seemed to not exist. This image was called: “zed.jpg”.
o It should be noted that there was one other instance in which a BG image code was placed into the source, yet no actual image seemed to exist. That other image was t_tl.jpg, that appeared on the main page the night Rosa spoke with the ID’s. The connection between the two is unknown, or whether the img coding was a mistake.
October 8th, 2015
· At 10:08am, Tyler uploaded a video to YouTube called: “Paranoid Knocking”. A breakdown of the events of the video are below:
o The video opens with a first person view of Tyler’s home, he’s speaking about sporadic knocking on his doors at all hours of the day.
o At about the 1:00 mark of the video he passes a window, and a face can be seen in the window. It appears to be the face of Kelbris looking in the window.
o At the 6:00min. mark, knocking is heard and his lights begin to flash. Suddenly a barrage of images and sounds are shown on the screen:
§ Flashing lightbulb
§ High-pitched noise
§ A red/black hand closes over the screen
§ Red text: “Some have to knock”
§ Douglas (green man) laughing
§ The pig-mask (mask #2 “will find you”)
§ Mason’s storm drain
§ The Third Giant
§ A close up of Kelbris’ face
§ Undistinguishable red text
§ Footage of the fishery
§ Undistinguishable red text
§ Images of an unknown person (possibly Kevin)
§ An image of what appears to be a rose, or a man with a towel on his head.
§ /Patrem\
§ The same image of a rose/man with a different filter
§ A black screen with the audio @90 by K3v1n
o The imagery is stopped and Tyler once again gains control of his camera.
October 9th, 2015
· At 2:25am, ARG Dov discovered a new video uploaded to Tyler’s YouTube account. The new video was titled: “calling john” and originally had a description that read: “I accidentally stopped the recording early but yeah that was really weird. I had a dream last night I went to that website I was shown a while back, johnisdead.com, made by those assholes who I guess wanted to make some joke out of my friends death or something. And in the dream it actually wasn’t just a blank red page with music or weird sounds, someone I talked to on the website told me to call john. So I looked through some of my old shit and found his old number. I was just expecting a disconnected message, or someone to already have the number taken over, but I guess whoever has it now also has a fucked up phone.” The video featured Tyler dialing John’s phone # and a spooky guttural noise was heard coming from the speaker.
· Earlier in the day, the Internet Detectives decided to begin to try and contact Tyler via his YouTube comment section again. ARG Dov, Thorin, and Eevee posted. Tyler responded to Eevee’s post:
o Eevee: “Tyler, you need to come back to us. We are not trying to hurt you, we care about you.”
o Tyler: “Why the hell do you people always lose your shit so hard in my comment section? “We are not trying to hurt you, we care about you.“ Like jeez are you some kind of cult? Goodnight actually before I get sucked into whatever is going on here; I have work in the morning.”
· At 2:38am, Spirkiroid noticed that the phone number dialed by Tyler was the same number we’d been calling and texting for months. So the ID’s began to call and text the number again.
· At 2:47am, the ID’s noticed the description of the video “calling john” changed. It now read: “TAGS”. By checking the source codes of the YouTube video’s page, we discovered hidden tags on multiple videos:
o Calling John: “Why, dont, you, check, again, old, friend”.
o Paranoid Knocking: “We, have, no, need, to, knock, child, regiminis, shall, be, watching, you, until, your, time, comes”
o Accidental Recording: “Icanseeyounow, Iamherewaiting”
o Jacob: “what, do, you, think, they, did, to, him?”
o Found a Cool Thing: “The, hackers, message”
o Bored: “the, four, will, come, and, open, way, for, goddess, on, november 11, you, have, to, make, choice”
· At 3:03am, the description to “calling john” was changed again, it now read: “i hit the Fucking end button a bit to early. oh well, I called johnS old pHone ERlier because i had a strange dream about the website i was shown before but it doenst matter suppose Yeah i don’t think i should call that again no ok llllll llllll 111111”. The capitalized letters spell out “FISHERY”.
· The ID’s rushed to check the tags to the fishery video and discovered a new hidden tag: “HELP THE ROOF IS COLLAPSING PLEASE DONT LET US ALL DIE”
· At 3:06 the description to “calling john” changed again: “i hit the Fuckilledusing end button a bit to early. oh well, I called johnS old pHone ERlier because i had a strange dream about the websitdhne i was showwhereamin before but it doenst matter suppose Youknowwhereweareburriedeah i don’t think i should theyarewaitingtocall that again no. You Know where we were buiried. they are waiting”
· By 3:07am, the description box was wiped clean.
October 11th, 2015
· At 11:06pm, the ID’s noticed a new upload to Tyler’s YouTube page. The new video was called: “I’m going to”. The description reads: “I know whoever runs that thing probably watches my channel, so here you go. I might have over reacted a bit at first, but fine, I don’t know who the fuck you are but Ill actually go to kevs house, I haven’t been in a really long time anyways and was thinking of going by to reminisce.”, and it featured Tyler calling John’s phone number again and hearing a busy signal. He also spoke about a browser that his GF introduced him too. This browser makes him unable to view johnisdead.com. Hidden in the source code of the youtube video was: “blood moon ritual ground I’ll see you soon Harbingers Link”.
October 12th, 2015
· At 10:14am the ID’s discovered a new video uploaded to LostMemory423’s YouTube account. The new video is titled: “IMG_1509”, and featured a camera-man filming the fishery. At the end of the video, there’s a note on the floor that reads: “Due to recent unfortunate events the continued use of the fish house has been deemed unfavourable for the continuation of our worship and personal well being. If you have recieved this notice, it is because you have been given the task of removing any valuable holy items from the fishery, the holy building provided to us by the Father Patrem, and transporting them to our new central meeting grounds, the Ohio Spire. Collect everything of value and await further instructions. AVOID THE FISH PONDS AND LEAVE NO SHREDS OF EVIDENCE TO ANY ACTIONS IN SAID LOCATION AND REPORT ANY ABNORMALITIES OR STRANGE SENSATIONS DURING YOUR TIME IN THE BUILDING! - Ezekiel”. There was a binary code in the description box, which has yet to be decoded.
· At 8:09pm, the ID’s discovered the main page to johnisdead.com updated. The new page said simply: “Listen”, and a radio stream was imbedded to the page:link here. The stream played song of unhealing, had some spooky noises, and then played vaporwave Elton John.
· At 8:58pm, the ID’s noticed an update to “/key592”. A new link was added called “number.mp3”, and was simply an audio of a phone dialing numbers. The ID’s called the number, and it now works once again. Audio was played when called.
· At 10:20pm, Tenebris posted to the Skype group: “Run”.
October 13th, 2015
· After 12:00am, the ID’s noticed new redirect pages. A list of pages can be foundHERE. One of the redirect pages had hidden text in the source code:
o /head: “trying to feed her son”, who officials say by then had been “deceased for at least six days.”
October 25th, 2015
· At 2:15am, Tenebris posted to the Skype Group: “Run”.
· At 2:18am, The ID’s discovered an update to johnisdead.com: /run. This new page featured a .gif image of train tracks called: “tracks.gif”, and an audio file called: “pastevent.mp3”.
· At 2:31am, The main page of johnisdead.com was updated. The main page now featured a new image of train tracks called: “anomaly.jpg”, and an audio file called: “scared.mp3”. Hidden in the source was: “REMEMBER. THE HOUSE”.
· At 2:41am, The ID’s discovered an update to /key592. There was now a link called: “execute.txt”. The .txt file says: “ry.ex”.
It is presumed at this point, that we being
instructed to download the game lostmemory.exe
November 1st, 2015
· At 6:37pm, Drowned (Aka:“Number’s Guy”) posted to the ARG Skype Group: “AHWVIICNEEJFIGSQ4EDJKSRTSVDJIWSTEENBKZCRCEHFJJ2MAVG5IGKVEUCNITKUMFCJKI2RWUINIXKWMVERJSCUSELZGN2RIUJBKR2ROVCZIH2SKTI5KNSTUEBNIMKWGFLRGNCUUUINJWSQMEEBJLSTOVLVJSKSYEJBKJSVMTG5IESMITENKWKRKUDJGLSNOEMZJJCTUVFFKFKTKDDVIDSTIDCRKOKSOUF5JURVIEJFJMSWWUKFKHKSSU2MIM2SKULZKH2QETGFIFSV2EG5GLSTKUC5GVSTQUBJKX2UKFFVJURMCVLNK2KNQUCNIVKRKVLRGFCSEFNFJVKRMUGRGDKW2UKRKJSSSUBNJNKVITIRJWRQEVLNKBSV2UHNKRKSKFLVIGKSEVJFJFSMKTGFK22TCUCVGV2TYEBNGFKVEDJNJVZUGEZEKVJQSULJLTSMGFGJIJSUEFKFJFKSUUEBLSSMCVJNIOSRMEZEKT2UGEHZIUSUEVHVIWJWSECJK22UMFDZIJSMEFZ4IWmKsWKUEFJTJUOEEFLCKS6EFRJFSVKTAFJF2MEFZQIZKRSEFJIP2RIFKFKJCREVLNKWSRMUEVJSKTIDCNIOSRGFJZJZ2QGENFJ”. (The translation: “they have him and I am scared, he let me out of his box and im waiting in my house but something bad is gonna happen in ten more days I just know it. The masks just wont stop watching him”)
· At 7:20pm, Drowned posted again: “CTKWDMBJERC2A6YGXB2MDYEGZKLECSYHWZU2SFFGN24AFVBHPSJWSVMHNCVAX5YGMZYIDXEGJ2R4GWBHXC54TRNHG24AFVBHOK5USVMHRST2C6YG2CZWVRYHXRNIEGFHKIDOTJVFLKMSTVIE2RN2U2JFLZOSEHVF4RNYCZJNJKMUVZMFERPMTJVFLKMKUZBKKDO2FWMFLZOOGYJKDRPMCEZIJKMCUZBKKDOAFTMFLZOEUIVF4RNMWZIBNAXGC74HJZ4OC6UKL3IQU5IJGTKMU5AKGZKWS5MK22PYD3MFJ3T4SY4HJZ4OC6UKL3IQU5IJGTKMU5AKGZKWS5MK22PYD3MFJ3T4SYUH4B4WD3ULV2N2FFUB5JSGHIJNYRSSGVMF3ZRUV7QHWBT6F2FE6BUIT7AJ3BXKV3UL5JUSVMFE6ZS6GVMF3ZXAWWQHWJMMCIZFRZPSSZ5E4JVWWRAJ3RSMGVYI3BUMSVMF3ZUUQGIL7BPMTVENPSLCT7EFT3JYTKNNDBSWDFZMKRRWDIZELZKWTJJL7BPMTVENPSLCT7EFT3JYTKNNDBSWDFZMKRRWDIZELZKWTJJL7BPMTVENPSLCT7EFTTC2QTQHVRSOWXEGF24AFVBHL23USVMHLSW6D6YG4S2WVRYHASTMD6YGGZPWCXEGQRZUCDNHKK2USVMHGKU2C6YGHJX6EXEG7JKGXTQHFZPWCXEGF24AFVBHKIDCVOJFLZOGFEZL3RNOW7IEERPKFVJKDRPKVVNEI2O4TZBKKDO2U2JFLZO6EQVF4RNODUZGQJMIFGNMI2OKDF5MPJMSETJFG2OKVUJFLZOKFHVF4RN4D2JBNA46SYQKELSGC7UJT22CC7EKZKWCC7UJVTKWS5MI22PYD3AGJZ2SUYUJCBJQU5QLV2N2V6UJGTKMU5YJVTKWS5UGUSNYD34E22TSUY4JORNQU54KUTPGGFUB3RQGHIJNYJTKHVMF3RRCVWQHWBOEGY5FRZVCSSNE6BKCVQRMRJVMGVYI3JVSGVMF3RUUFSQHWRPIHY5FRZT4C3AJ3RVWWRAJ3RTMGVYI3JVSGVMF3RUUQGILEBPMD7QOQ3LCTHZFWBSWDLNNDBSWDHZMKRRWTKFNKZKWDJJLEBPMD7QOQ3LCTHZFWBSWDLNNDBSWDDNOQS2QTGVOKZKWDDFKNBPMD4IMQ3LCTLFEFTC2QRYHIJUCGSFGVSZUCDNHVK2USVMHSSWIC6YG6B5AXXEGPSLMDENHW22GCENHOSZUCDNHVK2USVMHSSWIC6YG6B5AXXEGPSLMDENHW22GCENHOSZUCDNHKIDKVUJFLZOEFNRE4RN4D2BOPJM6EXYGI2OMVVNEI2O4ETJFG2O2U2JFLZOSFHVF4RNEDIBOPJMGXJZIJKMMF2ZHD3O2WVIIDRNMEVQJRTN4VS4HECPIFAJBNQWSC6QOLSQOT3AKPRRCW5UHXJPIX2MIBJWAH3ANXRXEW5EHBBJ4W3YKJBMQC6YGJKPKF3YGHRPIX2EKFSOCH3AMULXEW5YG32JCH3MOC2JCH3ALPRRCGFUB3RKQV6QOVBSMDPFOWBXQWOJM3RPMDYFOWZLETFNI4RR6CDFM3ZNOC7QOVBUEE5EOWRQGWABF4BN6EVBOWZLETFNI4RT6CDFM3JWAX6QOVRPUCGFOWJRUQGEF6JJ2T4EEER3OTLJGL2QYDD5FGKYWT34E6B5KTCFE2J4MDQZN52QYT4EEER3ODDNIHJ4MDTYI5JVMDZAO5B5KTBVIQL4MDRFG7BRYT4EEER3ODDNIHRC2QYZGGRR2TKZGSB42D2VGDKRAXYZGCLM6DCRHZJIICX5GG2QOSYZGMCSOUTJIUZP6VX5GA2I4GUFHRSSKGUFHH2ZMW34GJSKIH34GIKYOS2VGZRW4CY5G”.(This translation was partially decoded:“ Come to my mind 5?a? home pass I have to tell you the e h he is coming to get m m”). To see the formula to solving these ciphers, go HERE.
November 3rd, 2015
· At 12:50am, ID member Spirkiroid played lostmemory.exe, and wrote his experience: “I walked into the house, everything was regular, then the tv in the living room turned to static and the lights downstairs broke. I went upstairs and walked around a bit and then I was teleported behind the locked door on the first floor like Zack was. Cremia appeared floating, crying, and without a face. text appeared on the screen saying “hernamewas”, and then “diana”. I was teleported outside the house and text appeared saying “heisnotthefather”. Then I was teleported under the map into water.”
· At 4:28pm, Spirkiroid noticed a .txt file on his desktop called: “ezekielthoth33.txt”. When opened, it contained:
91hfW:Ms`<;cZIf7R^BW1/(>=86&;]1.t5;6psID;as>^6:FUI;b9PU9L_NQ;b0DZ793&]1/
pb993"D\;bT\R7TMrW10-t97R^HZ;H$4X793,^934_T77B^I;cZOp6rc'B93+\9N=S`912E
F7TEMg10$q(6WI2d;b]ke>“1qZ91MQW9LVrZ6UXR>6<6fY>#n6b93+P_>#S'p6:OCB>#S$g8
k;NQ1J^SC7R^<V6Vg<L8QAPa;bp%i79*2^107+L9LV`pAQ2T#93+M_:K’#L8Q&#H=&C_H928
- X92dT98lA2J79*8Y8@iamtwo@QnMO9iFtZ8PVrK93+t^7oi&Y79)*F7nQES79*8[7nQ6O78u$38kqiE
=]A9t91D?M9iP%]8k)3;7oiPh93+G\1fI%E7nka=;cZgl93OeR;,oAP93+_T:K17b8QJ;]92
/>c8Q&#H=&UkJ92\/X92dT=8lA&F79*8Y8QnYS9iFtX8kiJX:Ms`A;bp%i79*2^107+L93"b
_91hiX8le_d10-tE7R^BU1/(>986&;]1.Or76psID;as>^6q0mL;aj8Q9L_ZU;aa,V78X
HE KNOWS SO MUCH
W
B U T NOTME
R
O
T
H
E
R
WEA RE2N OT1 IAM M B A E X N
NO W FI ND T HE TRU TH
· At 9:48pm, The Ghost of Eevee solved the cipher, using the clues given in the second half of the .txt. What remained afterwards was: “3MrC6OLRutS}”.
November 4th, 2015
· At 9:48am, ID member Juplaylp discovered an update to /key592. The page now featured a new link called: “findthename.txt”, which read:
The ANSwe3r is right In front of yOu
fac3e it
I
N
P L
AiN
S I
GH
T
lunarCHILD
· At some point during the night, the main page of johnisdead.com changed, the title was now: “NAME”, and hidden in the source was: “33”.
November 5th, 2015
· At 10:06pm, Drowned posted to the Skype group: “JNBEERSPKIZFISSGINCVCVCTKNFTKTKFINGVGQ2JIZEEMQ2XKNMUWRJSIRDVIS2IJJMTERKD ǝɥʇ ɹǝʍusɐ sɐɥ uǝǝq ʇɥƃıɹ uı ʇouɹɟ ɟo onʎ” (Trans: “The answer has been right in front of you xli glmph l3xsl3x”
· By 10:12pm, after trying various usernames, the ID’s used [username:thoth33/pass:3MrC6OLRutS}] to gain access to the Lunarchildren’s website once again, and also found their forums.
November 6th, 2015
· At 1:29am, Tenebris started a video call on Skype. His screen displayed a 30min countdown timer, along with text that read: “HURRY”. The ID’s quickly ripped the forums to a .zip file.
· By 2:00am, the LC’s forum was wiped clean (except for a single board titled: “’Controller’”). There was also a new post to the LC’s main web page apologizing for the purge due to “trolls” making new accounts in the forum.
· At 2:30am, the main page to johnisdead.com changed to a chat-box. SKM began to communicate with us once again. He apologizes to us, and explains that he lied to us about who he really is. The ID’s learn that he’s actually a high ranking member of the Lunar Children, and administrator of the website/forum; LiquidSaint.
The full conversation with SKM can be found HERE.
· At 4:23am, the ID’s chose to test their song powers, and played New Wave Bossa Nova.
November 8th, 2015
· At 12:54am, a user by the name of Jarilo333 posted a thread to the LC Forums titled: “I can post here now?” It was clear that the NWBN had brought us a new character.
· At 8:00pm, The ID’s used the mask of truth on Jarilo, and began to ask questions. Among some of the things learned:
o He has a son named Hunter.
o He is an old LC member, and was with the Moon Children before the split.
o He has a brother with the “misguided”, that new the original Tenebris. (Who we believe to be user “Spencer_23”)
November 10th, 2015
· At 3:57am, Drowned posted to the Skype group: “somtheinsideaurfomlunarntalktothemyL. Jarilo333 knows so much more. nheisotheseems”.
· At 9:09pm, a user by the name of: “___”, posted to the LC forums: “ulmth.91-res”. The content of the post was: “Why don’t you tell him about his son”. The thread title translated to: “user-19.html”, and lead to a user called: “Jie_Lin_HunterL”. This is Jarilo333’s son, and he’s an admin of the forum.
· At 11:11pm, after searching through the saved archives of the forums, we discovered a post from Ezekielthoth33 to Hunter L.: “I sent you an invoice Hunter, there is a task you must perform and a voice you must silence. It may be hard to break this bond, but remember who your true family is. That is all I shall say here.” It was then realized by the ID’s that Jarilo333 might be in trouble, his son was tasked with killing him to gain promotion in the LC ranks.
The ID’s spent the evening trying to convince Jarilo that his son might kill him. He displayed anger at us for speaking against Hunter, and did not heed our advice.
November 11th, 2015 (Night of the final day! Undecim Nocte)
· At 3:01am, Jarilo333 posted to the LC forums: “HUUGY2ZFIE4CYULTJARUSZ2KIE4GAVBUIJIEITRRIZCGSOR5IFFVSWRPIRFUWSBR” (Trans:“Why did you do this to me hunter”) It now appeared that Jarilo has been killed (or was already killed) by his son, Hunter L.
· Ay 3:17am, Jarilo333, posted for the final time before his account was deactivated: “Your friend is next, I can see him now, young one what was done to me shall be the terrible fate of your link. They have him now, he cannot escape alone.”
· At 3:21am, with the revelation of Tyler being captured and held by the LC, the ID’s played The Song of Soaring. (This post was quoted by user Mertap, which later counted as a second playing of the song!)
· At abt. 9:00am, Tyler posted a video to his Silentdork channel, titled: “I am doing just fine.” It appeared that he was home, safe, and found his lost necklace at the fishery. There was a hidden message in the video via search tags: “john died you are next tyler they make choices never realize NOONECANHELpYOU”.
· Sometime during the day, Ezekielthoth33 posted on the LC blog: “THE HARBINGERS LINK IS MISSING. ’He is no longer in his holding area at the fishery! I have been informed he uploaded a video from his home earlier today. There is little time, and we must hurry and move in on his location! Anyone with the capability to move in for capture, do so at once!”.
· At 4:25pm, Panicked with the revelation that the LC would eventually find Tyler at his home, the ID’s played the Song of Soaring once again, to whisk Tyler to safety. (Unknowingly, this meant that the ID’s playing the SoS 3 separate times!)
· At 9:01pm, unsure of the results of playing the SoS, The ID’s choose to use one last item to help Tyler. The Stone Mask was used to make Tyler invisible to the LC, should they discover him.
(During an impromptu OOC Q&A, the ID’s were informed that their actions were successful
in saving Tyler from the Lunar Children. Undecim Nocte was foiled by the ID’s!)
November 12th, 2015
· At 9:45pm, The ID’s decided to play Epona’s Song to call Helper.
· At 10:41pm, Helper made contact with us once again: “Hello, Adventurers! It sure has been quite a while. Has everything gone well for you? Do you need assistance? Perhaps the deliverance of a package?”
· It was decided by the ID’s to ask Helper to steal Tyler’s necklace, and give him the Picto Box (camera), in hopes that he would share the images he captured with us.
· In Helper’s last post to us, he agreed to give us Tyler’s necklace, and drop off the Picto Box. The ID’s now await the item from Helper.
December 31st, 2015
At an unknown time, Tyler messaged the ID’s on Skype. He spoke about being trapped in his girlfriend’s home in Australia. The message can be read here.
The 1st cipher in his message (HEX) translated to this: “Dont worry old friend you wont be trapped here for long”
The 2nd cipher (shifted) has never been solved.
#JohnIsDeadTimeline
#2015
Blog cleanup
Just letting ya’ll know I’ll be doing some maintenance on the blog. I’m also going to change the way I update the timeline, it will now appear in the feed, and will be read newest-first. (It’s easier for me, and will cut a lot of time out of updating)
~Eevee
#maintenance
Timeline update 2/11 - 2/15
February 11th, 2016
At an unknown time, a video was uploaded to the Silent Dork youtube channel. The video was titled “Waiting”, and featured a flaming background with red shaking text that flashed: “Waiting, Friends, Masks, The Ashes”. The video was tagged with: “NNN”, “from beyond your world”, “tenebris watches”, “regiminis watches”, “play again”, “soon”. (the video has since been removed by the user)
February 12th, 2016
At an unknown time, johnisdead.com updated. The bg-image was a recycled image, but had a ben effigy added, and was renamed “madness.png”, the bg-audio was named: “april.mp3”. Hidden in the source code was: “WE SEE YOU WHOLE AGAIN SOON”.
February 15th, 2016
At about 2am, the video “IMG_1426” was uploaded to lostmemory423. It features a person walking around in a wooded area examining a key and various notes, one of which features the names of significant arg characters. The description features a cipher which translated: “If you wish to be called SKM from here on, fine that is what we will call you, but before we can let you come to the fishery we need you to prove your worth to us, record yourself going to the enclosed geo coordinates, this place was the meeting grounds of who we knew as the misguided. There should be a key, this key gathered the essence of the dying remnants of that place, find it, open the last standing building in that orchard with it and film what masks remain for our archives. If you succeed you will be answering to the man who ended them for us from the inside, Elder child Mathew.” (cipher was encoded in base 64, then reversed) This suggests that the video may be partial footage of SKM fulfilling the described actions.
#JohnIsDeadTimeline
#2016
hey, its not a question but. Sebastien in the storyline of 2015 and shnnhs223 from reddit are the same person, and he was on skype with you for some time but you trash-talked to much and he had a lot of spam that he couldn't mute. and he was actually me. so yeah. I still stick to you guys, just not into skype things.
March 2nd, 2016
- At 11:04pm, ID member Eevee posted the “Postman’s Hat” in the inventory thread on the LunarChildren Forums, with a message that read: “Hey Helper! You promised us a necklace… ”.
#JohnIsDeadTimeline
March 10th, 2016
- At 1:17am, Drowned (#’s guy) posted a series of Binary, Hex, DEC, and OCT codes which translated to: “You played new wave bossa nova, We are glad. By chance it gave us the energy to escape far enough to speak to you all through this thin window.I am becoming more aware to consciousness. We are coming closer and closer to self realization, and I am remembering many things.”
- At 1:28am, #’s guy posted more code that translated to: “One of us drowned. Me drowned drowned drowned but this was before one of us was taken by a man named sikzjowned drowned drowned drowned drowned drowned. Truth.”
- At 1:29am, #s guy then posted: “It was not his fault. They forced him. He didn’t know.”
- At 1:50am, #’s guy posted a series of code that read: “the man who has us wants to sell us to the who has worked amongst you all since before your inception. s a l e s m a n.”
- At 2:29am, #’s Guy posted more code that translated to: “The one who has us, reginimis, makes the deal. He will take john, and the harbingers shall return to (CCC). All the visions, the LOSTMEMORYs I had shown you, have been memories of what my (juzapdh) did in his search for the masks.” The words in (parenthesis) are not known/decoded, so this is quite a mystery. Does this mean that #’s guy is the one we see in the (now deleted) video of a person finding a key and a list of names? And since the ID’s are the “harbingers”, where are we going to go back too?
- At 2:53am, #’s guy posted more code: “He wanted to find the masks. He thought they had me. They had us. Have. He did their bidding to enter their ranks. He searched for it with the numbers we learned so he could find them.” He then posted a youtube link of an old lostmemory video: “https://www.youtube.com/watch?v=ZBzODWc-t6w” He then posted more code that read: “He met with the masks and they told him what they wanted. They sent him to the Moonchildren who were already d ” (We do not know what “d” represents)
- At 3:14am, #’s guy posted a HEX code that was only partially deciphered to: “killed them all but left behind something important.”
- At 3:30am, #’s guy posted more code that translated to “ He found the list and, then the key, and went to the orchard my father used to play with the children in. the gift we asked the postman to leave him IMG_1509” (https://www.youtube.com/watch?v=U-p6g0VqtTM) “what was in that container was once mine. He opened it and I was with him when he did”
- At 3:56am #’s guy posted a code that translates to: “He returned from the orchard of the moonchildren to meet with the masks again, but then had already left for their Spire. He found the gift we asked the postman to leave him.”
- At 4:16am, #’s guy asked us if we wanted to see what was inside the suitcase Tyler found at the end of IMG_1509. The ID’s answered YES!
- At 5:21am, #’s guy posted a video: (https://youtu.be/r8-ir3L_sZ8). The video is titled: “Untitled”, and features someone opening the suitcase (found at the fishery in img_1509) and finding a gasmask.
- At 5:30am, #’s guy posted a code that translated to: “somethings wrong some one changed something, this never happened.”
- At 9:13am, new ID member “Hitro” asked #’s guy “What never happened?”
- At 11:16am, #’s guy answered him by posting a binary code that translated to: “someone who plays with time has changed the story he was never given that book he gave it to the masks.”, and a video titled “This Never Happened”: (https://www.youtube.com/watch?v=EvH8cD7HoQU). This new video features the same scene as “untitled”, but now the suitcase contains a book wrapped in chains with a note that reads “Don’t open it”. (the word “ don’t ” is scribbled out with red ink.)
#JohnIsDeadTimeline
#timeline
#2016
March 11th - 15th, 2016
March 11th, 2016
- At 4:00am, Eevee Reborn played The Song of Time in the control thread of the Lunar Children Forums. No permission was asked from other ID’s, no fucks were given.
March 15th, 2016
- At 2:08pm, the ID’s noticed an update to johnisdead.com. The title of the main page was: “RETURN”. Hidden in the source code was: “<!– –>”, the image was called: “Time.gif”, and the audio was called: “id.mp3” and sounded like a plane flying in the air. (sound not confirmed) Could this mean that Tyler is returning from Austrailia?
- At 3:09pm, ID user “Juplayp” noticed an update to page “/key592”. The page featured a link to a photo titled: “fva.jpg”.
#JohnIsDeadTimeline
#timeline
#johnisdead
LostMemories420
We had a long interaction with Drowned (#’s Guy), but unfortunately we lost the backlog. One thing we can remember: Kevin=Regiminis.
Wolf totally figured that out… NOT CIRCLE!!!!!!
#not circle
#video
Timeline Update
March 17th, 2016
- At approx. 2am, DROWNED (#’s guy) posted to the ID’s Skype group: “you played song of time. The red man. He wants to take everthing. You have power I know this. Please hide us from him. Please stop him, this time he will take us, we will be offered to the salesman for trade of the burned one. SKM will be offered the salesmans conduit. his body. Save us.”
- #’s guy posts a series of videos to the Skype chat:
- (https://youtu.be/QxrohXmWIPY)
- (https://youtu.be/TAAIZenvfQc)
- (https://youtu.be/FfT2i3dWRlE)
- (https://youtu.be/s7xTwbSe27Q)
- (https://youtu.be/AZLTQI9VsQM)
- At 2:14am, ID member Spirkiroid posted the Garo’s Mask on the LC Forum.
- At 2:30am, #’s Guy posted: “You saved us. Hid us as one of the servants of the red man. Regiminis, the title of one to govern. He was to govern the portal, as its called. And portals there are many, but they sought to organize johnisdead.com, he named it after what he did. But he was angered as all was not according to plan. This was only to taunt his destined kill: The link.”
“Yes.”
Oceanstuck asked: “Do you have an idea what the plan was?”
“I cannot be sure. I know the woman of the clock tower knows more but she is frightened of returning to the portal.”
Thorin asked: “Rosa?”
“Yes she has been once called this.”
ARG Dov asked: “What is she called now?”
“Many things. They. He wished to make a great sacrifice to the mother. It wishes to consume. Consume everything. Their first plan was with the first portal yshdt.com, but due to what they called the harbingers, this plan failed years ago in your time before many could ascend to it.”
Thorin asked: “Do you know who the harbringers are?”
- At 2:52am, Eevee checked lunarchildren.com and discovered that the last post from 11/11/15 was deleted. (The post stating Tyler had escaped.)
- At 2:55am, #’s Guy posted: “There was a time in which the red man took me to be traded to the salesman. To be rid of the burned one as he was meant to be the red mans conduit and take me once more.”
Eevee Reborn asked: “Will you be safe for long?”
“Rosa has already spoken. You have only prolonged the inevitable. The salesman wants two things from red man; a body in exchange for the burned one, and MUCH more power than he has now.”
Thorin asked: “Why is the burned one important?”
“The masks tell many lies, but between lies hides truth. Amongst their now twisted lore it is a truth that one who ascends can be promised much more power if they have what is deemed a conduit.A conduit is one who has been killed as a result of their own assention. However beings beyond all of us may take sacrifices as conduits when lowering to our realms.”
Eevee Reborn asked: “So was john a sacrifice conduit?”
“By mistake yes. The one who plays with time is laughing. The father spoke with beings beyond all of us during that year before that day. Before Patrem became bound to his vessel and before I could breath once more.”
Eevee Reborn asked: “What can you tell us about Patrem?”
“Patrem spoke to them and said ‘He must be sacrificed to the mother as I have watched his existence break many things in my time, he will be used by regiminis as a conduit’ I hate him. I will not talk about him.”
- At 2:59am, Drowned made his last post of the night: “Regiminis. qmmri://mgfyiwfml.pzzpwl.jzx/#fnmz/ly/vlst”. The cipher decodes to: https://translate.google.com/#auto/en/kevi. Kevi=Governing. The general consesus now, is that Kevin is Regiminis.
- At an unknown time, a new video was uploaded to the lostmemory youtube channel: (https://youtu.be/zmXkpyyX8YM)
- At 9:10pm, DROWNED (#’s guy) posted to the ID Skype group: “I am sorry that this cannot be changed, but the time is coming, it is nearly here. Sam will be spared, you managed this. You really do have the gift to change things. We are sorry.”
- At 9:13pm DROWNED left the ID Skype group.
March 23rd, 2016
#JohnIsDeadTimeline
#timeline
ZUNEPGOXXPKG23UGZMLD4EN3UQNPVZKYX5NPZCNHZLIGJKWTRJJPHW3AXUNDFA3RXKNP22EBXTJB
01111010 01110101 01101110 01100101 00100000 01101001 01110011 00100000 01100001 00100000 01100110 01100001 01101100 01110011 01100101 01101000 01101111 01101111 01100100
Solved: Zune is a falsehood
=EDLM1WSxI2ZqJ0K+kFYvIzXtdCRwgEYpwSMsMUVAFjYeViLykCJwZEMmFTYxEzRep2QwoEUAJ0K+AFb2ITKtMnQycSPWFjMEpQDbdSQ
Solved: Shift 11 and __SE32
NB2HI4B2F4XXE5LNNNUW4LTDN5WS65DPN5WHGL3DNFYGQZLSF5RWCZLTMFZC223FPFSWILTQNBYA
Solved: http://rumkin.com/tools/cipher/caesar-keyed.php
IZEXXNMAJZGHZVMWLZEHQEPF32ASXZN
Solved: no key reverse code
bGV0IGdvIG9mIG15IGhhbmQgY2hpbGQgaXRzIHRpbWUgdG8gZ3JvdyB1cA==
Solved: let go of my hand child its time to grow up
IyZjPis1dFhCMjY0LSkyLEZiZTBya2s+DQorOG49JzIzbmpKMDFJWkQycm50Pis4ZT0nMi5fWEIyPCFyQTMlMnU+Kz49VT8zOEZIKTIjMjI/KzcrOiQzMG5qSjAyUnVfMnINCmtrPiszOyZkMCkpYEgwNDo2KTJya2s+Ky4yYEgwP207RTIlL2w+KzBWImExNlUyJjNzdCg
Solved: http://lunarchildren.com/?page_id=324
#video
New Page discovered:
http://lunarchildren.com/?page_id=324
It’s Password protected. We do not have the pass as of yet.
#lunarchildren.com
March 24th, 2016
- At 4:26pm, ID member Spirkiroid discovered a new video posted to the Silentdork youtube channel: (https://youtu.be/BsB1bD_5R88). The video is titled “Regiminis” featured several ciphers in the description box. Through trial and error, the ciphers eventually decoded to a new page on lunarchildren: “http://lunarchildren.com/?page_id=324” This new page is password protected, and we do not have access as of yet. (see 5/23/16 for password). The video itself had dial tones that decoded to: “Dont listen to him, its me john, his mask, ill talk later”, and had an SSTV that decoded to two images: (01) and (02). The youtube source code had a hidden message: “Your old friend, malagasy, https://translate.google.com/#mg/en/kevi”.
#JohnIsDeadTimeline
#timeline
I’ve edited the id.mp3 and the picture
http://i.imgur.com/edvufHf.jpg
- The picture seems to be a mask or a skull with an eye, with background of forest, probably the one from videos on youtube.
http://picosong.com/Ah8T/
-the file was stereo, and the left speaker had less noise going on, and I captured 2/3 strange sounds in 1 minute of a file.
$-$
Update on /tyler.
johnisdead.com/tyler $-$
“read these off to the newyork grotto” and “New Text Document (3)” (from IMG_1427)
115 111 109 101 116 104 105 110 103 32 105 115 32 119 114
111 110 103 32 119 105 116 104 32 73 102 114 105 116 44 32
104 101 32 104 97 115 32 115 110 97 112 112 101 100 32 97
110 100 32 115 116 97 114 116 101 100 32 107 105 108 108
105 110 103 32 112 101 111 112 108 101 32 100 113 105 32
108 122 119 101 118 113 118 111 32 105 118 108 32 109 116
109 107 98 122 119 107 99 98 113 119 118 32 40 105 97 107
109 118 97 113 119 118 32 120 105 98 98 109 122 118 97 41
32 97 110 100 32 115 101 101 109 115 32 116 111 32 98 101
32 116 114 121 105 110 103 32 116 111 32 98 122 105 118 97
107 109 118 108 32 98 112 109 117 32 99 118 108 109 122 32
98 112 109 32 116 99 118 105 122 32 107 112 113 116 108
122 109 118 97 32 98 109 105 107 112 113 118 111 97 32 40
114 99 97 98 32 116 113 115 109 32 101 112 105 98 32 97
109 109 117 97 32 98 119 32 112 105 100 109 32 112 105 120
120 120 109 118 109 108 32 98 119 32 115 109 116 106 122
113 97 32 105 110 98 109 122 32 112 109 32 115 113 116 116
109 108 32 112 113 117 32 49 48 32 103 109 105 122 97 32
105 111 119 41 32 32 105 107 119 122 108 113 118 111 32 98
119 32 98 112 105 98 32 406 119 119 115 32 105 116 109 102
32 106 122 119 99 111 112 98 32 99 97 32 13 10 72 101 32
100 105 100 32 104 105 115 32 99 101 114 101 109 111 110
121 32 116 111 32 65 108 101 120 32 97 110 100 32 97 99 99
111 114 100 105 110 103 32 116 111 32 111 110 101 32 111
102 32 121 111 117 114 32 108 111 99 97 108 32 103 117 121
115 32 104 101 32 103 111 116 32 83 112 101 110 99 101 114
32 40 73 32 100 111 110 116 32 107 110 111 119 32 104 111
119 32 117 110 108 101 115 115 32 104 101 32 99 97 110 32
115 111 109 101 104 111 119 32 102 117 99 107 105 110 103
32 116 101 108 101 112 111 114 116 41 98 117 116 32 73 32
97 109 32 115 117 114 101 32 121 111 117 32 97 108 114 101
97 100 121 32 107 110 111 119 46
73 110 115 105 100 105 101 97 32 105 115 32 97 32 115 112
121 32 102 111 114 32 116 104 101 32 116 114 97 105 116
111 114 115 32 100 111 32 110 111 116 32 116 114 117 115
116 32 104 105 109 32 73 32 117 110 100 101 114 115 116 97
110 100 32 110 111 119 32 119 104 121 32 104 101 32 119 97
115 32 115 111 32 117 112 115 101 116 32 97 102 116 101
114 32 97 108 101 120 32 98 114 111 117 103 104 116 32 117
115 32 116 104 97 116 32 98 111 111 107 32 102 114 111 109
32 116 104 101 32 108 117 110 97 114 115 33 32 73 32 116
104 105 110 107 32 105 102 114 105 116 32 105 115 32 119
111 114 107 105 110 103 32 119 105 116 104 32 104 105 109
32 111 114 32 115 111 109 101 116 104 105 110 103 46
#johnisdead
#ciphers
Deciphered: “read these off to the newyork grotto” and “New Text Document (3)” (from IMG_1427)
Something is wrong with Ifrit, he has snapped and started killing people via drowning and electrocution (ascension patterns) and seems to be trying to transcend them under the lunar children teachings (just like what seems to have happened to Kelbris after he killed him 10 years ago) according to that Ɩook Alex brought us.
He hid his ceremony to Alex and according to one of your local guys, he got Spencer (I don’t know how unless he can somehow fucking teleport) but I’m sure you already know.
#johnisdead
#ciphers
IMG_1427
Insidiea is a spy for the traitors do not trust him I understand now why he was so upset after Alex brought us that book from the lunars! I think ifrit is working with him or something.
#johnisdead
#ciphers
Tones decoded from Regiminis video
Dont listen to him
its me john
his mask
ill talk later
New contact on LC Forums
Whats going on in here?
I know you people are in here so just be chill about it and let me know whats happening, I have some information for all of you right now that you might wanna hear. - Sheepdog
http://lunarchildren.com/forums/thread-31-post-170.html#pid170
What Regiminis means
Regiminis is the name of an entity within the game. His wiki page is here
April 1st, 2016
- At 2:20pm, a user on the Lunar Children Forum named Sheepdog (Profile link: http://lunarchildren.com/forums/user-20.html) posted a thread titled: “Whats going on in here? ”(since deleted).
- The initial post:
“I know you people are in here so just be chill about it and let me know whats happening, I have some information for all of you right now that you might wanna hear.” - Second post:
“Im not really sure how I have managed to get access to this place while no one else can, but I see you guys used that power that is held here a bit. Things have been…. going… I guess you could say, here at the lunar spire still despite various screw ups and the hole 11/11 flop. But your last song actually did something goodish and badish both both sides standards. Tyler was brought through one of the parallelos and then back to the fishery, idk exactly what happened to him there but he proceeded to run right back to his house. He is held up in there now and some of the children are trying to keep an eye on him but something there wont let us get any closer, something kind of fuckin freaky to say the least. We can hear him in there in his house but we can’t see him. But I am sure he is ok for now.” - Third Post:
“I never have in terms of the torture and blood sacrifices. But the way they treated this Tyler guy was just a bit much. We nearly killed him multiple times, and that point where we held him in a trunk for a couple days was going overboard.” - A new page was discovered on the Lunar Children website: “Auxiliatis” http://lunarchildren.com/terminology/auxiliatis/.
At the sacred time when Luna was to send an ambassador of her parallelos to help guide humanity to her light, he was commanded by Luna to perform this task. But he refused, desiring to partake in the ways of the overworld more than his obligation to Mother.
“Why and wherefore dost you bid this of me? I hath served thee and thy kingdom since my creation. I wished to partake for but a moment in the ways of man, and yet here you trap me to this right? Nay, give this power not to me but unto my brother.” -Auxiliatis response to Luna’s final request of him quoted from the Libro Lunarus
#JohnIsDeadTimeline
#timeline
Artist: Unknown
Track: despair.mp3
Album: Johnisdead Soundtrack
johnisdead update - 4/12/16
(Source: johnisdead.com)
#audio
File Three.rar
You know that?
I’ll give you a hint,
The password is: A key
#muahahahaha
#submission
The site stopped giving random subsites when typed the nonexistent link, instead, when you type in truth, the site gives word "LIES" and random subsite, otherwise its just "lost?" and goes back to main page, since when that has changed?
It seems that the change happened some time last night. The redirects are gone, also / key592 is clear again.
Guys i found some spooky file three.rar . lel.
The password is NOT A key
What is shrine?
It’s where I lay my soul down on the sacrificial slab for /him
Where can i download three.rar? (I cant find it because i am so stupid)
http://johnisdead.com/3/
Look in the top left corner for the link
/hole/fall/ Something new here, look.
I don’t see anything new in the redirects, this page was recorded here http://johnisdead.wikia.com/wiki/Johnisdead.com#June_26th.2C_2015
Published on May 23, 2016
968 6878 5337 668464 89537
36 668 538 48888448 48848888 48884848 946
93 273 5283 367 76636637 24784329
4277924784329236
do not let you win
#silentdork
#video
5646 Transcript
Where am I?
You are home
You are sleeping
and be careful, you are watching.
I only have a little bit of time so im sorry
Im still not sure whats happened to me man
but I am not dead, as much as they want you to think I am.
But I don’t think I am alive either. The thing behind this all wants to confuse you. I was under it for a long time, it really hates you. But I don’t know why, all I know is that you living traps it in some way
The thing is like a parasite, I t has to have the lives of others to exist and the religioun kevin was following teaches people to try to be like that as well, except that’s not how it seems to work.
That religion Kevin was in, if you can remember, is a cult.
I don’t understand a lot of whats going on, but that thing is at the top of it all whether or not they know. This thing has walked through time and created a huge mess in its wake. Somehow this all ties to you, a kid who drowned and his father who was killed 14 years ago, and many others
You have to understand this is real
Don’t try to explain this away as a “glitch”
I have been trying to give you signs for a long time
I don’t know what will happen but you must not let yourself be taken. Whatever this thing is will be unstoppable if you do
I know you are scared
But please
Open it
#Thanks Thorin
5646 video tags
“I AM IN CONTROL OF EVERY ASPECT OF YOUR BEING
DO NOT THINK FOR ONE MOMENT YOUR CONTINUED STRUGGLE IS NOTHIMG NORE THAN A GAME FOR YOU”
New Page discovered:
It’s Password protected. We do not have the pass as of yet.
Password discovered: 4277924784329236
What is the password for lunarchildren/archives/ ?
We currently do not have that password.
so john is dead site wont be updated anymore? this arg is so closed (for friends) only : (
The ARG still ongoing, and is open to everyone.
cant you guys make subreddit for posting and chatting with everyone?
I’ll run it past the rest of the group, and see what they think. 😊
cant you guys make subreddit for posting and chatting with everyone?
I’ll run it past the rest of the group, and see what they think. 😊
https://www.reddit.com/r/TheID/
#we got a reddit
May 23rd, 2016
- At an unknown time, a video was uploaded to Tyler’s Youtube channel. https://www.youtube.com/watch?v=G7D5ukv4LLg. The title was: 5646, and the description was a HEX / corrupted binary/ OCT combo that translated to: “you must keep moving tyler. do not let you win. we are late for someone birthday” There was also a message hidden in the tags: “I AM IN CONTROL OF EVERY ASPECT OF YOUR BEING. DO NOT THINK FOR ONE MOMENT YOUR CONTINUED STRUGGLE IS NOTHIMG NORE THAN A GAME FOR YOU”
- ID member Thorin transcribed the messages within the YouTube video: “http://internetdetectives.tumblr.com/post/144832302873/5646-transcript”.
- A new page was discovered on the LC website: “http://lunarchildren.com/happybirthday/” The password is: “4277924784329236”. This new paage has an image: “http://johnisdead.wikia.com/wiki/Special:Images?file=Family.jpg”, and a message: “Father why couldn’t she make it to the picture? Your Mother? She is sleeping, but worry not Benjamen as her awakening is coming soon, even now ones from beyond these parallels speak to me. They told me not to listen to “kelbris” anymore and to stay with them. I am no longer Kelbris, that was my fools name. As I said before do not listen to the misguided, merely dwell with them. Our time is coming soon, while they flounder about, we shall soon bring the times of the mother to this forsaken land. Now let us go inside, I obtained for you the game device you wanted and a nice game as well, alas the label seemed to be torn. None the less, happy birthday my son. I love you dad. Hurry there is much to be done in the coming days, inside at once.”
#timeline
#JohnIsDeadTimeline
#sstv
#6-22-16
bcd.zip
[password: lostmemory]
Updates to Lunarchildren.com
- http://lunarchildren.com/2016/03/01/everyone-come-immediately-to-the-top-floor-of-the-spire/
- http://lunarchildren.com/2016/03/02/success/
- http://lunarchildren.com/2016/04/24/why/
- http://lunarchildren.com/2016/04/23/528/
- http://lunarchildren.com/2016/04/30/if-anyone-is-still-out-there/
- http://lunarchildren.com/2016/06/23/update-3/
- http://lunarchildren.com/2016/06/23/524/
#lunarchildren.com
June 22nd, 2016
- At 5:14pm, the ID’s discovered an update to johnisdead.com. The main page was renamed: “Reunion”, the bg-image was named: “reunion.png”, and the audio was named “threevoices.mp3”. Hidden in the source was: “Don’t Fall”.
- The image: http://internetdetectives.tumblr.com/post/146484027683/reunionpng. In the upper left of the image was a string of BINARY that translated to: “Merging times”.
- The audio: http://internetdetectives.tumblr.com/post/146484393383/unknown-threevoicesmp3
- At 5:29pm, the ID’s discovered: (http://johnisdead.com/hole/fall/N/). Hidden in the source code was: “bcd” and “zip”.
- The ID’d discovered: (http://www.johnisdead.com/hole/fall/N/clue.ogg) an SSTV that translated to an image (image: http://internetdetectives.tumblr.com/post/146484837668/httpjohnisdeadcomholefallnclueogg-sstv). The image had text that read: “Cvpgherf ubyq bar gubhfnaq jbeqf Ernq Gurz”. (Translated by ID-Mike: “Pictures hold one thousand words Read Them”).
- At 5:38, the ID’s discovered: (www.johnisdead.com/hole/fall/N/bcd.zip) a file titled bcd.zip (password: lostmemory). This file contained a .bmp image (titled: _.bmp) the file is corrupted and cannot be opened (but the source of the image reads: “Still looking for answers? Who do you think I am?”) and .txt file that reads: “Were you expecting a reward? A hint? Something to help you in this pointless struggle you have placed yourself in? You are in error, it will be amusing watching you all this time. Just as before you wont understand until its too late.”
- At 5:50pm, An update to (http://www.johnisdead.com/tyler/) was noticed. A new BG-image displayed a distorted image of BEN. (http://internetdetectives.tumblr.com/post/146485369158/eyesjpg.“
#timeline
#JohnIsDeadTimeline
June 23rd, 2016
- At 7:36pm, the ID’s discovered a video uploaded to Tyler’s youtube account (Silent Dork: https://www.youtube.com/watch?v=zDrHco23_50) Hidden audio in the video reads:
- 1st beginning part - “oh john had not yet been cast into prison, you shouldn’t have”
- 2nd part - “but ER(not sure) come in with (mumble), when the true worshippers have worshipped father in spirit hand in truth for the father he’d give such to worship him”
- 3rd part - “(crying is audible during certain segments) please go away, please, please go away, p-please go away, please, p-please go away, i- go away, please. please stop.. knocking. please.. stop.. FUCKING knocking.”
- At an unknown time, several updates were noticed on lunarnarchildren.com:
- http://lunarchildren.com/2016/03/01/everyone-come-immediately-to-the-top-floor-of-the-spire/
- http://lunarchildren.com/2016/03/02/success/
- http://lunarchildren.com/2016/04/24/why/
- http://lunarchildren.com/2016/04/23/528/
- http://lunarchildren.com/2016/04/30/if-anyone-is-still-out-there/
- http://lunarchildren.com/2016/06/23/update-3/ (Password: “mhftt”)
- http://lunarchildren.com/2016/06/23/524/
- At an unknown time, Silentdork uploaded another video titled: “3” (https://www.youtube.com/watch?v=2teBBl1Ixm8). The video featured laughing sounds, and a very dark screen with and unkown faded image. No messages were in the source, and nothing was written in the description.
#timeline
#JohnIsDeadTimeline
A note to all JID players & followers:
During the Moon Children Reboot (Aka: “Salty Jad’s Arc3 - Better than ever before“), the ID’s will be working on both JID & MC.
#notice
#lol jad's upset
(͡° ͜ʖ ͡°)(҂⌣̀_⌣́)
youshouldnthavedonethat.net/index.php/contact/tyler
RnVjayB0aGUgcG9saWNlIQ==
What is the username and the password?
To what?
Message from YSHDT GM
A sad hour is upon us I am afraid
I would like to take this short moment of my time to apologize for what has occurred in the past months that what being absolutely nothing.
Consider this to be OOC, something I was hoping and planning to never do except maybe MAYBE at the end of it all.
There is still plan for continuation however, but before anything else I would like to take time to answer some question and further apologize for my (the GM’S) various failings, but I do not have time for it at this exact moment, I will however be available this Tuesday and if anyone is interested I would be happy to answer whatever questions anyone has on youshoudlnthavedonethat.net and what is going to be happening in the future, as well as apologize for the long inactivity and basically pulling a classic jad on everyone.
Johnisdead 2017 News!
Great news ID’s, youshouldnthavedonethat ended at midnight new years eve, and that means JID is scheduled for a return.
We now know that YSHDT and JID, were two sides of the same coin, and both stories intertwined, so there is wonderful insight in to the identities of many JID characters. I would highly recommend reading up on the YSHDT timeline, if you haven’t been following.
As soon as JID reboots, this page will start updating regularly once again.
Praise Luna.
4chan Thread
I forgot to share this for a legit year, but I made a thread about this. Members of /x/ helped a lot. http://4chandata.org/x/Weird-ass-Site-a816219
Hey this is saint hyrule. Do you have any follow ups since I took a long break?
Hey Saint, sorry for the looong hiatus, but yes, JID is coming back for 2017. The GM has finished up yshdt, and plans to reboot JID.
Lunar children password on the website? >~
Lunar children should now be accessible to everyone, no need for a password.
What is the username and the password to yshdt?
User name: JadusableIsGay
Pass: PraiseKek
what's jid?
John is dead.
dude yshdt got changed to a chinese porn website
I know, it’s hilarious.
Unfortunately Dawn did not maintain the site.
dude is there a place where i can catch up on literally all of lunar children? i checked out within hubris wiki but they don't have it there. ive been missing this stuff.
Yes, here actually. Lunar Children content is JID, and can be found in the JID timeline posted here on tumblr.
what does the yshdt mean by 'the plans have changed' like did someone find a clue that set this off? when did it change? im so out of the loop man
As of Jan 1st, 2017 the yshdt.net arc is finished. The site was handed over to an ID member (circlehunter) for lulz, and anything appearing on the site IS NO LONGER CANON.
What's the current ARG?
Current ARG is Johnisdead.
Hello, good afternoon/night, i just wanted to ask, is this ARG still active?
Yes! Johnisdead is still active, and as soon as it updates, we’ll alert everyone here.
How many years has this arg been going on?
2 years
I'm starting to think this ARG will never update honestly.
Don’t worry, it will.
So are Youshouldnthavedonethat and Johnisdead separate things?
Technically yes, which is why I have omitted the events of yshdt.net from the JID timeline. However, their stories and characters are intertwined.
This is an ARG. Please read the faq page http://internetdetectives.tumblr.com/faq
Do you love me, child?
- cumz intensely*
February 4th, 2017
- At 2:27pm, ID member Scout Pancake discovered an update to the JID website. The backround changed back to the original “Foggyworld.jpg”, and the BGmusic changed to the original “@90, by Kevin”.
#timeline
#JohnIsDeadTimeline
Is it one person answering questions or is it multiple?
It is me, Eevee. I update, and answer questions :)
Is it one person answering questions or is it multiple?
It is me, Eevee. I update, and answer questions :)
I EXIST TOO BUT I DO BASICALLY NOTHING!
SORRY NOT SORRY
~Link
Eevee, if you evolve, what kind of Eevee would you be?
Vaporeon
Do you answer all of your questions?
I try too. Some asks are incomprehensible so I end up deleting those.
Change
Johnisdead has fockin changed again. ripperoni.
JohnIsDead.
This morning the site changed again, Now showing a newspaper published Feb 2nd 2017.
Hi xd
Hey can you answer my question?
Yes.
(next question)
Please help me
???
When was this place created?
Are you referring to the groups? If so, then one is Tyler’s group and one is Mugen’s group.
Is this for real? a comeback of the IDs after such a long time? ~ Sincerely, An ID-lover
Well, the ID’s have never been away. We changed Skype groups. The large group we had last year has been dramatically reduced. Basically, we’re ID classic again. Original recipe 😆
February 24th, 2017
At an unknown time, the main page of JID updated. The title was canged to: “construction”, and the BG image was titled: “DSC_0324.jpg” (423 backwards). The image shows a faded red face, and the Lunaris Libro (the holy book of the Lunar Children). Nothing was hidden in the source code.
#timeline
#johnisdeadtimeline
IIIIT’S another update. noice.
I was watching some lostmemory423 videos, when i noticed, in the last video, there is a gas mask. I saw that gas mask earlier, it's the SCP-1499, you think its the same gas mask? it has the same color scheme and shape
The gas mask is meant to represent the character Drowned, which is in fact lostmemory423. As to the model # of the mask, I’m not really sure.
why?
#FuckTheFish
Lunar Children?
Yes, the Lunar Children site has been a part of Johnisdead since the early stages of the ARG. As of yet, we are not allowed into the archives.
#ask ID
#submission
dO72dgR2loYOBHaWBDY2li7OBKZOhgSephYqBHS2phYuBA42phYELhI've found this by replacing the 3 characters from the code in the description of IMG_1509 and converted it to base64. Any idea?: bmlrYErvaeBC6GFi4E5naWDvYWBDSmtvYWBE6WphYuBBbmrvZOFi4EJqZu9rYErvaeBM6GBK72ngTmdpYWxi6G7gQ0pk6mFi4ENjaWLs4Epk6m7gS2phYuBGb2BKa29s4ELq5GBDS2phYuBHamps4ETqZupnYEpm6GFgQmNq72xgSu9poEdM6m9uYE5naWnobOBE6WphYuBM6GBJ42ToamBM6G7gR29va2BE6WphYuBC6uRgQ05naWLqamtgROrvaeBPYuBKYuhjYEnoYmBIYEpk6m7gSu9p4ENIyMDEwEJnZMBE6mRramxqYi
Neither of those look complete to me. As of right now, we have no unsolved ciphers. Which one exactly are you looking to solve?
This video was originally uploaded to the Silentdork youtube channel on 5/28/15. Tyler told the ID’s the day before that he’d captured this footage while walking home from Kevin’s abandoned house.
In the subsequent days after uploading the video, Tyler was contacted by the police, and asked to remove the video from his youtube page, and destroy the original copy.
(Source: johnisdead.wikia.com)
#silentdork
#video
Timeline update:
An update to the timeline of: June 22, 2016 has been made to reflect a cipher that was decoded today, and a .txt file that was not previously recorded and is no longer available at johnisdead.com.
Please update your notes.
Is the title of JID "construction" because it's going under construction???
It may be a message to us that the site is undergoing changes, yes.
New mayb?
https://www.youtube.com/channel/UCfjnw6rFLW3-NhEphVdPymw this is another channel of the args, idk if it’s something new but it just appeared in an e-mail of a famous spanish youtuber sent by an anon
The M account is part of YSHDT, which is the first ARC of Johnisdead. (Check the timelines for yshdt) We’re not really sure what’s going on the Spanish youtube community right now, we know that there is a lot of interest in johnisdead, especially the Silentdork channel.
Hola
Hello :)
How do I get the password to enter the lunarchildren files?
The archive page is still locked. We do not have the password.
Now the spanish community es very interest in silentdork channel because a famous Youtuber is investigating what's going on there . Maybe he knows that is an ARG but he receives many mails and most of the community is discovering files that you already know
We all think its really cool that the Spanish YouTube community is intetested.
The internet detectives are watching you 🕵
That’s cool, we’d love to know more.
PAGE
There is the link: http://yshdt.net/
I dont know if your staff already saw this.
Yes, we do already know about this, thank you. This page was where the last ARC took place (The truth arc). That ARC ended on January 1st, now we are in the Final Arc.
We’ve get new people everyday asking questions, and getting really interested.
I just wanna to say, that I started investigating and decoding the johnisdead and all the arcs things weeks before that famous spanish youtuber did, i just wanted to say that, xDDDD -Josplosion also know as NitroCo or Beast.
So why don’t you join our Skype? We need good investigators.
Timeline update
I have updated the timeline for the date of 3/24/16 to reflect the ciphers solved within the Silentdork video “Regiminis”. I noticed that I never included them in the timeline. Please update your notes.
Three biggest tips for getting into investigating these changes? I was too young when the yshdt ARG happened to pitch in, but now I'm feeling ready to- and super inexperienced,,
You should send us your Skype, we’ll add you.
have you seen that?¿
We don’t have one, no.
Mostly because the GM always erase pages after we discover them.
Internet Detectives Theme Song
Originally just an mp3, now on youtube!
~Link
Hello c:
Hi :p
I found some staff
The other thing is that I found this image and put what was important. Maybe you already know all that I’m saying but I would like to give my part to solve this problem. I have “some” theories, that I would like to share.
By the way, John changing his username for Tenebris makes a reference to Eulogy.
First of all, I’d like to point out that the GM/Tyler DID NOT email BersGamers that dumbass game, it was one of his own fans fucking with him. Silentdork only followed his channel after we found his first video on the ARG. Bersgamers has literally nothing to do with this ARG.
If you’d like to join the Skype group and share your theories with us, add me on Skype: wickedlady4180 (Eevee Reborn).
Timeline Update
An update was made to the timeline date June 23, 2016, to reflect several things left out of the original edit.
- The password to Lunarchildren update 3
- Silentdork video 3
Hi, first, sorry about my probably bad English XD, well I just know about silentdork and all of this topic last week, I just want to know what do you know about it and, the most important think to me... Is it real? I mean, all about lunar children and silentdork and Lostmemories it's real? Or just an internet game?... Thanks :D
Hello, I know more than most ppl, as I write the timeline. Yes, this is an ARG, and we’ve been playing since 2015.
Hello. I was seeing a lot of things about Lunar Children, and Kevin and John is Dead. I am really confued about this things. Sorry, my question is, ¿What is an Arg? I search it on internet but I still not having it clearly yet, so, if you can explain me clearly, y would be very happy. And, another question, ¿Is this real? I mean, all this things about a murders in a fishery an human sacrifices and that kind of crazy things. thanks.
An ARG means “Alternate Reality Game”
And no, it is not real. Also Kevin is not dead :P
Hello!
We’re here to answer any questions you have about John Is Dead. We don’t run the game ourselves, only one guy does. Anyway, ask away if you like.
- CircleHunter
New video on Silentdork channel
Silentdork published a new video!!
What's new since the events in the last year ?
The timeline is completely updated.
Yes, there updates.
JordiWild is doing a review about you. You appear on his last video.
Cool, I’m glad he’s interested in the ARG.
May I join?
Yes, PM me your Skype name.
I’m curious
- I don’t know how it finishes.
- Vincent Adams = Jacob.
- Not sure about your last question.
Can I join to the internet detectives?
Sure!, Send us your Skype name and we’ll add you :D
~Link
Today is a great day for Jhonisdead or that is what they think
Well, it certainly looks that way! Let’s see how it goes from here.
- CircleHunter
Do all the internet detectives know what the plan for the ARG is or do only the Game Masters know?
Only the GMs know the true plan. A few of us are sort of in moderating positions, but aside from that, we’re all players.
- CircleHunter
Can I join to ID?
Its a way to join Internet Detectives?
Absolutely, just send your skype username and we’ll get to ya.
who is "Jordi Wild"?
A Spanish Youtuber who found the ARG.
Honestly it looks very interesting . Sure the investigation will continue
Thank you, yes the ARG is still ongoing.
I want the truth? i need participer
We can answer any question you have. You can also read the timeline, it’s updated. :)
March 24th, 2017
At an unknown time, Silentdork uploaded a video titled: “4/23/2017 ebuTouY -” (https://www.youtube.com/watch?v=H_5cDGWeRgc) The video featured a black screen with water gurgling sounds. No messages were hidden in the source code.
#timeline
#JohnIsDeadTimeline
Timeline Update
An update was made to the timeline of 3/10/16, timestamp 3:56am, to reflect a recently decoded cipher.
Will we ever know the truth about john is dead?
Eventually, yes.
Do you know who threatened Jordi Wild and his fans on that Johnisdead wikia? It seems that you run that site, but you don't seem bad people at all.
We got raided lastnight on our Wiki 😣
But we have deleted the pages, and blocked the users.
I wish you luck :p
Codification
yZjPis1dFhCMjY0LSkyLEZiZTBya2s+DQorOG49JzIzbmpKMDFJWkQycm50Pis4ZT0nMi5fWEIyPCFyQTMlMnU+Kz49VT8zOEZIKTIjMjI/KzcrOiQzMG5qSjAyUnVfMnINCmtrPiszOyZkMCkpYEgwNDo2KTJya2s+Ky4yYEgwP207RTIlL2w+KzBWImExNlUyJjNzdCg
pytmxzn
/KzVNQSoxPFhjKTJxaGs+KylRRw0KPisxREEqMTU9LWMxIyx1Pis0ZT0nMjVVbEQyIiNjPistNWBIMDlMUSkyISNsPis1MVU/MzVJdSUzdHFrPis8K1U/MzZMNkgx
Those don’t look like anything TBH.
Maybe incomplete?
Why Vicent Adams is Jacob??
Thanks for the help.
Yes Jacob is Vincent Adams.
After John died, Tyler and Jacob lost their memory. Tyler ran away, but Jacob remained and became a vessel for Patrem. The Lunar Children renamed him Vincent Adams, and we currently do not know where he is.
If you watch his videos, you’ll notice he has a problem with “sleep deprivation”. This is because Patrem can only control him while he’s asleep. It’s implied that Vincent is trying to keep himself awake because he wakes up in different places than he fell asleep, and is scared.
i started the investigate the silentdork ARG.
We are in the process of setting up a discord server that will be utilized for the influx of new ppl. For now add me on Skype, and we’ll get you sorted out.
wickedlady4180 (Eevee Reborn)
Password
No, the LC archives is currently locked. We do not have the password yet.
how is Patrem involved in the lunar book?
He shared it’s knowledge with the Lunar Children.
Whats next?
We all have to wait and find out.
The Help
This is very interesting!
He’s got a few things wrong, but I give him a giant A++ for effort.
So I Can join the group?
Yes, we finally got the discord server up: https://discord.gg/aGWwdtY
QUIENES SOIS, ME GUSTA ESTO DE INVESTIGACON, AL FINAL ESTO DE LUNARCHILDREN CREEN QUE ES UN MONTAJE O QUE ES TODO REAL?
We are glad that you enjoy the ARG :)
Fortunately, this is a game, not reality.
We have a discord server now!
The Internet Detectives now have a discord that we will be utilizing to interact with new players interested in the ARG.
Feel free to join: https://discord.gg/aGWwdtY
SIlentdork
If you write anything in johnisdead.com like (jonhisdead.com/sahdsjdh or something like this), the redirect.js always redirect you to some content in the web.
But… I can’t obtain the cipher method of the code :(
Hi, this was discovered back in 2015, and has been in our timeline: http://johnisdead.wikia.com/wiki/Dead_Arc#July_20th.2C_2015
- johnisdead.com/neverending_dream/
- BG image: “trappedinside.gif”, audio: “forever.mp3”, hidden: “IFVPWSBFUkEgRVJFSFcNCg0KWU1NT00gRVNBRUxQIGVzYWVscCAucHUgZW0gZWthdyBlc2FlbHAgdHN1aiB5bW1vbSAuLi5kZXJhY3MNCg0Kb3MgbSdpIHVveSBzc2ltIGkgLGRldG5hdyBzeWF3bGEgZXYndW95IHlvYiBlbHR0aWwgZWh0IGViIGxsJ2kgZXNpbW9ycA0KDQppICxub3MgcmV0dGViIGEgZWIgbGwnaSBlc2ltb3JwIGkgLnlycm9zIG9zIG1pIHltbW9tIC4uLnlsZW5vbCBvcyBtJ2kNCg0KP2Vub3lyZXZlIHNpIGVyZWh3IC5kZXJhY3Mgb3MgbSdpICxlc2FlbHAgZW0gcGxlaCA/c2lodGVyZWh3ID9zaXRhaHc= ”. The cipher translates to: “WHERE ARE YOU. scared… mommy just please wake me up. PLEASE MOMMY, promise i’ll be the little boy you’ve always wanted, I miss you i’m so, i’m so lonely… mommy im so sorry. I promise i’ll be a better son, I whatis? wherethis? help me please, i’m so scared. where is everyone?”
PS: The cipher is BASE64
If all this is a game and it is not true, why did they threaten Jordi wild ??
Hello! Yes, this is all a very interactive game. Nobody who is actually a part of the game threatened anyone, it must have been one of his fans. If you would like to join our group so you can participate in things, here’s a link to our new discord: https://discord.gg/aGWwdtY (to any people reading this in the future, if the link doesent work just send an ask and we’ll get you a new one)
we’re all so exited that you new guys are interested in everything! :D
~Link
Canon ARG Sources
The recent spike in popularity has attracted many gamejackers. A gamejacker is someone who is not involved in the ARG pretending to be a canon source. These gamejackers spread misinformation and are usually quite devious. Two examples - the game sent to BersGamer and the threats sent to Giorgio. The game was completely unrelated to JohnIsDead, and the threats weren’t sent by anyone involved in the ARG.
Make sure you get all of your info from canon sources:
YouTube Channels:
silentdork’s YouTube
lostmemory423’s YouTube
Vincent Adams’ YouTube
Canon Sites:
JohnIsDead.com
LunarChildren.com
Older Links:
WhatIsBen.com
Doug’s Blog
Helper’s YouTube
Original JiD Thread
Resources:
Internet Detectives Tumblr
Internet Detectives YouTube
OceanStuck’s Dropbox
CircleHunter’s Timeline
JohnIsDead Wiki
-Wolfcat
#links
#sources
#link
#source
#wiki
#dropbox
#canon
Would you recommend using that discoverthemistery.blogspot to keep going?
Definitely feel free to watch whatever group or blog you wish. Having different perspectives on the ARG is a great thing and we encourage that blog to keep it up, just make sure you keep your speculations based on evidence. Always read up on the JohnisDead wiki and timelines.
-Wolfcat
I don't know if you have discovered this before, but I've found the password of the Protected: Update page of Lunar Children: mhftt. There is a text, exactly this one: what will happen this time. Father O true Father I worship thee in mind, body and soul. Your victory is assured in this and all times, Father!You were too late for this one. The game is not over yet, keep playing.
Yep, this was found a while back and it’s listed in the JohnIsDead timeline.
I is posible join in game
Join our discord: https://discord.gg/aGWwdtY
Is this only a game??
Yes, this is an ARG.
Bible verse John 4:23 on silentdork video
“But the hour comes, and now is, when the true worshippers shall worship the Father in spirit and in truth, for the Father seeks such to worship him.”
Oh wow. We did not notice this. I will take another look and add it to the timeline. Thank you!
LOSTMEMORY423
“something is wrong with Ifrit, he has snapped and started killing people dqi lzwevqvo ivl mtmkbzwkcbqwv (iakmvaqwv xibbmzva) and seems to be trying to bzivakmvl bpmu cvlmz bpm tcviz kpqtlzmva bmikpqvoa (rcab tqsm epib ammua bw pidm pixxmvml bw smtjzqa inbmz pm sqttml pqu 10 gmiza iow) ikwzlqvo bw bpib jwws itmf jzwcopb ca He did his ceremony to Alex and according to one of your local guys he got Spencer (I dont know how unless he can somehow fucking teleport)but I am sure you already know.Insididiea is a spy for the traitors do not trust him I understand now why he was so upseu after alex brought us that book from the lunars! I think ifrit is working with him or something.”
I don`t Know if the part without sense its cipher too or its corrupted.
Yes, here is the link to the transcript: Grotto Papers
Silentdork
Yes, we currently have a list of the redirects, and pages of johnisdead.com, thank you.
I love this <3
Aww thanks <3 you’re so kind :D
~Link
I’m so glad we have so many people here to help us out with decoding stuff and what not. This is going to be pretty fun-
Just a friendly reminder
We have a discord! if you want to join please use https://discord.gg/8p2h7q9 to join us!
~Link
What's the game about? How do i get in?
https://discord.gg/8p2h7q9
TY Internet Detectives
Our new discord server has a section with Spanish speakers. https://discord.gg/8p2h7q9
How can i enter the game with yours?
Join us on Discord: https://discord.gg/8p2h7q9
2, Lostmemory
That link doesn’t work :(
Hi I have two questionsThe first that has to see internet detectives with lunar children and the second is what is used for internet detectives is its purpose
Hello! The Internet Detectives is just a group that was created to play ARGs. Our relationship with the Lunar Children is the same as most players - stop them from summoning Luna into our world and save those who they’re after.
-Wolfcat
password of lunar children
I’m guessing you’re referring to the protected post on the front page? The password is: mhftt
Edit: Unless you’re talking about the Archives. We currently have no password for that.
-Wolfcat
Hello I would like to join the internet detectives group as ID's as I could join and what advantages does it have to give my skype?
Hello, we’ve recently moved over to Discord instead of skype. If you’d like to join, go here.
https://discord.gg/8p2h7q9
The advantages of joining are really just being in a large group that’s been playing the ARG for a long time, so you have plenty of people to work with. Of course, we encourage the growth of other groups playing the ARG as well and our resources are free to use, so don’t feel restricted to just us.
-Wolfcat
yshdt. net
As of right now, this site is unrelated to JohnIsDead. Unless a canon source acknowledges this site, nothing posted on it should be considered canon.
-Wolfcat
have you got password for the .rar's archive?
I’m not sure what exactly you’re talking about. We still don’t have access to the Archives on the Lunar Children website - no one knows the password. There were two .rar’s that were password protected, do you mean those? “three.rar” has the password “A key”, and “ WhoWasTheFirstAccount.7z” had the password “DandP”.
-Wolfcat
three.mp3
Hey IDs! Some time ago I downloaded a rar file named “three.rar” on a JID site. It was password protected, but later I saw a post of you saying it was “A key” XD. So I found it contained a mp3 file named “three.mp3”, and I decided to take a look at it.
At first glance, it was just sort of a weird song (a weird experimental song XD). but then I noticed something very odd. I remember watching a video several years ago in which I learned you can hide images in an audio spectrum, this produces a very funny audio that “hides” the image.
And indeed! When I started analyzing the mp3 file I found some weird stuff hidden in it.
The first thing hidden in the audio features like a drawing of a burning house and, next to it, the words “He burned”
The next thing I found reads: “The number three is reported [some weird lines] to have been said numerous times.”
The next thing is sort of a drawing, I really don’t know what it is, but it seems like three stick figures and one of them is really strange XD
I’ll leave the images here, just so you can see them. Hope this might help:)
http://imgur.com/a/pa60V
http://imgur.com/a/vxAp8
http://imgur.com/a/n2Bzv
#submitted post
#submission
three.mp3
Hey IDs! Some time ago I downloaded a rar file named “three.rar” on a JID site. It was password protected, but later I saw a post of you saying it was “A key” XD. So I found it contained a mp3 file named “three.mp3”, and I decided to take a look at it.
At first glance, it was just sort of a weird song (a weird experimental song XD). but then I noticed something very odd. I remember watching a video several years ago in which I learned you can hide images in an audio spectrum, this produces a very funny audio that “hides” the image.
And indeed! When I started analyzing the mp3 file I found some weird stuff hidden in it.
The first thing hidden in the audio features like a drawing of a burning house and, next to it, the words “He burned”
The next thing I found reads: “The number three is reported [some weird lines] to have been said numerous times.”
The next thing is sort of a drawing, I really don’t know what it is, but it seems like three stick figures and one of them is really strange XD
I’ll leave the images here, just so you can see them. Hope this might help:)
http://imgur.com/a/pa60V
http://imgur.com/a/vxAp8
http://imgur.com/a/n2Bzv
Yep, this was found a while back but some of it is still unexplained. The house burning is clearly a reference to John. The three figures in the middle we suspect to be Tyler, John, and either Jacob or Kevin, but we’re not sure. This is just speculation. The line at the end about the number three is a direct quote from the original Moon Children website about Kelbris’s talks with Luna. The number three does indeed seem to be very important with Luna, as mentioned on the Lunar Children website.
-Wolfcat
New video update! This time on the much more scarcely used channel, Vincent Adams. We can hear a piano rendition of “Show me”, the Lunar Children theme. The code in the description and title all translate to “show me”. Checking the video tags reveals “show me” and “73 68 6f 77 20 6d 65″ as tags, again translating to the former.
-Wolfcat
#johnisdead
#silentdork
#jid
#john is dead
Another new video from Vincent. This one is very interesting. First let’s get the codes out of the way. The title translates to “Foolish child”, and the description says “Did you think you would remember this?” As of the time of this tumblr post, there are no tags.
There is also a date in the description: March 19th 2015. This is the day when Patrem was speaking to us through Vincent on Within Hubris. In the middle of our conversation, Patrem lost control of Vincent and we were able to speak to Vincent for a while. Vincent said he was in some park and mentioned a child asking him about a strange purple man (most likely referring to Patrem a few moments earlier). Based on what Vincent says in this video (The park - the park he woke up in, the child - the child who asked about the purple man, the website - Within Hubris where we were talking to him), it’s clear that this takes place in the specified time and is from Vincent’s point of view.
There is also whispering that can be heard about 30 seconds in - most definitely from Patrem. We’ll update when we have a better transcript of them. Check March 19, 2015 on the timeline for part of our conversation with Vincent.
-Wolfcat
#john is dead
#johnisdead
#silentdork
#jid
April 3rd, 2017
- at approx. 6pm, Vincent Adams’ youtube account uploaded a video titled: “73 68 6f 77 20 6d 65” (Translated: “Show me”) https://www.youtube.com/watch?v=jr3kM2iIIn4. The description of the video also repeated the title’s cipher several times. The video featured a view of Vincent’s window, the view outside, and an indistinguishable reflection in window. Vincent is heard playing a piano in the backround, seemingly creating the song that plays on lunarchildren.com This seems to be the piano creation that was decribed on the anthem page of the LC’s website. “This song is a lyricized version of a piano melody created by Father Patrem in honor of Luna, just prior to the creation of our group.” http://lunarchildren.com/anthem/
- At approx. 7pm, Vincent Adams’ youtube uploaded another video. (https://www.youtube.com/watch?v=rMml5FXw-eU) The title translates to “Foolish child”, and the description says “Did you think you would remember this?” There is also a date in the description: March 19th 2015. (http://johnisdead.wikia.com/wiki/YSHDT_Arc#March_19.2C_2015) This is the day when Patrem was speaking to us through Vincent on Within Hubris. In the middle of our conversation, Patrem lost control of Vincent and we were able to speak to Vincent for a while. Vincent said he was in some park and mentioned a child asking him about a strange purple man (most likely referring to Patrem a few moments earlier). Based on what Vincent says in this video (The park - the park he woke up in, the child - the child who asked about the purple man, the website - Within Hubris where we were talking to him), it’s clear that this takes place in the specified time and is from Vincent’s point of view. There is also whispering that can be heard about 30 seconds in - most definitely from Patrem, the whispering appears to be what’s written in the title and description.
#timeline
#JohnIsDeadTimeline
How are you?
We are doing good, growing fast, and waiting for a new update.
Where'd everyone go?
We’re still here, there just hasn’t been much ARG activity. We’re expecting things on 4/23 though. If you’re talking about ID in general, we’ve moved to discord: https://discord.gg/8p2h7q9
-Wolfcat
That's good to know :D What type of music do you like? Have nice day :D
Eve and I both like Alternative Classic Rock. Adult_Link is a bore who likes video game music.
How would you suggest killing a person?
Make them a character in this ARG. I’m sure we’d end up accidentally offing them eventually.
-Wolfcat
Discord
Reminder that we got a discord now. Join to know what’s up in the ARG.
https://discord.gg/jeehUrk
So, I don't know if you knew about Jordi Wild streaming, but if you did... Can you explain me what happens with the call or something about it? Thanks
We’re not sure what happened.
you think the link in silentdork website its important?
The Silentdork Youtube is very important, it’s the main character.
And why is slientdork sorry?
To answer both questions: We don’t know.
1.Would you mind tell us what's happening? Silentdork posted a video and it was creepy, most the final.. 2. It's drownedman really part of this story or we are taking the wrong path?
1) The video itself was pretty straight forward, Tyler was brought to a very spooky place and attacked.
2) Drowned is a very important character, he helped us many times during the arc, and we helped him as well.
Were you guys trying to help Jordi wild?
We noticed that he almost never tries to solve ciphers, and honestly that’s where all the secrets are hidden. We just tried to push him in the right direction.
Everything is an ARG, however, do not explain it through videos to Jordi Wild, if not scare and more.
We like to help everyone, that will not likely change. Thank you :)
Do you think it could have been "Lunar Children" of Jordi Wild's live?
No, we are 110% sure his fanbase is messing with him. Which is sad, cuz’ we were enjoying the stream.
Que piensan de Jordi Wild? va por buen camino o se esta metiendo en donde no debe?
We like Jordi, and enjoyed the short stream he did, but yes he got sidetracked by a video that was not part of the ARG. (This one)
Srry, me again... What do you think that could happened?
In regards to what?
In the live of Jordi someone pointed with a laser in his eyes, and called in his house. We think they are only some fans kidding him, Jordi said that he's okay
That’s good to know, we were a bit concerned for him. We’ll keep an eye out for a new video from him.
About El Rincon de Giorgio
We have never had direct contact with Jordi.
4/23 is a sacred day for the Moon Children & Lunar Children, it is the birthday of Benjamin Hubbard.
I’ll talk with the other ID’s and we’ll see if we’d want to do something like that.
Who is the guy from the video me in your channel?
That is Doug
http://johnisdead.wikia.com/wiki/Douglas_P.
Are you part of this game, or are you investigating?
Our group is investigating.
~Thorin
If you are detectives, why your videos are soo fucking creepys?
The videos on our youtube channel are mostly all backups of things that were on Johnisdead and the other related websites, that are no longer up. It’s like an archive.
~Link
Just wanted to let you know that you guys are amazing, I love all the work and time you dedicate to the ARG. So ummm, what do you usually do on your daily life, you know like, besides being "internet detectives"
Well, some of us work and go to school, but most importantly we are friends. We usually hang out on the discord and play video games and have fun ;)
Does it have any relation? The video is a reference of Ben Drowned?
Yes, Johnisdead is a fan continuation of the Moon Children Arc of Ben Drowned.
Why LunarChildren's website doesn't work?
Ddos’d
For how long have you guys been investigating this?
Since January of 2015.
On 4/23/2017, “going to kevins” was uploaded to the SilentDork channel. Let’s go over what we see in the video.
First off, we can assume that this happened to Tyler a while back, so whatever danger he faces in this video is no longer a threat to him. In his video “Update june 23rd: More to come”, he stated that he was going to upload some videos he took himself. Judging by the timestamps in both the descriptions and the video itself, we can assume that this was uploaded by Tyler himself, not some malicious spirit.
The description reads:
“oct 11th 2015
never made it
shouldnt have went outside
shouldnt have opened the door
they got me”
October 11th 2015 was the day Tyler uploaded “going to” on his channel. In this video, he visits JohnIsDead. The site tells him to go to Kevin’s house, which he agrees to do before the video cuts off. It appears that we’re finally seeing exactly what happened when he arrived in this most recent video. The tags of the 2015 video read “blood moon ritual ground I’ll see you soon Harbingers Link,” This might help clue us in to what exactly we’re seeing.
Onto the newest video’s contents.
We start off seeing what seems to be a dark room. Possibly somewhere in Kevin’s house? We faintly see Jadusable’s video of Rosa overlay the current vid. In the background, we hear “Who’s That Knocking At My Door?” playing in reverse very softly. This is often considered Doug’s theme song, as it usually accompanies him. Right on cue, we hear some spooky noises as the video cuts to a faint picture of Doug smiling at the camera.
Doug then appears and does a jumpscare before the video switches to someone holding a sign saying, “She told you not to open it.” This is clearly another reference to Jad’s Rosa videos, wherein one of Rosa’s predictions was simply “Don’t open it.” After this, we see a faint image of Rosa before the video cuts once again to a different figure. This figure is very hard to make out, as we can only see what appears to be the mouth, but judging by the red coloring, we can guess it’s Kevin.
After this, we hear a very quiet and staticy voice saying something. By raising the volume in a video editing program, we can make out this: “We need to lock him up. But ???????? first. Just don’t let him kill himself.”
The video cuts to some unknown date in 2015. Tyler appears to be locked in some sort of server room. Tyler says: “This place is so fucking huge. ????. I don’t know who the fuck these people are. Hey, at least I found my fucking phone. Now if I can just find a fucking exit. What the fuck is this shit?"
We then see Tyler filming in some sort of dark room in front of a strange light. In the background we can hear what sounds like drums and some chanting. Tyler begins talking again: "Okay… I managed to find something like a fuckin’ lamp… This is the only light… This is the only lamp(?). I wanna know what the fuck these people are doing in here, it’s dark as shit… I think the exit might be through this way."
The video cuts to Tyler walking around in a dark room. "It’s always so fucking dark… I don’t think anyone’s in here. Not gonna risk turning the light on though. I think I’m almost out… What the fuck is this fucking… fuck fuck fuck… I’m going in fucking circles… Damn it, it’s so fucking dark. I’m fucking walking through walls or some shit. My eyes are fucking playing tricks on me cause I’m fucking teleporting or some shit through all these fucking rooms cause I keep seeing the same shit again and again-”
The video abruptly cuts once more. Tyler is now looking outside through some kind of metallic door or grate. “Oh wait, wait, what? What the fuck? Fuck it, fucking solid metal fucking door! It’s fucking-” Tyler is then cut off by a loud distorted voice as the video corrupts. The voice appears to say: “HURRY, STOP TYLER/THE(?)” It is a bit difficult to make out. Judging by how the video turns green while this entity speaks, we can guess that it is Doug, since he is always associated with the color green. The video then cuts to black as Tyler yells.
We once again hear a staticy voice like before. It appears to say: “[????] Did you get Douglas up here? …Good. Take the Harbinger’s Link to the interrogation chamber. I have a few questions-” The first part of this is very difficult to make out. I think it may be in Spanish, but we aren’t sure. As we know, the Harbinger’s Link is Tyler.
After this we see what resembles lights moving overhead, perhaps this represents Tyler being dragged somewhere and we’re seeing his point of view?
We then see where Tyler was taken - some sort of freezer. “J-jokes on you, I happen to fuckin’ like the cold…” The video cuts to Tyler banging at the icy wall. “Fucking pricks, let me out… let me out…” The video cuts again to the ventilation fans in the freezer. We can hear a distorted voice when the camera is focused on the left fan. The voice is backwards - reversing it, it says “You’re wasting your battery.” Tyler then looks at the other fan and says: “Maybe I can get out through these vents…”
The video cuts to Tyler looking at the freezer door while we hear some more backwards voices. Reversing this, it says: “Really, you should listen to yourself. Just this once.” This voice sounds like Tyler’s. We then see Tyler laying on the floor in pain, the cold clearly starting to get to him. There is one final video cut as we see someone grab Tyler off the floor by his hair.
-Wolfcat
#silentdork
#johnisdead
#jid
April 23rd, 2017
- At approx. 6:30pm a video was uploaded to the Silentdork youtube channel. (https://www.youtube.com/watch?v=PgYgIAEl6rE). The title of the video was: “going to kevins”, and the description read: “oct 11th 2015. never made it. shouldnt have went outside” A transcript of the video can be found here: (http://internetdetectives.tumblr.com/post/160040245243/on-4232017-going-to-kevins-was-uploaded-to)
#timeline
#JohnIsDeadTimeline
Answering some submitted questions
“Good afternoon. I have a question. I’ve been researching on the Johnisdead wiki, but I’ve seen things (in the “died” box) as “2009 (human)”, but then something like “January 1, 2017 (entity)” appears. The “entity” comes to me in characters characters and with the same date.
My question is: What does “entity” mean and why should the “entity” of all that I have seen be exactly the same date?
Thank you in advance.“
Some characters were once humans who, when they died, turned into a spirit, ascended, or transformed into an entity. For example, let’s look at Kevin. Kevin died as a human in 2011, transforming him into Regiminis. Regiminis was defeated in 2017. This is why there are two different death dates, they are for the different ‘forms’ of characters.
“amigos yo llevo 11 meses en este cuento de lunar childrend y los canales de you tube y he tenido experiencias por medio de correos electrónicos que me envían advertencias y amenazas y con ellos un par de códigos vinarios y me siento un poco asustado, y aunque solo sea un juego no me siento seguro“
This is strange. The only time users have ever gotten emails to my knowledge is when they were the ones who emailed characters first. Are you sure you aren’t being trolled? I know some popular youtubers like Giorgio have been getting emails from trolls pretending to be characters from the ARG. Also, I wouldn’t worry or feel unsafe - it’s all just a story. You’re just dealing with classic trolls.
“How did Silentdork know that someday someone its going to try to find out this mystery?“
It is an ARG, so there are clues all over the place, slowly uncovering the truth for us. If you’re asking how he knew people would be interested, he originally had someone pose as a regular user on Within Hubris, a message board for Ben Drowned, pretending to stumble across the first website - a clever way of giving us the URL for the website without giving away his identity.
“Hello guys,I’ve have founded the website silentdork.com, the sound is pretty scary, i’m not sure what the binary code means (it’s posted on the website).”
This is an impressive and spooky site, but it is not canon at all, and is made by a fan. You can tell because no canon JohnIsDead sources link to this site, and the youtube channel that the codes lead to is subscribed to prank channels and stuff, lol.
“Ehhh Tío , tu crees que Jordi está haciendo las cosas bien o hay Algo de que aún no se ah dado cuenta? Si sabes algo verdad de SilentDork que Jordi junto nosotros no sabemos“
There is a lot that Jordi has not yet realized, but I think that’s because he has not read the timeline yet and sometimes stumbles across videos that are completely unrelated. It’s not his fault though, the ARG can be confusing to newcomers. Hopefully soon we will have a comprehensive video detailing the timeline in an easy to understand way.
“What about the threats that Jordi has been receiving?“
These are just trolls, just like whoever was pointing the laser in his eye and leaving him notes. A similar thing happened to BersGamer - someone sent him a completely unrelated video game claiming it was related to John is Dead. You can’t trust random emails, lol. There are a lot of fakes out there.
“1. Have you Lunar Children’s pass?. 2. Do you understand Spanish? If not, how do u know what Giorgio says in the streams?“
The password to the protected post is mhftt. We currently have no password to the Archives. And now that Giorgio has given John is Dead a lot of attention, we have many new Spanish speaking players who help translate what he’s saying for us. A big thanks to those guys <3
“What will happen on April 28?”
Nothing, I think. Are you talking about April 23? 423 is a number that appeared numerous times in Jadusable’s Ben Drowned ARG, and so important things usually happen on 4/23. In this case, a video was uploaded to SilentDork.
“La pescadería o pesquería tiene algo que ver con silentdork o con la casa de John?”
The Fishery is a Lunar Children meeting place. A lot of important events happened there, and is a spooky location.
“Hey, ¿Link to the ID discord?“
Here you go: https://discordapp.com/invite/8p2h7q9
“Hello”
Hello!
Alright, that appears to be all of the asks for now. Sorry I cannot respond in Spanish, my Spanish is very bad and I think google translate would just confuse people lol.
-Wolfcat
“Hello guys, how are you? Are you Satanic or something? C'mon, answer me as soon as you can.?”
I think we are mostly not satanic probably.
-Wolfcat
“Porqué no puedo entrar en la pagina de lunar children??”
The site was DDoS’d. It will probably be back up eventually.
-Wolfcat
So have you abandoned this place?
Nah, its just there’s been a mix of nothing happening in the ARG, and nobody asking us stuff. We’re a lot more active on the discord. https://discord.gg/8p2h7q9
When stuff starts back up, we’ll deff post stuff here.
~Link
Hello guys, writing to you from COL. First of all, I want to say that I admire the work u guys are doing, and the time you dedicate to this. I wanted to ask you a little question. Lst month a new ARG started inside the campus of my college. Right now there is a FB group with about 800 ppl, investigating, but only few are into the subject. I'm afraid that in our country we're not familiarized with this things, and ppl are leaving the game. Please, wht tools can we use, any recomendations? -krvvs
Hello, the best answer I can give is to regularly post theory, and keep interest going by talking about the ARG. In down times, ppl tend to lose interest quickly, and that can be remedied by trying to create a group of friends within the most interested players.
How can I enter the ARG as player?
You can join our discord, there’s links in previous posts.
Who or what is Tenebris Link??
John was our Tenebris link.
Where does the term Tenebris Link come from?
It’s a term used by the lunar children. Tenebris is an entity, and he used John as a link to this world.
Are you the nice guys?
It depends on who you ask.
Very sad and confused
“Hi my best friends, thanks to all the people that helped me :3 and I want see my friends but is hard. :c I live in a very small and dangerous nation. Elsalvador SV kisses, my time is short. and what happen the october 22?”
Dude, I hope you’re ok. We wish you all the best luck, pls stay safe. As for 10/22, to our knowledge nothing happened on that date.
Kevin is from the lunar children
where is jhon?
Johnisdead
JID Update
Just a shout-out to all the johnisdead players out there: after 4/23 the game is obviously on a hiatus. For those who’ve been with us from the early days, this is nothing new, we know that the GM is a human just like us, and whether it’s general life stuff or creative barrirers, content sometimes comes to a halt.
For our new players, fear not! Johnisdead is not “over”, it’s just taking a break. At several points in the timeline you can see the large gaps in updates. Now is a great time to get totally familiar with the Lore, characters, and gameplay technique. For those who haven’t joined our discord, head on over and say hi, we’ll answer all your questions.
Right now as it stands, the stats are this: Tyler is still at home (Silentdork’s last “abduction” video was set in the past), John is still theoretically dead (though there are theories that suggest he’s alive according to the ending of the Regiminis video), SKM/LiquidSaint is alive and in the U.K., all but 2 possibly 3 Lunar Children are dead/ascended, Jacob is still missing, Vincent/Patrem are safe at home, the Moon Children are also dead, and the Harbingers have moved their communication location (Skype to Discord).
Updates will be announced here and on the wiki as soon as they occur.
~ Eevee
Membership
“How can i be member of Lunar Childrens¿ Im from CAnary Islands”
Currently, the Lunar Children website is 404’d.
why?
Because.
“yep, could you post any link to discord channel? youtube´s link appears offline, thanks”
Oh my gosh i’m so sorry! we removed our old links and i guess we forgot to update them :L
discord.gg/CzVayTN
~Link
what is love?
Baby don’t hurt me.
What about Giorgio? No more videos? You must contact him to continue the investigation! Greetings from Spain.
Giorgio got too spooked. He shouldn’t have done that.
Do you know when this might be coming back?
We are looking towards 11/11 for a possible update.
How can we find again the lunarchildren page? the last one is closed…
Right now the LC page is closed to traffic. We’re not sure if it will come back.
Johnisdead info & news
Sorry for the lack of content and updates in the past few months. I noticed a few new followers, hello to you all.
As far as updates go, there’s been nothing officially since 4/23. The ID’s did save Tyler from hurricane Irma (https://youtu.be/-x1bV3EU3_I), but he hasn’t thanked us yet. Ungrateful fuck …
Future dates to look forward to are 11/11, which is coming up fast, and possibly Halloween (but that is more of wishful thinking on my part.)
I’m still planning on creating a youtube video series on Johnisdead, but am trying to work out the formatting details. I don’t have a definite project launch as of yet, but look out for more info on that in the future.
That about sums up everything so far, feel free to join the discord and interact with us.
Johnisdead update 11/11
Alert: New video https://youtu.be/KTi6Na_CVNc
New video from Tyler
November 11th, 2017
• At 11:32pm, the ID’s discovered a new video on the Silentdork youtube channel (https://youtu.be/KTi6Na_CVNc). This video was titled “.”, and was originally uploaded on 10/23/13, but has been unlisted all these years. It is now the official oldest video on the Silentdork channel. The video featured gameplay from what we believe to be one of the remember.exe trilogy games. In the video Tyler is screen sharing his gameplay with John, his character is underwater and he’s remarking about how his character is not drowning.
• At 11:45pm, Captions are discovered in the video settings. The captions read:
o This story is older than all of you
o and now you show up
o but so late
o 01000111 01001001 01001111 01010010 01000111 01001001 01001111 (= GIORGIO)
o “…Filed missing persons report just before 2017 new years eve…”
o Do you really think he is still alive?
o “…deaths all linked to members of local religious group”
o Glphqvlrqv (= DIMENSIONS) Where is Tyler? h e n
• At 11:58pm, ID member Circle mentions the video shares a title with a previously uploaded Silentdork video (https://youtu.be/H_5cDGWeRgc). This previous video has drowning sounds. There is now speculation that Tyler may be dead.
#johnisdead.com
#timeline
#johnisdeadtimeline
November 12th, 2017
• At 12:27am, ID member ArgDov sends an email to pididoip@johnisdead.com (aka: “K”), this email contains the MM song Sonata of Awakening. (http://internetdetectives.tumblr.com/post/167435654588)
• At 1:27am, ID member Scout discovers an update to JID main page. The title changed to “Comatose”, the BG image changed to “awaken.jpg” (http://internetdetectives.tumblr.com/post/167436108208), the BG music changed to “awaken.ogg” (http://internetdetectives.tumblr.com/post/167436830473) hidden in the source code was a cipher “dtrH” (Unsolved). This update is important in two ways:
1. This proves that we now have our song powers back! Although we do not know at what point we were given back our Ocarina, we are certainly happy to have it back in our possession.
2. ArgDov has finally redeemed himself, atoning for his sinful giving of the bomb plans to Doug. He’s finally done something useful in over 2 ½ years. Mazel Tov!
• At 1:34am, ArgDov sends another email to “K”, asking how we can help Tyler. The reply was “Who’s Tyler?”. (http://internetdetectives.tumblr.com/post/167438440623)
• At 1:57am, ID member Dila discovers a change to the page /hole. The page now displays a black screen which says “whats lost can be found m/” (http://internetdetectives.tumblr.com/post/167438916053)
• At 2:24am, ArgDov get an additional response to his email, this time a cipher which decodes to “whats lost can be found”. (The ID’s now attempt to figure out what’s been lost, trying several url extensions)
• At 2:50am, the ID’s discover a new page: “johnisdead.com/memory/”. The title was “Forget”, and the BG music is “ForgetMe.mp3” (http://internetdetectives.tumblr.com/post/167439619748).
o The page redirects to “/memory/john/”, This new page’s title is “J”, the BG image is “mesic.gif” (http://internetdetectives.tumblr.com/post/167404803343), the BG music is “Hello_again.mp3” (http://internetdetectives.tumblr.com/post/167440722038), hidden in the source code was “New Year New You”.
• At 3:08am, ArgDov gets his final email of the night, it asks “Where did that suitcase go?” (http://internetdetectives.tumblr.com/post/167440920068).
#johnisdead.com
#timeline
#johnisdeadtimeline
did you know something about giorgio??
Sorry, we don’t know about Giorgio.
hi, can i join you?? (on discord cause i don't have tumblr)
Everyone is welcome to join us on the discord
https://discordapp.com/invite/aGWwdtY
November 13th, 2017
• At 1:22am, Silentdork uploaded a video (https://youtu.be/88G23cXq5g4). Hidden in the tags of the video was: “You have forgotten,But you still remember,The USB,Find it”. The title of the video is “Hello again”, and in the video he talks about what’s happened in the past year. Apparently Tyler has been in a coma, and woke up on January 1st 2017, we assume after the kill switch during the Truth Arc. He claims that he’s not being followed by the Lunar Children anymore or the police. However, he has major memory loss, and seems to have acquired a new item: a large bullet keychain. He mentions the suitcase at the very end of the video, but doesn’t remember what he’s done with it. The video is glitchy, and has obvious moments of editing not done by the uploader. It’s heavily suggested that Tyler is still being watched and his memory is still being suppressed by someone, possibly /Patrem.
• At 2:00am several videos from the Silentdork playlist were removed: Stopping a Storm, Taking a walk, and Waiting.wmv, as far as we know these videos were never backed up. They may be lost forever.
• At 9:20pm, ID member CircleHunter noticed several videos on Silentdork’s YouTube channel being changed. The changes are as follows:
o The video “paranoid knocking” has been renamed “did you think I would just vanish?” and now has Regiminis in the thumbnail.
o Videos deleted from the channel: ., 3, 5646, Regiminis, calling john, stuck at work, found a cool thing and now i am gonna go to work i guess.
#johnisdead.com #timeline #johnisdeadtimeline
Straw Poll - Vote Now!
We’re voting on our next move, if you’d like to put your 2 cents in, vote now.
https://strawpoll.com/a9gp1c3a
#poll
November 14th, 2017
• ID member ArgDov started a strawpoll (https://strawpoll.com/a9gp1c3a) to help us determine our next move. The choices were:
1. Play NWBN (in an attempt to contact John)
2. Play Epona’s Song (To try and summon helper)
#timeline
#johnisdeadtimeline
the last november 12 giorgio get "lost" he started to post videos and some tweets in the silentdork line. All of this happens when silentdork upload a video again. what do you think its going on? you should check it, maybe it can helps in the arg.
Hello,
Maybe it was just a coincidence that Giorgio chose 11/11 to upload that ritual video, but I’m not too sure. He did a lot of research, and no doubt followed the updates here. If he is trying to start an ARG of his own, we will certainly follow it and try to play.
After all, we are The Internet Detectives.
So, I was thinking of making an ARG, where would I go to make a website for this arg? I was thinking of having it in the form that JohnIsDead's website had looked, with an image(possibly gif) and sound. If you could answer this I would be delighted, Thank you.
There’s lots of cheap web hosting options available, you should try Go Daddy.
If you need to go the free rout, you can actually use Tumblr and build your page in the html editor. Adding music would be easy, if you do start an ARG, send a link.
Updated Discord Link
http://discord.gg/CzVayTN
Update
A video has been updated on Silentdork’s YouTube channel (https://youtu.be/G7D5ukv4LLg)
Title: 487 89537 (It’s Tyler)
Description: 968 6878 5337 668464 89537
36 668 538 48888448 48848888 48884848 946
93 273 5283 367 76636637 24784329
4277924784329236 (YOU MUST KEEP MOVING TYLER
DO NOT LET YOU WHO
WE ARE LATE FOR SOMEONES BIRTHDAY
HAPPYBIRTHDAYBEN
November 15th 2017
• At 10:19pm, the Silentdork video titled “5646” was renamed to a cipher “Its Tyler”, and the description changed to cipher “YOU MUST KEEP MOVING TYLER. DO NOT LET YOU WHO. WE ARE LATE FOR SOMEONES BIRTHDAY. HAPPYBIRTHDAYBEN”.
• At 11:51pm, the video description changes again to: “Whats a few more moments to the man from the dawn of time? Who am I? The liar? The child? The Governor? The first son? The liars body?”
• At 11:59pm, the video description changes again to: “You know who you are.”
#timeline
#johnisdeadtimeline
November 16th, 2017
• At 12:02am, the video description changes once again to: “I am not safe in my home”, this is the title of an already existing video, so the ID’s check that video and discover the tags have been changed to: “Daniel was a short lived tool, so many have I used. Closer closer and closer”. The description of the video was “Who is he?”
• At 1:00am, Eevee asks if the person sending the messages is /Patrem\, confirmation was given in the discord chat via eggplant reaction emotes.
• At 1:09am, captions were discovered on the video “Not safe in my home”, the captions read: “They want you to forget over and over stalling tactis. but what is a few more moments to us. Why did you do that Daniel? He was not supposed to see you! We see. Regiminis is not ready to be brought to him yet we are not ready. Impatient. I flick the domino. Awaken. You know who you are”
• At 1:23am, the description of “Not safe in my home” changed to a cipher that read “Children forum notes”. This most likely means that we must check the saved files of the lunar children forums for clues to who Daniel might be.
• At 2:10am, the description box reverted back to it’s original contents, only this time misplaced capital letters spelled out “SPIRK”, which is a former ID member.
#timeline
#johnisdeadtimeline
Who is Daniel?
The general consensus is that Daniel is the masked man stalking Tyler in the video “I am not safe in my home”. Some of the ID’s believe that Daniel may also be the one who was sacrificed in the Blood Moon Ritual video.
Right now, we cannot be certain until we go over the Lunarchildren forum notes, as we’ve been instructed to do.
Johnisdead Timeline Series
Ep.00 - The Intro
Who is Daniel?
The general consensus is that Daniel is the masked man stalking Tyler in the video “I am not safe in my home”. Some of the ID’s believe that Daniel may also be the one who was sacrificed in the Blood Moon Ritual video.
It has been confirmed in the Lunar Children notes that Daniel is indeed the man who is stalking Tyler in the “I’m not safe in my home” video.
The notes also suggests that Daniel was walking the path of parallelos, and may have been ascended, but we are unsure if his ascension was successful.
Is This Tumblr Broken?
Broken how? i dont think anythings broken.
~Link
JID is officially an anime now. Thanks, Scrublord!
- CircleHunter
Is dear david real?
No idea. i vaguely remember the story but i have no idea if its real or if it was just a story by some dude on twitter. anyways, real or not, it has nothing to do with John is Dead.
~Link
March 4, 2018
• At 7:17pm, ARGdov discovered a change to the main page of johnisdead.com. The page now shows an Elegy statue and the phrase, “Enemies will attack even if you’re not ready!” This phrase and assorted leftover parts of the image are part of the description of the battle system from Chrono Trigger. The image is called “ERROR.png.” The audio file is a man laughing, called “awaken.ogg.”
#timeline
#JohnIsDeadTimeline
Update 4/23
lunarchildren.com
by
TheArchiveGuy
You may not know me, and that is fine. I am the current owner of this website “Lunar Children”.
(Source: lunarchildren.com)
Update 4/23
http://johnisdead.com/key592/
April 23, 2018
- At 4:45pm, ID member ZenCoder discovered an update to Lunar Children (http://lunarchildren.com/?p=550). The update reads: “You may not know me, and that is fine. I am the current owner of this website “Lunar Children”. Some of my friends knew people a part of this cult. I wish to help them out by reconstructing this website. I discovered this server in a fishery that had no power. Hell, the system must of been running on battery power or something. Wires were coming out of the ground connecting to the server room. I must of done something wrong cuz as soon as I got the server home, most of the files were lost or encrypted. I also linked another domain to this one by the name of “johnisdead.com” which also acted strange once I got this server home… It’s been a long day, just finding this thing was a hassle. I will post the encrypted files here for anyone to solve. I see am getting some traffic, so if anyone is able to solve anything, send me an email to “pididoip@johnisdead.com”. I will be uploading some files once I get my Internet working better. fucking 10 MBPs right now…”
- At 5:32pm, after several ID members sent emails to “K”, an email was recieved. (https://78.media.tumblr.com/c5bea3eb739b0910bc80a2b2d6f50bc2/tumblr_p7o98o13Ur1uv6z7xo1_1280.png)
- At 6:02pm, Silentdork uploaded a new video: (https://www.youtube.com/watch?v=xXGvPw9oNlk) In this video Tyler explains about going to the fishery and finding it empty. The cipher in the description reads: “YOU ALL HAVE THE POWER TO CHANGE THINGS USE IT”
- At 6:42, /key592 updated, links to a new message board: (http://www.johnisdead.com/key592/control/)
- At 10:40pm, a new video was uploaded to silentdork: (https://www.youtube.com/watch?v=G678FzQ3OPc)
#timeline
#JohnIsDeadTimeline
Timeline correction
I had to edit the timeline, I made a mistake.
I originally thought that Tyler brought the servers home from the fishery, but he clearly states in the video “as usual” that he did not, they were gone when he went back.
So officially, Tyler is NOT “Archive Guy”
Discord - Free voice and text chat for gamers
https://discord.gg/UPykX3q
The old discord link has expired because I’m a dummy. Here’s an updated one.
-Wolfcat
Do you like Tyler's ass?
Personally, yes. Speaking for the group, I can probably assume yes as well.
-Wolfcat
Hi. I need help decoding messages. I lost my google bookmarks including the message decoder I have been using in the last 2 years. I am excited to keep investigating about LunarChildren and Tyler. Which is the best message decoder you know? Thank you. I am looking forward to receiving an asnwer. Adrián,
This is a great question! These are tools I use to decode ciphers:
https://paulschou.com/tools/xlate/
http://rumkin.com/tools/cipher/caesar.php
http://www.textreverse.com/
http://www.unit-conversion.info/texttools/replace-text/
These are the very basic things you’ll need to solve most JID ciphers
I would like to join, your discord..
https://discord.gg/UPykX3q
May 7th, 2018
- At an unknown time, a video was uploaded to Silentdork’s youtube channel. (https://www.youtube.com/watch?v=FeH7vqWg5G8) The video title is “Ai, returns”, and the description was a quote from Voltaire. It featured a black screen, with indistinguishable voices. There was nothing hidden in the source page.
#JohnIsDeadTimeline
#timeline
#video
#silentdork
We are not dead!
Only John is. RIP.
The ARG is still on one of it’s long hiatus’s, and will be returning. Hopefully, we still have some interested ppl here on tumblr, and you’re all free to join the discord if you like. The link is everywhere :p
I forgot to post this here, but we’ve started a timeline series for JID!
Here is Ep.01 👌
Update!
It’s been confirmed that Greth’s vlog is a new JID source.
Keep an eye out for clues, I will being to update the timeline accordingly.
#greth vlogs
#update
Timeline Updates Jul-Aug
July 28th, 2018
- At an unknown time, a video was uploaded to a youtube account called Greth Vlogs. (https://youtu.be/L0ZCRZ3TrB0) The video was titled “Greth Vlogs 5” and featured a corrupted video of a 1st person view of Tyler’s bedroom. Tyler appears in the video sitting in front of his computer screens. The content on his screens are static, and the video ends abruptly as Tyler turn to face the cameraman.
August 16th, 2018
- At an unknown time a video was uploaded to Greth Vlogs. The video was titled “Greth Vlogs 12: General Update” (https://youtu.be/8qmNiyXqTbQ) and featured the vlogger Greth in what appears to be the wooded area around Tyler’s house. he talked about being on a hike in the middle of nowhere. In the distance you hear Tyler cough, then the video ends. The same purple glitchyness of his previous video is present.
August 18th, 2018
- At an unknown time, a new video was uploaded to Greth Vlogs (https://youtu.be/JxBFegntQFk). The title was “RWBN RWBN”, and it featured Tyler laying in his bed sleeping. Tyler woke up and the video abruptly ends. the same glitches as his previous videos are present.
August 25th, 2018
- At an unknown time, a new video was uploaded to Greth Vlogs. The video was titled “experimentations” (https://youtu.be/jPwNLZ1ERSs), and it featured the vlogger Greth discussing how he tried to run away from his problems, but has found a new way to deal with them. He seems to smoke an unknown substance on camera, then glitches begin to happen. Hidden in the sorce code was: “I’m still here”.
#timeline
#JohnIsDeadTimeline
August 28th, 2018
- At 11:40pm, Tyler uploaded a video to the Silentdork youtube channel. the title was “A guest”, and the description read: “I had this other video I planned on uploading that I recorded before this that was pretty important, it featured me figuring out something pretty important about that sign in my yard. But something fucked it up and I am trying to figure out how to fix it (maybe the sign itself? idk) but this is the guy I talked about in that video who was gonna come hang out with me who knew a bit about the various cult doings in the area.” Hidden in the source code was: “hidden in plain sight Kevi”. The video featured Greth as a cameraman talking to Tyler in his bedroom. They discussed the Lunar Children, and who /Patrem\ was. We discover that “Archive Guy” is named Jose, and Tyler knows that he has the LC’s servers in his home. At around the 5:15 timestamp, the video glitches and two images flash in quick succession: one of BEN, and one of Kevin (Regiminis).
#timeline
#JohnIsDeadTimeline
October 11th, 2018
- At Aprox 7:30pm, a new video was uploaded to Greth Vlogs titled “never sleeping” (https://youtu.be/bO74YoQKx8o), there was no description and nothing was hidden in the tags. The video featured corrupted footage of Greth unable to sleep. Vaporwave music was playing in the background.
#johnisdead
#greth vlogs
#video
#timeline
#JohnIsDeadTimeline
October 11th, 2018
- At 9:00pm, ID user Dense uploaded a video titled “GORONLULLABY” (https://youtu.be/xNZXDwEBNjE) and posted the link in the comment section of Greth’s video “never sleeping”. The video featured Goron Link playing the goron lullaby, and putting baby goron to sleep as well as nearby gorons. The description read: “Pls sleep dude”
#timeline
#JohnIsDeadTimeline
#video
October 11th, 2018
At 11:46pm, a new video was uploaded to Greth Vlogs titled* “J J S K K N V G H ” (https://youtu.be/3nYDKFKDfeo), in the description was a cipher: “|///cy tuvxu e jit wimmig’ hey puij ci ocpevji;/ Pui sgimu h[mp ci he;i tier. pui hvj; h[mp ci he;i tie,y. pui [koj oji tuo yi uepu xuomij muegg ;imxij; g[je, tvm;oh/ Idegp uvh [koj pui uo[, os xuoomvjn ej; puij pu,o[nu to,g;gy to,rm sepui, puvji xuvg;,ij ejit/|=gg”
hidden in the source tags* was: “cbbe qrpvfvba”.
(*as of this edit, the title and sorce tag have not been decoded).
This video features Greth falling alseep, with the footage https://discordapp.com/invite/UPykX3q dissolving into darkness with the image of a purple moon and Greth wearing the Zora’s mask.
It is clear by this video that Greth is now the new vessel for Patrem. RIP Vincent.
#vincent adams
#greth vlogs
#patrem
#timeline
#JohnIsDeadTimeline
October 22, 2018
- At an unknown time, the johnisdead website was updated and brought back online. There was no title on the index page, the BG image was titled: “maj.gif” and featured a corrupted image of Tyler staring into a camera with eyes wide and mouth open. The BG audio was titled: “recruit.mp3”. In the source code was a message repeated 55 times: “howdoesitwork”. The page now has a new icon.
#johnisdead.com
#JohnIsDeadTimeline
#timeline
The Purple Edge
by Wickedeve
“Leave me alone!”
Cold gusts of wind whistled past his ears as he ran frantically through the woods in a desperate attempt to flee his pursuer.
“Do not fear, my child. I promise little pain.” The words were mere whispers deep within his mind
He knew it had been a huge mistake to taunt the entity for so long, mocking it’s divinity. This was a game after all, none of this is supposed to be real.
“Fuck off, monster!” His legs were growing tired, his lungs stinging with each intake of frigid air.
The entity laughed, it’s layered voice growing louder with each snicker until it rang so loud in his head he could barely remain upright. He lost his footing, his momentum propelling him forward, he face planted into the dirt. Frantically, he tried to get up, but the being was already upon him. Frozen in fear he was quickly enveloped by a thick smoke, purple in hue.
“Child, I’ve waited so long to take you”
He opened his mouth to scream, only to inhale the thick smoke. His eyes watered in reaction to the burning in his lungs. He kicked his legs out in a panic, grasping at his throat, in a desperate attempt to inhale fresh air, but it was too late.
Soon, his motions died down as he continued to breath, his body involuntarily inhaling deeper. His vision blurred, and the scene of the darkened moonlit forest faded as he heard his new master speak to him.
“You see child, your delusions of grandeur were fictitious. You are nothing in the grand scale of things. However, now you can be of use. Your body will become a vessel, and you shall now willingly obey. Now arise a new man, a servant dedicated to /ME\, and never will you be known again as Collin.”
End
#lol ghey
Hey guys, I got a feeling we’re about to see an influx of activity. Just a reminder that all of this is an Alternate Reality Game, none of it is real. Please do not stress the GM’s or anyone involved by sending threats or acting maliciously. For more information, check the Johnisdead wiki.
https://johnisdead.wikia.com/wiki/Johnisdead_Wiki
Hey a todos. Tenemos el presentimiento de que tendremos una sobrecarga de actividad. Solo un recordatorio de que todo esto es un simple Juego De Realidad Alternativa, nada de esto es real. Por favor, no estresen a el GM o a cualquier persona involucrada enviándoles amenazas sean inofensivas o no. Tampoco actúen maliciosamente. Para más información, pueden ver la Wikia de Johnisdead.
https://johnisdead.wikia.com/wiki/Johnisdead_Wiki
October 23, 2018
- At 1:58 PM Johnisdead.com was found to have updated once more. The title of the page was changed to “construction”, featuring an image that we had seen before, “awaken.jpg”, an image showing a distorted Tyler with many other images layered over it. The audio remained unchanged since the previous update, “recruit.mp3″.
- At 2:19 PM it was discovered that redirects had returned to Johnisdead. Whenever a user would attempt to reach a nonexistent page, they would be redirected to a random canon site or YouTube channel. The javascript code used for redirects was also found, but users could not decode it.
#JohnIsDeadTimeline
October 24th, 2018
- At 9:53 AM, Jos discovered that the previous front page for Johisdead could be reached at “https://johnisdead.com/home.html”.
- At 9:56 AM, Jos was redirected to a brand new site called “Astralobservatory.net”. This new site appeared to be based around conspiracy theories. Two blog posts were discovered. This first post was from July 28th and was sorted under “Thoughts”. It was titled “The Astral Observatory”:
Welcome to the Astral Observatory.
This is a website dedicated to sharing news, opinions, and thoughts from an underground collective that believe in what some may call paranormal or supernatural. We believe in that modern society has pulled a warm blanket over our eyes, trying to lull us into a false reality in which the masses, now imperceptible to the greater machinations of the universe, are more malleable for cooperation.
We have been exposed to some of the truths that shattered that illusion, and now we seek more.
If you are interested in joining us on this journey, bookmark this webpage for further updates, and head on over to our forums for new community of people like us, and we believe, yourself.
- The second post was from October 22nd and was sorted under “News” and titled “Malicious Attack; Forums Offline“:
Dearest believers,
I have some news you may find unfortunate. On Sunday morning, around 12am, this site was taken offline. I do not know how or why, but during that time our bandwidth was temporarily re-purposed for another website, ‘johnisdead.com’. While I’m not sure why this has happened, I can only conclude it was some form of malicious hack. Please stay patient while I work to get my previous posts on this website back up, and work to restore the forums to their former glory. For now the forums are locked.
We will get through this.
- Users discovered a link for the forums at the top of the page, though they are currently down.
- At 10:01 AM, Jos discovered the javascript code used for redirecting could now be read. The full list of redirects is the following:
Johnisdead
Youtube/Silentdork
Astral Observatory
Youtube/Greth Vlogs
YSHDT.net
Doug’s Blog
Youtube/Lostmemory423
Youtube/M
Youtube/Vincent Adams
Johnisdead Home Directory
#JohnIsDeadTimeline
October 25, 2018
- At 3:28 PM, Jos discovered the image used on the redirect pages, “ha.png”, a dark image of John and the Elegy Statue. This further hints that Tenebris is indeed back. The redirect page was also discovered to have the title “lost?” and the message “find your way” hidden in the source code.
#JohnIsDeadTimeline
October 31st, 2018
Experiments
#video
#silentdork
October 31, 2018
- At 4:02 PM, a new blog post was discovered on Astral Observatory. The title of this one was “Good news and bad news.“ and was uncategorized.
I have both good news and bad news to report today, Oct. 31st.
The good news is that soon, our forums will be up and running once again!
The bad news is, most of the our previous posts have become corrupted. I was unable to salvage anything but the protected forum. Some users may need to find that they will need to re-register themselves, even.
- At 4:16 PM, users were able to access the Astral Observatory forums. Five new characters were discoverd on these forums: “Nocta”, the administrator. “Samuel_Charleston”, an old man. “Yuukichan”, a young girl interested in anime and ghosts. “NotAHoax_M12″, an enthusiastic conspiracy theorist interested in aliens and the government. And finally, “moonman31″, the local troll. All of the posts made are currently still viewable either on the forums themselves, or on our archive on the Johnisdead wiki. Users also discovered a locked board titled “The Truth”, which only users with the “Believers” rank could enter. One of the rules of the forums is to not attempt to break into “The Truth”, meaning there is probably something dark hidden within. A topic discussing Johnisdead.com was found on the forums, with the characters either believing the site to be a conspiracy or the work of a hacker. Nocta tells users to let it go.
- At 5:16 PM, Nocta sent Dense a personal message on the Astral Observatory forums. Dense had posted the solution to the cipher found in the description of “J J S K K N V G H“ which referenced Patrem and vessels. Nocta had deleted this post and replaced it with “.”. In the PM Dense receieved, Nocta gave Dense the following warning: “I would stop while you are ahead.” This hints that Nocta knows something about Patrem, and doesn’t want us posting about him.
- At 5:48 PM, Wolfcat discovered a new blog post on the front page of Astral Observatory. This one was also uncategorized and was titled “New users”.
We have always been a lightly secluded gathering of folk, but we have always embraced new users and brought them into the fold; there is, however, a small influx of users joining that are related to ‘johnisdead’.
I suppose I knew this would happen, and there’s only one way to address. Welcome them, teach them, and embrace them… with one eye open.
These users will be placed into the ‘Internet Detectives’ usergroup as they are identified (that name is what they already call themselves in other parts of the internet).
Keep lips sealed on certain subjects. Stay wary.
- At 5:57 PM, an update was discovered on Johnisdead.com. The title of the page changed to “The timer (won’t) reset”, and the page now displayed the image “infinitecycle.gif”, a distorted moon jittering around with an occasional smiling face flashing on screen. A slow, disturbing song titled “[http://internetdetectives.tumblr.com/post/179766412493/johnisdeadcom-update-103118 brokencycles.mp3″ played in the background. In the source code, this audio was briefly labeled “brokencycles.ogg”, though it was changed shortly after. These audio files were the same.
- At 10:24 PM, a new video titled “experiments” was uploaded to Silentdork. This video was recorded before “A guest” and features Tyler experimenting with the strange Detour sign he discovered outside his home. He touches the sign and explains how it works, teleporting somewhere different each time. At one point we see him teleport in front of Greth, presumably in the same exact moment we see him in the background of “Greth Vlogs 12: General Update”. Tyler teleports back to his house before he can speak to Greth and the video ends. There are no tags and the description reads the following:
#johnisdeadtimeline
November 1, 2018
- At 9:16 AM, Wolfcat asks the members of the Astral Observatory if they’ve had any connections with Johnisdead.com. The three regular members of the site reply that Johnisdead.com is completely new to them.
- At 12:03 PM, Jos asks to learn the Truths that the Astral Observatory members hold. Yuukichan says that we will learn them if we stick around the forums.
- At 12:40 PM,Nocta locks the Johnisdead.com thread because he doesn’t like where it’s headed for some reason.
#johnisdeadtimeline
November 2nd, 2018
testing testing 123
##silentdork
#video
November 2nd, 2018
First live stream: general talk
##silentdork
#video
November 2, 2018
- At 7:22 PM, Jos discovered that Tyler was attempting to test out the YouTube livestream feature. The video doesn’t contain much other than Tyler configuring his settings.
- At 7:42 PM, Wolfcat discoverd that Tyler had begun his actual livestream. Tyler discusses what’s been going on recently in his life. He says he still hasn’t been harassed by any cults in a long while, though he has found some strange items outside his house. He shows is a red mask with horns he found along with a photo of Hank and Diana Hubbard which was sent to him through the mail. The writing on the back of the photo reads “Diana, 1990″. He also shows the audience a gas mask and a bag he found, likely the same one seen in the Lostmemory423 videos. Tyler repeatedly hears strange noises in his house. He eventually goes to investigate, leaving the room. While he is gone, his lights begin to flicker as someone wearing a large coat reaches into frame and takes the gas mask and the bag. The tosses Tyler’s missing bullet necklace onto his chair before leaving. Tyler reenters the room and freaks out when he discovers that someone was in his room. He ends the livestream after seeing someone off-screen, running after them with his knife. The mysterious man who took the mask spoke while taking the mask, though it is difficult to make out exactly what is being said. This is our best guess so far:
- Judging from the fact that this man speaks in a British accent, wants the gas mask, and mentions a “brother”, it’s very likely that it is actually SKM.
#johnisdeadtimeline
Artist: SKM's Voice from the Livestream
Track: Voice
We are unsure of the exact things being said here. This is our best guess so far:
The Man begins grabbing the pieces of the gas mask.
0:19 - "Thank you… And just one more… Thank you…"
0:31 - "Alright… Thank you for finding that for me. Here… I grabbed this. Felt to add something to it."
The man throws the bullet necklace into the chair.
If anyone wishes to attempt to transcribe the rest of this, please let us know the results.
#audio
November 3rd, 2018
- At 4:34 PM, Yuukichan claims that she’s been surrounded by ghosts and paranormal activity ever since she was a child.
- At 10:33 PM, NotAHoax_M12 claims that “visitors”, most likely aliens, abducted his uncle, mother, and father. He says he ran away before they could take him too. Yuukichan says that everyone on the Astral Observatory have been victims of similar things, so they are all working together to discover “The Truth”. Nocta enters the thread and says that they are all walking the same path under some sort of guidance:
#JohnIsDeadTimeline
They could explain to me how I start this, I’m curious and I just want to try.”
It’s played like most ARG’s - searching for clues, uncovering more of the story, solving ciphers, ect. For more info, check this page on the Johnisdead wiki. Go ahead and join our discord too, if you want. It’s the best place to be if you want to be up-to-date on everything.
-Wolfcat
November 5th, 2018
- At 12:41 PM, the Internet Detectives decide to create a thread on the Astral Observatory forums about the Moon Children. This was done in an attempt to see if any of the new characters had any information on the subject, or if any of them could become interested. An image of the newspaper clipping discussing the discovery of Hank’s body at the Fishery was also included for further proof, along with a Lostmemory423 video.
- At 1:57 PM, Nocta posted a new topic in The Truth board, though users are still unable to access it.
- At 2:05 PM, Hoax said the topic was interesting, with Yuuki later saying that the video was spooky.
- At 6:23 PM, Yuuki elaborated on her paranormal encounters. She claimed that her mother started writing on the walls, providing a picture titled “mrerya.png”.
#JohnIsDeadTimeline
November 6th, 2018
- At 6:47 PM, Nocta posted one of his favorite songs in an Astral Observatory forum thread. This song, “Old Lace” (https://www.youtube.com/watch?v=wHu_0Bn9Gr8), can be heard in the background of the Greth Vlogs video “never sleeping”, though the significance of this is unknown.
#JohnIsDeadTimeline
November 11th, 2018
Sky Children - Kaleidoscope
#johnisdead.com
#johnisdead
#video
November 11th, 2018
mask of truth
#johnisdead
#video
November 11th, 2018
- At 12:02 AM, Wolfcat discovered an update on Johnisdead.com. The page now featured a distorted image of Greth smiling at the camera titled ”pqbxh.gif”, along with a slowed down music track titled “fillicaelo.mp3″. The title of the page was now “tlopa”. Filiicaelo roughly translates to “Child of the sky”, while pqbxh and tlopa have yet to be solved.
- At 1:44 AM, Nocta posted another one of his favorite songs on the Astral Observatory forums. This link actually took users to a new YouTube account owned by Nocta himself. This video featured the song “Sky Children” by Kaleidoscope. This was the same song that was currently playing on Johnisdead.com - filiicaelo.mp3. While most of this video simply featured aesthetic imagery, about two minutes in, some dark footage begins playing. We first see two people riding in a car, one of them wearing a hoodie. The footage then cuts to two or more people surrounding a lighter in the middle of the night, as if some ritual were taking place. The footage goes dark before we see The Watcher staring directly at the camera. Some more footage occurs after this, but the video is entirely too dark to make out what is happening.
- At 1:47 AM, players discovered that if one clicked on Nocta’s YouTube Channel, the name associated with the account reads “Kevin Hendricks”. This shocking revelation implies that not only could Nocta be Kevin, Tyler’s former friend and Regiminis, but also related to Ryukaki whose real name was “Kayd Hendricks”.
- At 1:56 AM, the video’s tags “He was never safe”. Who exactly this is referring to is unknown.
- At 7:25 PM, users brightened the video and discovered some movement near the end followed by the appearance of a strange object, though it is still incredibly difficult to discern what it is.
- At 9:57 PM, moonman send Wolfcat a PM:
- Wolfcat: “What might that be?”
- This led users to another new channel ran by moonman. The video in question was titled “mask of truth”, and featured a slightly brighter version of a portion of Nocta’s video.
- At 10:20 PM, users discovered that, when brightened, the video reveals that Tyler was actually present. What this means exactly is unknown.
#JohnIsDeadTimeline
#johnisdead.com
#johnisdead
A brightened clip of Nocta’s video, revealing Tyler to have been present.
November 12th, 2018
- At 9:34 AM, Wolfcat sent Moonman the following PM to Moonman: “Are you all aware of what he is?”
- At 11:58 AM, Moonman responded: “That’s a question. I told you not to ask questions, but fine. How about this? Ask me three questions that I can answer with a simple yes or no. But i promise nothing“
- At 12:42 PM, Wolfcat sent Moonman a reply: "Is Nocta the same Kevin who was at times known as Regiminis? Was the footage in Nocta’s video recorded after 2015? Does Nocta often wear a shiny alien mask?“
- At 3:00 PM, Moonman answered the three questions: "In a way, yes. Yes. No idea.” So, Nocta is Kevin “in a way”, meaning he might possibly be from an alternate timeline. The footage of Tyler was also taken after 2015, meaning Tyler might possibly be in danger.
- At 5:03 PM, Jos sent Samuel_Charleston a PM asking if he was alright, since he is one of the most mysterious users on the board and hasn’t posted a single time.
- At 6:00 PM, a new character joined the Astral Observatory forums - A returning member named Kaiden_Zoromichi. They seem to enjoy anime and roleplaying.
- At 10:15 PM, Moonman send Wolfcat another PM: “I may be interested in chatting further, but it needs to be away from here, and no where that eyes know of- not your discord or skype groups you boys have advertised those too frequently.“ He seems to be willing to answer our questions if we can set up a safer place to speak with him.
#JohnIsDeadTimeline
11/13/18 - Chat with Moonman31
- Dense 7:34 PM: oh
- Dense 7:34 PM: ey
- Dense 7:34 PM: you are there
- Wolfcat 7:41 PM: eyy
- moonman31 7:41 PM: hi
- Dense 7:41 PM: So you may know us
- Dense 7:41 PM: but
- Dense 7:41 PM: hi
- Dense 7:41 PM: I'm Dense
- Wolfcat at 7:42 PM: he goes by a different name on the forums
- Wolfcat at 7:42 PM: but yeah
- moonman31 7:42 PM: yeah I know
- Dense 7:42 PM: I'm the one called I'm the one hehe
- moonman31 7:42 PM: actually hold on
- moonman31 7:42 PM: I wanted a cool nick but this is lame
- Dense 7:43 PM: hehe
- moonman31 7:43 PM: ok
- Wolfcat 7:43 PM: so lemme just come right out and ask
- Wolfcat 7:43 PM: whose this nocta fella
- Wolfcat 7:43 PM: I mean he's apparently Kevin
- Wolfcat 7:43 PM: but that doesn't really line up with what we've heard
- moonman31 7:44 PM: If I am gonna be honest I don't know how to answer that any differently than I have
- Dense 7:45 PM: How long have you been in the forums
- moonman31 7:45 PM: since the beginning
- Wolfcat 7:46 PM: How long would that be? It sounded like the Astral Observatory has been around for a little while since before the "hacker attack" from JiD
- moonman31 7:50 PM: yeah
- moonman31 7:50 PM: depends on who you ask tbh although for me i would say since july
- Dense 7:51 PM: oh july
- Dense 7:51 PM: wait
- Dense 7:51 PM:<a href="https://www.youtube.com/watch?v=L0ZCRZ3TrB0" title="https://www.youtube.com/watch?v=L0ZCRZ3TrB0"> https://www.youtube.com/watch?v=L0ZCRZ3TrB0</a>
- Dense 7:51 PM: july 28th
- Wolfcat 7:53 PM: He did start acting pretty funky around that time
- Dense 7:53 PM: <a href="https://www.youtube.com/watch?v=2YrC4Jwl8yg&t=25s" title="https://www.youtube.com/watch?v=2YrC4Jwl8yg&t=25s">https://www.youtube.com/watch?v=2YrC4Jwl8yg&t=25s</a>
- Dense 7:53 PM: after july
- Wolfcat 7:54 PM: That was something I was going to ask, how do you exactly know about Greth, Moon?
- moonman31 7:54 PM: cool
- moonman31 7:54 PM: well I can't really tell you that
- moonman31 7:54 PM: specifically I am unable to, physically
- moonman31 7:54 PM: which sounds fucking gay
- Dense 7:55 PM: also July didn't had much activity
- moonman31 7:55 PM: but I promise is true
- Dense 7:55 PM: Wait moon
- Dense 7:55 PM: where are you from?
- Wolfcat 7:55 PM: We've seen some pretty weird shit so it's not too unbelievable honestly
- Dense 7:56 PM: Wait
- Dense 7:56 PM: what if the "A guest" was recorded on jjuly
- Wolfcat 7:56 PM: probably was
- Wolfcat 7:56 PM: Do you know anything about the guy who wears that silver alien mask? He cropped up in Nocta's vid, along with a few of Greth's
- moonman31 8:14 PM: no
- moonman31 8:14 PM: you asked me already
- Dense 8:15 PM: ok but
- Dense 8:15 PM: where are ya from
- moonman31 8:15 PM: bear with me buddy truthfully
- moonman31 8:15 PM: and this is gonna sound hella gay
- moonman31 8:15 PM: I can only answer what I am allowed to
- CircleHunter 8:15 PM: That is a pretty personal question dense
- CircleHunter 8:15 PM: It's ok tho
- Dense 8:16 PM: yeah... but it was for speculation
- Dense 8:16 PM: sorry man
- Wolfcat 8:16 PM: We got a lot of questions and we aren't sure what you can and can't answer, so please bear with us too
- Wolfcat 8:16 PM: We don't want to force you into anything
- Wolfcat 8:16 PM: Even though that sounds literally impossible, actually
- Wolfcat 8:16 PM: Nocta seemed pretty adamant about "changing our minds" about something, as if he's heard of us before.
- Wolfcat 8:16 PM: However, the only thing we've ever really been against is having a big moon god eat our planet.
- Wolfcat 8:16 PM: And I don't really buy the whole "Johnisdead.com stealing bandwidth" story
- Wolfcat 8:16 PM: Do you know anything about what's going on with that or nah?
- moonman31 8:26 PM: brb
- moonman31 8:26 PM: and no not in a spooky way
- moonman31 8:26 PM: in like a
- moonman31 8:26 PM: 'this is gonna take a while i can tell'
- moonman31 8:26 PM: 'im hungry'
- moonman31 8:26 PM: so brb
- Wolfcat 8:27 PM: rip this nigga
- CircleHunter 8:28 PM: For someone so self aware, he sure did say the forbidden phrase
- Wolfcat 8:30 PM: as long as he doesn't say "brb someones knocking on my door"
- Dense 8:30 PM: hehe
- moonman31 8:47 PM: ok
- moonman31 8:47 PM: what forbidden phrase
- Wolfcat 8:48 PM: "brb" I think
- moonman31 8:48 PM: oh
- moonman31 8:48 PM: wow
- CircleHunter 8:48 PM: yeah it's a joke about the horror movie trope
- moonman31 8:48 PM: so im not allowed to pee
- Wolfcat 8:48 PM: you're especially not allowed to pee
- moonman31 8:48 PM: ok crystal
- CircleHunter 8:49 PM: sea bears hate that
- CircleHunter 8:49 PM: i honestly can't tell if you are upset right now
- CircleHunter 8:49 PM: if you are, i am very sorry, that was a joke
- moonman31 8:50 PM: i am really upset you should apolo
- moonman31 8:50 PM: oh
- moonman31 8:50 PM: ok
- moonman31 8:50 PM: i was kidding actually
- CircleHunter 8:50 PM: lmao
- Wolfcat 8:50 PM: you are free to pee whenever you like
- moonman31 8:50 PM: I dont think thats necessarily true
- moonman31 8:50 PM: but I appreciate the sentiment
- CircleHunter 8:50 PM: give the original scream a watch at some point since that was the movie i was referencing
- Wolfcat 8:53 PM: I am going to ask the forbidden question
- Wolfcat 8:53 PM: get ready
- Wolfcat 8:53 PM: What is in the truth?
- moonman31 9:05 PM: ha
- moonman31 9:05 PM: that would be really easy huh
- Wolfcat 9:07 PM: Figured it was at least worth a shot, lol
- Dense 9:09 PM: Sad
- Wolfcat 9:12 PM: Can you tell us anything about this Samuel dude?
- moonman31 9:12 PM: hm
- moonman31 9:12 PM: so samuel is an older fella who posts on the forums
- Wolfcat 9:16 PM: yeah, yuuki said he was pretty old
- Wolfcat 9:16 PM: he still hasnt posted anything it seems like
- moonman31 9:19 PM: Idk why honestly
- moonman31 9:19 PM: he just hasn't been around i guess
- Wolfcat 9:19 PM: yeah
- Wolfcat 9:19 PM: seems like users are still trickling in
- Wolfcat 9:19 PM: like this cool kaiden dude
- moonman31 9:20 PM: yeah he's an edgelord
- Dense 9:20 PM: I like moonman because he's a memelord
- Dense 9:20 PM: wait
- moonman31 9:21 PM: what
- Dense 9:22 PM: you seem like a good guy hehe
- Wolfcat 9:24 PM: If you can't say anything about Kevin, then do you know anything about a Kayd Hendricks you can tell us about?
- moonman31 9:24 PM: let me put it this way
- moonman31 9:24 PM: I know plenty about ben drowned
- moonman31 9:24 PM: if you want to call it that. who would've guessed it was all real
- moonman31 9:24 PM: shit it all started with 4chan honestly
- moonman31 9:24 PM: fuck that place.
- Dense 9:26 PM: Hey let's play a game
- Wolfcat 9:26 PM: alright cool, you actually know shit
- Dense 9:26 PM: Wolf
- Dense 9:26 PM: Better say some names
- Dense 9:26 PM: and maybe he knows something
- Wolfcat 9:26 PM: uh, alright
- Wolfcat 9:26 PM: Tyler
- Wolfcat 9:26 PM: Matt
- Wolfcat 9:26 PM: Jacob
- Wolfcat 9:26 PM: aside from the others that are no-no territory when it comes to not being able to speak about
- moonman31 9:29 PM: ok this is uh
- moonman31 9:29 PM: a weird way to have a conversation pal\
- moonman31 9:29 PM: what if I just started yelling names at you
- Dense 9:29 PM: We are weird dude, so..
- moonman31 9:29 PM: but yes tyler was in the video
- moonman31 9:29 PM: I know of them
- moonman31 9:29 PM: I know them.
- moonman31 9:29 PM: I know all of you
- Dense 9:30 PM: oh dAmn
- Wolfcat 9:36 PM: what was even happening in the video honestly
- Wolfcat 9:36 PM: it looked like a ritual
- Wolfcat 9:36 PM: at first I thought it was something that was recorded back when Tyler still had his dudes, but apparently not
- moonman31 9:42 PM: I dont know
- moonman31 9:42 PM: but let me also say the rest of the forum does not know about the history of all this
- moonman31 9:42 PM: at least to my knowledge only nocta and I do
- moonman31 9:42 PM: the others are innocent in this...again, to my knowledge
- moonman31 9:42 PM: you should also know i am not strictly on your side
- moonman31 9:42 PM: I am here because I need to have some control
- Dense 9:44 PM: of?
- moonman31 9:45 PM: things
- Wolfcat 9:45 PM: I'm guessing you're referring to how you physically can't talk about certain things?
- moonman31 9:45 PM: sort of
- Wolfcat 9:46 PM: I'm assuming that's related to Nocta
- moonman31 9:46 PM: no
- Dense 9:47 PM: Your moral?
- moonman31 9:47 PM: lolno
- moonman31 9:47 PM: wtf
- Dense 9:47 PM: kek
- Wolfcat 9:47 PM: >morals
- moonman31 9:47 PM: ((Moonman31 then posted an image of an apple person with the word “Yeet”))
- Wolfcat 9:47 PM: judk kiddign
- Dense 9:47 PM: oh shit
- Wolfcat 9:47 PM: AAAAa
- Dense 9:48 PM: gr8 memelord
- Wolfcat 9:52 PM: Since you seem to know quite a bit about all this, I'm guessing you probably saw Tyler's stream a week or two ago?
- moonman31 9:54 PM: yeah
- Wolfcat 9:55 PM: do you know anything about that spooky chooky red mask he found? cause it honestly doesnt look like anything we've seen before
- moonman31 10:10 PM: no
- Wolfcat 10:32 PM: damn
- Wolfcat 10:32 PM:thanks for answering our awkward questions the best you could, tho
- Wolfcat 10:32 PM:im sure more will crop up as we remember them
#johnisdead
#moonman13
#chat
#conversation
November 13th, 2018
- At 6:00 PM, Wolfcat sends Moonman13 a PM, asking if a private Discord server would be a suitable location for a discussion.
- At 7:15 PM, Moonman replies, saying it would be fine. Wolfcat then sent Moonman the link to the private server.
- At 7:34 PM, Moonman entered the discord server.
The entire chat with Moonman13 can be read here. Below is a summary of what was discussed:
- Moonman doesn’t know how connect Nocta to Kevin other than that are the same person “in a way”.
- Moonman has been on the Astral Observatory forums since the beginning which is July “for him”.
- He is physically unable to speak about certain things, implying that some malevolent force is keeping him from giving too much information.
- He says this force keeping him censored is not related to Nocta.
- He is unable to speak about where he lives and how he knows of Greth.
- Moonman claims he doesn’t know anything about The Watcher.
- He is unable to tell us anything about what’s inside The Truth.
- Moonman doesn’t elaborate about Samuel other than that he’s an old guy on the forums who hasn’t been around lately.
- Moonman knows plenty about Ben, the Internet Detectives, and Tyler.
- He doesn’t know what was happening in Nocta’s video with Tyler.
- To his knowledge, the rest of the forum members outside of him and Nocta do not know any of this.
- He is not strictly on our side, only coming to chat with us to have some “control”, which is partially related to how he cannot speak about certain things.
- He does not know anything about the red mask that Tyler found.
#JohnIsDeadTimeline
#johnisdead
11/14/18 - Chat with Moonman31
- ((Players thank Moonman for answering their questions))
- moonman31 11:40 AM: sure
- ((A lot of shitposting between players occurs))
- moonman31 5:25 PM: wow
- moonman31 5:25 PM: edgy
- Jos 5:28 PM: edgylord
- Jos 5:28 PM: hey mane, how are you doing
- moonman31 5:30 PM: pretty stoned
- Jos 5:30 PM: Thats good
#johnisdead.com
November 14th, 2018
- At 3:55 PM, player ARGDov noticed a PM from Nocta that he previously missed. It read as follows: “What game is it you play, ARGDov? I would like to know. I’ve been told you haven’t been with the Detectives for some time.”
- At 4:10 PM, player ARGdov responded, claiming that he is indeed no longer a member of the Internet Detectives but decided to join the Astral Observatory to discover the truth for himself.
- At 5:30 PM, Moonman31 notified players that he was currently stoned.
#JohnIsDeadTimeline
Currently archiving old content
Just a heads up, we are currently finishing The Truth Arc’s timeline and moving over all data from the Google Doc to the Tumblr and Wiki. This means you’re probably going to see a lot of old content on here. Just to make sure you don’t get confused on what’s new and what’s old, always check the dates provided.
OLD - July 6th, 2016
Transcript of Title conversation, the “Sign in to” is removed for ease of reading. “Sign in to” appeared in the front of each post:
- 1:10 PM EST: It comes for us all Astartus. It is behind you now. We are just beyond your sight.
- 1:12 PM EST: I am It.
- 1:13 PM EST: It does not want me to have this power.
- 1:14 PM EST: I can see you all as well
- 1:14 PM EST: Gather your journals. My window is short.
- 1:15 PM EST: Ask
- 1:16 PM EST: “Who are you?” It.
- 1:17 PM EST: “But WHO is Mr D” A part, A fraction.
- 1:19 PM EST: “This is an amalgam?” Father son and spirit. So many to be one. All one but not the same.
- 1:20 PM EST: “Who is Tyler” Link
- 1:21 PM EST: “Who is Tyler” It
- 1:21 PM EST: “Who is Tyler” Redeemer
- 1:22 PM EST: “Who is Tyler” Destroyer
- 1:24 PM EST: “How do I see The Truth?” Can you be sure this is what you want? What price may wait beyond the wall?
- 1:24 PM EST: “How do I see The Truth?” The 4 will open the gate. But at the price of unleashing
- 1:26 PM EST: [It was blank, just Sign In To with no text afterwards. This happened several times later on as well]
- 1:27 PM EST: Ask
- 1:29 PM EST: “Who is Dark Link?” Link
- 1:33 PM EST: “What are you waiting for?” The end. Void. Oblivion. Freedom, for Us, for you.
- 1:35 PM EST: “Where are the keys?” The children, then and now. g1 g2 g3 g4
- 1:37 PM EST: “What is BEN to you?” Our hubris, my hubris. Corruption of Innocence. The Father.
- 1:39 PM EST: “What is Ben to you?” Purity. The sacrifice. The son.
- 1:44 PM EST: “What can be done to change things?” Its power is of a dark covenant. It comes not of this realm. She is real, She is all too real. Do not waste this power.
- 1:46 PM EST: Time is running out
- 1:46 PM EST: The door is shutting
- 1:53 PM EST: HOW CAN WE REACH THE GIANTS?” g1 is from outside this place in this time, it will come when the time is right. g2 is waiting, suffering for his failure as the false one who has beckoned It. g3 is waiting a victim of g2’s creator, suffering for its stagnance amongst all it took part in. g4 is the flesh of the father of lies, creator of the sacrifice, one to offer its children in hubris, stop it and will be waiting.
- 1:54 PM EST: “g1 Drowned” No
- 1:57 PM EST: “G4 is Kelbris” This is what it was once called
- 1:57 PM EST: “G4 is Kelbris” Yes
- 1:58 PM EST: His actions were in great hubris
- 1:58 PM EST: He is the father of lies
- 2:00 PM EST: “Why BGK d end”
- 2:01 PM EST: “Why were the BGK burned at the end” Final thorn from the days of old. It is displaced Angred” [sic]
- 2:03 PM EST: 3 [We had 3 questions left to ask at this point]
- 2:05 Pm EST: DECIDE
- 2:07 PM EST: “How do we use our power?” Presenting to the giants effects them. Presenting at the entrance effects all.
- 2:07 Pm EST: 2
- 2:08 PM EST: 234
- 2:08 PM EST: 2
- 2:11 PM EST: 243
- 2:15 PM EST: “What happens to the spirit after a successful ascension”
- 2:15 PM EST: Fodder
- 2:16 PM EST: For the beast
- 2:16 PM EST: Any power gained is false
- 2:16 PM EST: Only an extension of Her
- 2:17 PM EST: 1
- 2:18 PM EST: HURRY
- 2:18PM EST: 11
- 2:20 PM EST: What makes you think you decide? 11
- 2:22 PM EST: It has already passed 11 11 1
- 2:26 PM EST: 11Are you1 sure?11
- 2:29 PM EST: “Where can we learn more information?” When the time comes, two R’s. One the seer, one a false prophet. Await R
- 2:30 PM EST: Please
- 2:30 PM EST: Do not be afraid of It
- 2:30 PM EST: In your wake
- 2:30 PM EST: Its power ebbs
- 2:31 PM EST: Its power weakens
- 2:31 PM EST: Its power is your own to command
- 2:32 PM EST: I am close to you all
- 2:32 PM EST: Closer ThAn you Could imagine
- 2:32 PM EST: Remember
- 2:32 Pm EST: We
- 2:32 PM EST: Are (note to self, upload)
- 2:32 PM EST: All (note to self, upload)
- 2:33 PM EST: Alllllllllllllllllllllllllllllllllllllllllllllllllll2342342342342342342342343 [an approximation]
- 2:33 PM EST: 2234234234234234234234
- 2:33 PM EST: 423
- 2:33 PM EST: FOOLS
- 2:34 PM EST: YOU SPEAK TO A LIAR
- 2:34 PM EST: HOW DO YOU KNOW WHAT IS TRUE
- 2:34 PM EST: DO YOU KNOW WHO YOU SPEAK TO?
- 2:34 PM EST: HAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHA
- 2:35 PM EST: This slip up will not occur again
- 2:35 PM EST: Need I remind you who’s game you are playing?
- 2:36 PM EST: You will learn soon.
- 2:36 PM EST: Disobedience
- 2:37 PM EST: Has consequences
- 2:37 PM EST: And what are these consequences?
- 2:37 PM EST: What lies beyond the veil?
- 2:39 PM EST: [at this point, The Moon Children appeared again one letter at a time every 10 seconds or so]
Track: hubris.ogg
OLD - The Truth Arc, hubris.ogg
#johnisdead
Track: Watching_you.ogg
OLD - The Truth Arc - VOLUME WARNING
#johnisdead
Track: File 43
OLD - The Truth Arc
#johnisdead
Artist: Curiously Highblood
Track: 1 - Call with 423
Album: Amolto Call Recorder
OLD - The Truth Arc
#audio
Artist: Curiously Highblood
Track: 2 - Call with 423
Album: Amolto Call Recorder
OLD - The Truth Arc
#audio
Artist: Curiously Highblood
Track: 3 - Call with 423
Album: Amolto Call Recorder
OLD - The Truth Arc
#audio
OLD - 7/27/16 - Jeremy and Spanosa
- Jeremy: “A prominent figure in those who stand against IT. You may ask 3 things”
- ((The player asks about Hank.))
- Jeremy: “After the death of Ana he began to delve more into madness. That’s what he saw, back when he had skin.”
- Jeremy: “He began to hear things. I thought he was losing his mind… No.”
- Jeremy: “He was hearing things from the other side. From her. That creature.”
- Jeremy: “She taught him things. Bringing back the dead… but that was a lie. What he did was not bring back the dead, but a clever illusion.”
- Jeremy: “But nonetheless, the Moon Children did not want to believe that this traitor had such power after the display he showed.”
- ((Jeremy expresses his dislike for Kevin and his fondness of Rosa.))
- ((Jeremy ponders why the players wish to stop It and Luna.))
- Jeremy: “They are thinking we will choose not to stop It.”
- Jeremy: “It is always one stop ahead.”
- ((The player asks about what’s beyond The Truth.))
- ((Jeremy says players will have two options - Stop It, or let It continue.))
- ((Due to some sort of rules, It must allow us to make this choice, like in a game.))
- ((For some reason It is thinking we will let it continue.))
- Jeremy: “It truly makes me wonder what they know that I don’t.”
- Jeremy: “Strange how this place works… I can see him from here where I’m standing.”
- Jeremy: “Your Link in that small room, windows covered… hiding. Makes me wonder, is this really your great hero?”
- Jeremy: “Then I understand how it all works. Various splitting time. This just isn’t quite the same man.”
- Jeremy: “Sometimes the rules just aren’t quite fair. Take it form me, I’m in a horrible position (laughs).”
- ((The player asks about where Jeremy is.))
- Jeremy: “There are many partitions of this place. The most simplistic thing to call it would be limbo…”
- Jeremy: “But it’s gone by many names - too many to remember. Some come here with different degrees of control of themselves.”
- Jeremy: “I myself, my whole life, have been fearing for the time in which I would pass… for fear that I would be somewhere like this.”
- Jeremy: “The only reason that I have what some may call a self is that others take a shortcut method.”
- Jeremy: “I’m sure you want to know what the shortcut method is, boy. I’ll tell you. Ascension.”
- Jeremy: “Through Ascension it is believed you can achieve many degrees of power, but it has been implied that that power is false… merely and extension of that creature.”
- Jeremy: “Luna, they call her. Or, we call her It, I suppose. Nowhere is it taught that you can get where you are by will alone.”
- Jeremy: “It’s much better than being an organ of that mass… a cog in her machine.”
- Jeremy: “He- Hank, went insade after ana died. He thought initially that she was gone forever… that she had not ascended.”
- Jeremy: “Through the beliefs of the Moon Children you are not gone forever like in traditional death.”
- Jeremy: “I was right about the time he went insane… at least that’s what it seemed like he showed these displays of power.”
- Jeremy: “I thought he was insane when he claimed Ana was Luna in the flesh and he was The Father.”
- Jeremy: “I think that I believe now that that was false. A lie to tell himself.”
- Jeremy: “I know now as well that she isn’t necessarily gone - That if you don’t do it like old Jeremy, you might disappear for good.”
- Jeremy: “Then again, maybe that’s for the best… or maybe it’s not. Things are very confusing here. Very painful.”
- Jeremy: “Is that all you wish to know? I certainly hope so, I have to keep moving.”
- Jeremy: “Have you spoken to Velvet? What a wonderful child… reminds me of my son. Very headstrong, very sure of themself.”
- ((Velvet is a fellow player who spoke to Jeremy before.))
- ((Jeremy says that Kevin doesn’t like people who talk.))
- Jeremy: “I hope you hear from my son Hunter. If you hear from him, please…”
- ((Jeremy sits in silence for a minute before ending the call.))
OLD - 7/27/16 - Jeremy and Greth
- ((Jeremy says that he needed a ‘Circle of Three’ players to choose to call on this date.))
- ((The three players chosen were Spanosa, Greth, and Velvet.))
- ((Jeremy, for some reason, says to not trust Rosa.))
- ((A pond was apparently found with Jeremy there.))
- ((He continues, saying we cannot help the dead.))
- ((He claims the only Moon Child who hasn’t died is Kevin.))
- ((Jeremy says Kevin is only pretending to be stuck in a time loop.))
- ((Jeremy says the 'Circle of Three’ has to work with Kevin.))
- ((Kevin is going to ask players to do something, and everyone has to agree or it won’t work.))
- ((Jeremy says that we can trust Kevin for now, but once Kevin gets SilentDT, we can no longer trust him.))
- ((It has apparently changed the rules of the game, and only brand new videos can be submitted in the guestbook.))
- ((Every time a video is submitted It grows stronger.))
- ((When YSHDT.net asked for a sacrifice earlier, Jeremy was the one who posted a video.))
- ((There was apparently a man at the pond with a Skull Mask.))
- ((Players apparently need to get past something called 'The Wall’.))
- ((Someone called The Governor is coming.))
OLD - 7/27/16 - Jeremy and Avia
- ((The player presumably asks Jeremy how he is doing.))
- Jeremy: “Gaping hole in chest, no flesh… Just a whisper, in a manner of speaking, quite an abstract situation, how I’m doing (Laughs)“
- Jeremy: ”…Hmm… I suppose it’s easier to say just fine after hearing a pretty young voice like yours, young lady.“
- Jeremy: "I have already spoken to the three, going around the world as I can see… Spansoa, Greth, Velvet.”
- Jeremy: “I heard someone didn’t want to be Peon… (Laughs)”
- ((This was a reference to something Avia had said in another chat.))
- Jeremy: “I can say to you something that is important to you - There is no reason to distrust Rosa. In fact, she is where I’m getting most of what I know from.”
- Jeremy: “I may be an old man and I am perfectly not wise - she is wise beyond on her years… We make it to the next step, the final cycle, soon, child.”
- Jeremy: “No more need to worry about the rogues, she has changed the rules. She is fair to some people, not like myself.”
- Jeremy: “I feel she is as… It is very important for us to not arrive there. There is one more that I need to speak to. My day job was just a postman.”
- Jeremy: “Jeremy seems to still be important. Have a safe night, Kimberly. Have a safe night.”
OLD - 7/27/16 - Jeremy, Ry, and Orion
- Jeremy: “One moment I'm standing by the house in the lake, the next I'm standing by where my friend was buried."
- Jeremy: "Something something dogs... Rem was so frightened, he didn't understand what he was getting into."
- Jeremy: "He shouldn't have moved into that house. He should've been much more truthful with who he spoke with, but it's not his fault he didn't know who was secretly It in this... game it plays."
- Jeremy: "There he goes, and there goes It, it's a shame he could not... It's a shame I could not speak with Ryan, one of your brightest, one of your brightest..."
- Jeremy: "Fortunate of me as well - I am unable to speak. I will take questions from Ryan though. Three."
- Jeremy: "It's a shame those dogs died later... the owner ended up with an animal abuse charge. A shame we didn't know it was ... It”
- Player: "How do we contact Tyler?"
- Jeremy: “Tyler will be contacting you. Tyler is a very complicated situation... very, very complicated situation."
- Jeremy: "Not quite sure why, but with that creature everything needs to be complicated to work."
- Jeremy: "Tyler will be contacting you, however it won't quite be the same Tyler. But, it will. One that made a different choice."
- Jeremy: "Would you like to know a secret, no strings attached I promise."
- Player: "Yes."
- Jeremy: “Very well then, hahahahaha. It... that amalgamation of the boy, the innocent boy, your Link, and... something else that I suppose we can call The Father..."
- Jeremy: "Hmm, do you think it is 3 things? Prominently it is three things, but there is something else in there - Many, many lesser spirits."
- Jeremy: "It takes them like candy, hahaha, like a child. After all, it is one - a child, and also a man, and also something... something else that's just... been for a very long time."
- Jeremy: "BEN for a very long time, hahahaha. But there is one amongst these lesser spirits that some of us, Ryann perhaps, might remember when the time comes."
- Jeremy: "It's not something that drowned, hahahaha... but, uh, the word might ring a bell…"
- Jeremy: "I'm following right behind Mr. Rem. Mister Hendricks here was very reliant on contacting Thomas. Thomas already knew was what was happening, but how could he know."
- Jeremy: "This is a very disorganized union, both unions, both organized for making sure only those with the intention of making sure the others know what the next step is."
- Jeremy: "Over the fence, as they say."
- Jeremy: "Oh… Are we sure? No questions at all? I would think from our brightest and best there would be an infinite number of inquiries…"
- Jeremy: "No questions whatsoever?"
- Jeremy: "And I wish that I could have the opportunity to... wield, I suppose you might say, the power that you have borrowed."
- Jeremy: "But not for, uh, this small petty window of time that seems to have become so very important. I do honestly wonder, what if he just waited up...”
- ((The players ask about the power that they hold.))
- ((Jeremy asks them to be clearer.))
- ((The players ask Jeremy what he would do with the power if he had it.))
- Jeremy: "If I had this power as I am now, I'd try to find out how I can just... put myself to sleep, hahaha..."
- Jeremy: "Not to, uh... sound like one of you silly teenagers but, uh, to be quite frank, I fucking hate this, hahaha..."
- Jeremy: "But if I was alive, uh... Well, I'd try to contact as many people like myself as I could, for one..."
- Jeremy: "Even though it's a bit rude, hahaha, for some who do not like to be disturbed... but not old Jeremy."
- Jeremy: "I always wanted to be a superstar back when I had skin, hahaha..."
- Jeremy: "So, while quite loud, all of this attention is somewhat refreshing in what I'm sure will be infinity from now."
- Jeremy: "In short, I really don't have a very useful answer. You've done tricks that have contacted others... Try them again."
- Player: "Other than Kevin, who should we be looking to talk to?"
- Jeremy: "Hmm... If, somehow, you could find a way to speak with Rem, I'm sure it would be quite rewarding."
- Jeremy: "He wasn't very trustworthy of anyone in his final moments, but I'm sure whatever position he's in now has probably loosened his lips."
- Jeremy: "Ah, here it is... I just got a call from Eulogy, and this time it told me to wait up. What if he had just waited up..."
- Jeremy: "Oh well, that's probably something that can't be changed... It's amazing. Over the fence, as they say..."
- Jeremy: "He proceeds through these woods and... he passes right by their base of operations at the time."
- Jeremy: "I'm sure you're going to ask 'whose base of operations', but we already had three questions, didn't we?"
- Player: "Whose base of operations?"
- Jeremy: "Well, at the time, mine. the traitors. Well, at the time then, that, uh, year..."
- Jeremy: "For you, uh... six years ago.... somewhere around there - it's much too complicated for me to keep up with, uh, tick tock nonsense on the other side."
- Jeremy: "I'm sure as well as the question has been asked before, you'll ask 'who are they'. The traitors."
- Jeremy: "Who are the traitors, and who are the traitors, hahahaha... It's quite the question depending on the way you ask, so..."
- Jeremy: "I have enough time to give you one shot at asking."
- Player: "Who are the traitors?"
- Jeremy: "Well, at least I don't have to say anything that'll get me in trouble now. Me, Hank, everyone you already know."
- Jeremy: "...And just to set the record straight, Kevin. Kevin, most definitely. Kevin at that time, this time, the window you were in, that time, and even before then, he was one of the traitors."
- Jeremy: "Even then, when we were both flesh and I was not one with no skin and he was ot one who was simply half a creature with flesh, hahaha..."
- Jeremy: "I didn't even like him then, way too shifty for me... always seemed like he had ulterior motives, hahaha."
- Jeremy: "I didn't consider myself nor did I consider anyone around me traitors, however anyone to be called a traitor it would definitely be Kevin."
- Jeremy: "But in the end, no matter how insidious he is, it amounts to nothing for him. As I've been told, his story is about to come to a screeching halt."
- Jeremy: "So, sorry to ruin the end of the book there if you were... hahahaha, excited for the big Kevin ending."
- Jeremy: "Regardless, though... before that ending comes, you should get out of Kevin what you need, which is him instructing you on how to get this SilentDT character."
- Jeremy: "And with that... I'll give you one more."
- Player: "Who is SilentDT?"
- Jeremy: "Hahahaha, that was exactly what I was expecting. I always told Rosa that I didn't believe psychic powers..."
- Jeremy: "This just ass more fuel to that fire if I can do that which makes her so special... but I supposed, uh, whatever she's doing makes her different."
- Jeremy: "But... we better start calling me old psychic Jeremy now, hahaha."
- Jeremy: "What do I know about old SilentDT? I know hes's Tyler."
- Jeremy: "I know he's... also somewhat dangerous."
- Jeremy: "Time in this small section of the story is... ripped quite asunder, and this is a Tyler that seems to have made a different decision in this life and has found himself there at the Orchard."
- Jeremy: "...Not all that far a walk from where he lives, either. Amazing, not all that far of a walk where the traitors live. Amazing, hahaha..."
- Jeremy: "Devine coincidence, as I generally spell it. Oh, that was asked at a point as well. Mr. Greth is one of the three prominents."
- Jeremy: "I never quite got around to answering that one. Old Jeremy's got a little too famous to talk to all of his fans, haha..."
- Jeremy: "Can't pass out signatures to everyone. All this fame's gone a bit too far to my head, hahaha."
- Jeremy: I really wish I was still around int he world of the living. Or not... probably not. Most definitely not, hahahahah."
- Jeremy: "However, I can say right now, before I depart and continue on my rounds - I will answer that old question Greth posed."
- Jeremy: "What is divine vs devine?"
- Jeremy: "But one might say it's a play on words... They always call it divine coincidence. Rosa always called it that, that video game - the one with her name."
- Jeremy: "The number three and it's relevance... 423. 1111111111. Dividne coincidence and its relevance."
- Jeremy: "However, I say devine. Devil. Evil."
- Jeremy: "It's a bit of a play on words, but I never was much of a speller... Dropped out of high school to be in a, uh, cult."
- Jeremy: "The next time we speak things might be a little... intense, hahaha. I just hope you all make the right choice."
- Jeremy: "But either way, somebody's gotta suffer. Isn't that just how life works? Hahaha."
- Jeremy: "Until then, have a safe night."
- Jeremy: "And, uh... Don't, uh..."
- Jeremy: "Don't go outside."
OLD - 12/29/16 - Jeremy and Chat
[2016-12-29 11:39:43 PM] ARGdov: HEY HEREMY
[2016-12-29 11:39:43 PM] Jeremy J: Or now rather hahahaha
[2016-12-29 11:39:48 PM] Grey: ack
[2016-12-29 11:39:54 PM] 🎄ADULT_LINK [ID]🎄: hey jero
[2016-12-29 11:39:58 PM] Wolfcat: jey jeremy
[2016-12-29 11:40:02 PM] ARGdov: Jey, do you remember us?
[2016-12-29 11:40:16 PM | Edited 11:40:26 PM] ryann foxx: Jello.
[2016-12-29 11:40:16 PM] Jeremy J: Jes haha
[2016-12-29 11:40:42 PM] Purpleleven: I’ve been looking at these for awhile, and thought something was off, but it is true. Base64 doesn’t contain any special characters like punctuation, but base85 does
[2016-12-29 11:40:59 PM] Jeremy J: It has been so long
[2016-12-29 11:41:03 PM] Leliel: Jeremy!
[2016-12-29 11:41:07 PM] ryann foxx: yes it has 8^(
[2016-12-29 11:41:22 PM] Leliel: I was looking at the skype group for awhile and then I looked a bit harder and then I was like “oh crap this guy’s serious business”!
[2016-12-29 11:41:30 PM] Grey: which is hilarious by the way
[2016-12-29 11:41:33 PM] Leliel: I’m so happy! Welcome back man =D
[2016-12-29 11:41:45 PM] ARGdov: are you doing ok, Jeremy?
[2016-12-29 11:43:06 PM] Leliel: Are you doing well? Also, do you remember me? =D
[2016-12-29 11:43:50 PM] 🎄ADULT_LINK [ID]🎄: … I found fuckin Saitama in a santa outfit in crosscode
[2016-12-29 11:44:07 PM] 🎄ADULT_LINK [ID]🎄: .-.
[2016-12-29 11:44:08 PM] Jeremy J: ryann foxx - Today 1:41 AM
> yes it has 8^(
Turn that frown upside down young one we have no time for sad faces. Soon is the time of action.
ARGdov - Today 1:41 AM
> are you doing ok, Jeremy?
8^ ) as good as I can be like this, same as always.
[2016-12-29 11:44:18 PM] 🎄ADULT_LINK [ID]🎄: 8^y
[2016-12-29 11:44:19 PM] Grey: Cross code has a full release now?
[2016-12-29 11:44:25 PM] 🎄ADULT_LINK [ID]🎄: nah not yet
[2016-12-29 11:44:30 PM] Leliel: 8^O
[2016-12-29 11:44:31 PM] 🎄ADULT_LINK [ID]🎄: still in early access
[2016-12-29 11:44:35 PM] 🎄ADULT_LINK [ID]🎄: john got it for me for xmas
[2016-12-29 11:44:37 PM] Jeremy J: Pay close attention
[2016-12-29 11:44:39 PM] 🎄ADULT_LINK [ID]🎄: (thank you john)
[2016-12-29 11:45:07 PM] ryann foxx: We will.
[2016-12-29 11:45:12 PM] Jeremy J: It has been so long no thanks to that wayward boy
[2016-12-29 11:45:33 PM] Leliel: Carry on my wayward son…
[2016-12-29 11:45:44 PM] Jeremy J: Insidea if I remember
[2016-12-29 11:45:52 PM] Jeremy J: I spoke of him before
[2016-12-29 11:45:59 PM] ryann foxx: Kevin.
[2016-12-29 11:45:59 PM] Leliel: Yeah, that’s the name.
[2016-12-29 11:46:21 PM] Jeremy J: Kevin has held things in place
[2016-12-29 11:46:39 PM] Leliel: Like new years eve parties>
[2016-12-29 11:46:46 PM] Jeremy J: Im not sure what he hoped to gain from this
[2016-12-29 11:47:16 PM] Jeremy J: Maybe he thought he could bend the rules to his will
[2016-12-29 11:47:32 PM] Jeremy J: Get the outcome he wants all by himself
[2016-12-29 11:47:50 PM] Grey: I take it that this didn’t work.
[2016-12-29 11:47:53 PM] Leliel: Ah, I see. Be on the side of only himself?
[2016-12-29 11:48:04 PM] ryann foxx: Hold on…
[2016-12-29 11:48:08 PM] Jeremy J: But even She cannot break the rules that hard
[2016-12-29 11:48:10 PM] ryann foxx: Nevermind, continue.
[2016-12-29 11:48:20 PM] Grey: She?
[2016-12-29 11:48:23 PM] ryann foxx: Luna.
[2016-12-29 11:48:25 PM] Leliel: What rule was he trying to break?
[2016-12-29 11:49:21 PM] Jeremy J: Take control of that which is behind the wall of truth
[2016-12-29 11:49:33 PM] Leliel: Oh man, that darn mystery.
[2016-12-29 11:49:38 PM] Jeremy J: But he is something like me now
[2016-12-29 11:49:44 PM] Jeremy J: We cannot do this
[2016-12-29 11:49:46 PM] Leliel: Oh no! ):
[2016-12-29 11:50:03 PM] Purpleleven: So he has been found out as well?
[2016-12-29 11:50:18 PM] Leliel: Something like you? But not exactly?
[2016-12-29 11:51:06 PM] Jeremy J: The difference between me and him is he killed to last beyond his own life
[2016-12-29 11:51:09 PM] BKG CircleHunter: oh shit
[2016-12-29 11:51:16 PM] Jeremy J: I just worked for it hahaha
[2016-12-29 11:51:19 PM] Leliel: dark
[2016-12-29 11:51:20 PM] Grey: Do you happen to know a girl named Hope by any chance?
[2016-12-29 11:51:29 PM] BKG CircleHunter: i am late to the party
[2016-12-29 11:51:33 PM] Jeremy J: But you can see what that got me
[2016-12-29 11:51:52 PM] Jeremy J: Death by itself is truly a gift hahaha
[2016-12-29 11:52:33 PM] Jeremy J: I long now for only null and void
[2016-12-29 11:52:46 PM] Jeremy J: But enough of my problems hahahaha
[2016-12-29 11:53:11 PM] Leliel: We’ll get you your rest, don’t worry
[2016-12-29 11:53:25 PM] ryann foxx: So, Kevin tried to play both sides and betrayed all of them, but it backfired?
[2016-12-29 11:54:13 PM] Jeremy J: It is currently backfiring after a countless amount of trials and failures and loops back to day one
[2016-12-29 11:54:17 PM] Jeremy J: So many
[2016-12-29 11:54:55 PM] Grey: ….How amny times have you guys looped?!
[2016-12-29 11:55:06 PM] Leliel: Oh! Is Kevin responsible for the time loop?
[2016-12-29 11:55:08 PM] ryann foxx: wait wait what if when the title was cycling that was kevin
[2016-12-29 11:55:17 PM] Leliel: Hmm
[2016-12-29 11:55:20 PM] Leliel: There’s too many cycles
[2016-12-29 11:55:23 PM] Jeremy J: The ones lost within this place have suffered and those he sought to govern now rebel against him
[2016-12-29 11:55:46 PM | Edited 11:55:56 PM] Grey: You mean Hope and the guy who held us at gunpoint?
[2016-12-29 11:57:12 PM] Jeremy J: Those events are but the screaming memories of lost moonchildren. Some stuck by association but not related to your own goal.
[2016-12-29 11:58:15 PM] Jeremy J: Im glad I died in peace
[2016-12-29 11:58:31 PM] Jeremy J: Stabbed in the neck by my own son hahaha
[2016-12-29 11:59:32 PM] BKG CircleHunter: so these people we heard from earlier are dead?
[12:00:12 AM] Jeremy J: But I was hardly awake while it happened so it was not of much a shock until later or earlier or something hahaha
[12:00:39 AM] Jeremy J: circle_hunter - Today 1:59 AM
> so these people we heard from earlier are dead?
To those who are “living”
[12:01:15 AM] Jeremy J: These terms get quite confusing once you are where I have been boy hahahaha
[12:01:32 AM] Grey: But we were talking to them, how could they be memories?
[12:01:43 AM] Leliel: Is the word conscious fair game?
[12:02:02 AM] ryann foxx: I think they’re like…
[12:02:09 AM] Jeremy J: Leliel - Today 2:01 AM
> Is the word conscious fair game?
That covers it best I suppose haha
[12:02:30 AM] Leliel: Does conscious include the ability to think?
[12:02:41 AM] Jeremy J: Sometimes
[12:03:07 AM] Leliel: Hmm, then yeah, it does cover pretty well.
[12:03:25 AM] ARGdov: ugh, I’m tired
[12:03:29 AM] Jeremy J: When She cant take that much from you or chooses to give it
to you, yes one may think here haha.
[12:03:35 AM] ARGdov: I have to go to sleep, Im sorry, guys
[12:03:44 AM] ARGdov: I’ll read through the backlog or the doc tomorrow
[12:03:52 AM] ARGdov: best of luck to you
[12:03:59 AM] Leliel: Good night Dov
[12:04:27 AM] ryann foxx: So they’re not like… data ghosts, so to speak? Echoes? They’re actually sentient beings?
[12:04:36 AM] ryann foxx: Night, Dov.
[12:05:26 AM] Jeremy J: There is every manner of thing in this sudo universe
[12:05:32 AM] Leliel: Isn’t Jeremy one of those people, whose sentient right now?
[12:05:39 AM] Jeremy J: This parody of your own reality
[12:05:58 AM] Leliel: Sounds like a fascinating world.
[12:09:03 AM] Grey: So why the run around with the glitch text
[12:11:16 AM] Jeremy J: You can see a little bit of everything from yesterday, today, tomorrow or sometimes more than one or all at once. Its a bit confusing and many things walk through this place besides me. Things from before your world came to be, before She participated in the process of what created it. But NOW I am certainly saying too much and will certainly bring trouble on myself hahahaha
[12:11:27 AM] Jeremy J: That can be a story for another time
[12:11:49 AM] ryann foxx: Right, that weird parallelos you’re trapped in.
[12:12:24 AM] 女佣机器人: oh, hey Jeremy
[12:13:12 AM] Jeremy J: greyoutt2 - Today 2:09 AM
> So why the run around with the glitch text
She has an odd fascination,in what she is in control of, for arbitrary challenges since She cannot outright stop someone like me from going where I please.
[12:15:13 AM] Jeremy J: Most likely due to its fury in the arbitrary process, which prevents her access to what she desires until she may have it completed.
[12:17:13 AM] ryann foxx: Hmmm…
[12:17:24 AM] ryann foxx: Is there anything particularly pressing we need to discuss or go over?
[12:18:04 AM] Jeremy J: The process I just mentioned of course hahaha
[12:19:05 AM] Jeremy J: I have seen a lot of things
[12:19:32 AM] Leliel: Hmm, would you have a name for the pseudo reality you live in? It’d be helpful if we had something easy to refer to it to.
[12:20:18 AM] Jeremy J: Well I have heard a lot of things call it a lot of stuff
[12:20:36 AM] Leliel: A list of names might be more useful then one name, actually!
[12:20:46 AM] Grey: How about we call it “The Upside-Down”?
[12:21:20 AM] Jeremy J: My “religious group” had a name for it too but that was, in a way, so long ago I have forgotten it.
[12:21:32 AM] ryann foxx: Wait, hold up, uh…
[12:21:38 AM] Leliel: Darn
[12:22:06 AM] Leliel: Maybe the undead world is a fitting name
[12:22:21 AM] ryann foxx: I might be able to dig it up…
[12:22:26 AM] ryann foxx: It’s not the parallelos of the dead…
[12:22:41 AM] Leliel: For something temporary
[12:22:49 AM] Jeremy J: Many seem to just call it “fake” in disbelief of what they must experience
[12:22:52 AM] ryann foxx: Would you be considered ‘ascended’, whatever the requirements for that are?
[12:23:08 AM] Leliel: Then calling it the fake world will do
[12:23:35 AM] ryann foxx: Oh, hold up. Fakeworld, haha, that brings back memories of Janus…
[12:23:42 AM] Jeremy J: ryann foxx - Today 2:22 AM
> Would you be considered 'ascended’, whatever the requirements for that are?
Probably hahaha
[12:23:44 AM] Leliel: Although whether we use it or not depends on how well it catches on with people here.
[12:23:56 AM] ryann foxx: Okay, you might be considered a 'finitor’.
[12:23:57 AM] 女佣机器人: dead world sounds kind of silly because it’s hard to call them “dead” per se
[12:24:10 AM] ryann foxx: Or… hm.
[12:24:16 AM] 女佣机器人: also idk where we’re at here but has anyone ever experienced this place without “dying”
[12:24:19 AM] ryann foxx: Parallelos of the Ascended, then, I suppose.
[12:24:20 AM] Leliel: I always felt ascension was a state similar to what Jeremy is in but “special”.
[12:24:24 AM] 女佣机器人: forgive me if I’m late
[12:24:37 AM] ryann foxx: http://lunarchildren.com/terminology/parallelos/
[12:24:48 AM] ryann foxx: Well, powerful ascended people are like that
[12:24:51 AM] ryann foxx: “Special”
[12:24:57 AM] ryann foxx: There’s also, like, botched ascensions
[12:26:20 AM] Leliel: Well, botched ascension could just be actual death
[12:26:38 AM] Leliel: I mean ascension involves electrocution and you mess that up…
[12:26:50 AM] ryann foxx: Nope nope
[12:26:51 AM] ryann foxx: http://lunarchildren.com/ascension/devium/
[12:26:59 AM] ryann foxx: More than just electrocution, drowning, bunch of other stuff
[12:27:21 AM] ryann foxx: If you’re not trained properly, you can get trapped in 'portals’ like Johnisdead.com, and presumably YSHDT.net.
[12:27:50 AM] Leliel: Hey Jeremy, what do you think of the stuff Ryann is linking?
[12:27:55 AM] ryann foxx: Anyway:
[12:18 AM] Jeremy J:
<<< The process I just mentioned of course hahahaYou said we need to discuss this?
[12:29:11 AM] 女佣机器人: oh nevermind, I read that site Ryann linked and it answered my question
oh cool Scrying
[12:29:21 AM] 女佣机器人: I wonder if Scrying Mirrors will come of use in some way, shape, or form
[12:29:31 AM] ryann foxx: scrying?
[12:29:33 AM] 女佣机器人: inb4 MM specific Mirror shield
[12:29:45 AM] BKG CircleHunter: i almost bought an obsidian mirror a while back
[12:29:50 AM] BKG CircleHunter: still really want to
[12:30:18 AM] BKG CircleHunter: but that’s because of an entirely different cult
[12:30:24 AM] BKG CircleHunter: of the colored shellfish variety
[12:30:28 AM] 女佣机器人: [12:29 AM] 女佣机器人:
<<< oh cool Scrying
I wonder if Scrying Mirrors will come of use in some way, shape, or form
inb4 MM specific Mirror shieldI say this because it’s the closest to the idea and there’s no Mirror shield that is black, even though Scrying Mirrors are typically black.
[12:31:19 AM] 女佣机器人: basically the Scrying section on lunar children describes exactly what it is, but in various forms of witchcraft it uses a black mirror to see things within the reflection
[12:31:22 AM] 女佣机器人: or lack of one, whichever
[12:31:38 AM] ryann foxx: there’s a scrying section on the lc site?
[12:31:48 AM] 女佣机器人: it’s in Parallelos
[12:31:58 AM] Leliel: I’ll probably start heading to bed after what Jeremy says next
[12:32:04 AM] 女佣机器人: Scrying: Looking into a parallelos to attain visions. One may also without having ascended to attain visions of past, present or future. Though it is possible to do this with various devices, Scrying can be done with the mind alone by those of the parallelos path teachings, and with much greater accuracy but at the high cost of mental vitality. It is thought that over use or misuse may cause blindness.
[12:32:56 AM] 女佣机器人: a crystal ball might also be considered Scrying
[12:33:14 AM] ryann foxx: [12:32 AM] 女佣机器人:
<<< It is thought that over use or misuse may cause blindness.hey, didn’t Jeremy’s brother go blind in one eye or something
I know some guy’s brother did
[12:33:25 AM] Jeremy J: Yes, there is a ceremony of sorts. One that requires the four giants, one who is living and the “mask” that is placed upon him.
[12:34:53 AM] Jeremy J: Kevin believes he shall gain much more power from causing this ceremony to unfold and bring about her time.
[12:35:12 AM] 女佣机器人: when scrying, do some go blind from seeing Her, as it has been said in the past mortals are not meant to do so?
[12:35:17 AM] Jeremy J: Ifrit, in a manner of speaking, still walks your earth.
[12:35:49 AM] Leliel: I have to sleep now
[12:35:53 AM] Leliel: Its nice seeing you again Jeremy
[12:36:03 AM] ryann foxx: Ifrit’s… possessed, right? By something?
[12:36:08 AM] ryann foxx: Night, Leliel.
[12:36:17 AM] Leliel: Night, Ryann
[12:36:29 AM] 女佣机器人: I’m curious because we could be misinterpreting various lines about eyes being taken this entire time /shrug
[12:36:33 AM] Jeremy J: He believes he will make himself the one holding that “mask”
[12:37:14 AM] ryann foxx: Who does, Kevin?
[12:37:28 AM] Jeremy J: But in his state has been blinded from the truth
[12:37:36 AM] Jeremy J: ryann foxx - Today 2:37 AM
> Who does, Kevin?
Ifrit
[12:38:55 AM] Jeremy J: That one has already been chosen
[12:39:10 AM] Jeremy J: He was chosen then and he is chosen now
[12:39:42 AM] Jeremy J: He is chosen everytime no matter how many “times” it comes to pass
[12:40:11 AM] Jeremy J: And there is no “time” in which this changes
[12:40:35 AM] ryann foxx: What’s with the quotes around “time”?
[12:41:10 AM] Jeremy J: That one is Tyler
[12:41:16 AM] 女佣机器人: idk if you guys have discussed Thoth yet, but there are some interesting things behind Thoth worth appreciated based on a character’s username being such, whether relevant or not. such as Symbol Moon disk, papyrus scroll, reed pens, writing palette, stylus, ibis, baboon, scales
[12:41:19 AM] Jeremy J: But I feel you knew this
[12:42:26 AM] Jeremy J: The ceremony has already occured partially
[12:43:22 AM] Jeremy J: Only due to the ignorance of those involved
[12:43:45 AM] Jeremy J: But the next part involves you all
[12:44:06 AM] 🎄ADULT_LINK [ID]🎄: binding of Isaac is an amazing and broken game
[12:44:09 AM] 🎄ADULT_LINK [ID]🎄: 100/10
[12:44:10 AM] ryann foxx: The Ceremony of the Three Elements?
[12:44:14 AM] Oceanstuck, Knight of Light (Lewis): yo lonk arg shit is happening
[12:44:16 AM] ryann foxx: Is that the ceremony?
[12:44:18 AM] 🎄ADULT_LINK [ID]🎄: o oops
[12:44:38 AM] 女佣机器人: I never thought having some fun facts due to enjoying various forms of neo-paganism would be of any (possible) relevance but I’m now interested in Thoth, the character.
[12:44:47 AM] ryann foxx: “Just as well, one of the most important ceremonies involving the return of mother, involves the gathering of 3 very important individuals representative of the three silver secrets. This ritual is known as the Ceremony of the three elements.”
[12:45:47 AM] 女佣机器人: “The magical powers of Thoth were so great, that the Egyptians had tales of a 'Book of Thoth’, which would allow a person who read the sacred book to become the most powerful magician in the world. The Book which "the god of wisdom wrote with his own hand” was, though, a deadly book that brought nothing but pain and tragedy to those that read it, despite finding out about the “secrets of the gods themselves” and “all that is hidden in the stars”.
[12:46:08 AM] ryann foxx: Book.
[12:46:14 AM] ryann foxx: Book taken from the Lunars.
[12:46:20 AM] ryann foxx: I think we should let Jeremy finish typing now.
[12:46:27 AM] 女佣机器人: we should, yeah
[12:46:58 AM] 女佣机器人: and I wouldn’t take everything from stories about Thoth, but there are some interesting parallels that are probably due to good research on GM’s part, if nothing else
[12:47:15 AM] Jeremy J: Not exactly sure what three elements are supposed to be, I might have been at some point. But book reminds me, somone actually wrote a book a long time ago hahaha
[12:47:48 AM] Grey: Fascinating.
[12:48:31 AM] ryann foxx: The Libro Lunarus?
[12:48:34 AM] 女佣机器人: http://www.sacred-texts.com/egy/ael/ael08.htm here’s the story of Ra’s curse (Nut being unable to have children) being broken by Thoth, a god who was in love with her.
[12:48:35 AM] Jeremy J: The book consisted of “whispers” from that evil thing
[12:49:57 AM] 女佣机器人: how old is this book, and where could we find it?
[12:50:20 AM] Jeremy J: The one copy of it was defaced by someone I used to be very friendly with and filled with many of his grief driven delusions.
[12:50:59 AM] 女佣机器人: was that someone Kelbris? I apologize, its been awhile so I cannot recall his true name at the moment.
[12:51:10 AM] Jeremy J: Delusions I mostly followed, if for nothing else, due to my fondness of him.
[12:51:34 AM] Jeremy J: He was a very good friend until the incident
[12:51:50 AM] Jeremy J: But that is not really relevant hahaha
[12:52:10 AM] ryann foxx: The three elements or secrets, would two of those be Power and Wisdom?
[12:55:42 AM] Jeremy J: insertcreativeusername - Today 2:50 AM
> was that someone Kelbris? I apologize, its been awhile so I cannot recall his true name at the moment.
Kelbris was a very good friend and it was quite a shame how he was treated by the “family”. But naturally as soon as they realize he had some sort of power they go and pretend he was their saint and chase after any crumb they can get from him hahaha
[12:59:21 AM] Jeremy J: Yes Hank was the one who got his hands on that book. From where I cant be sure, but probably from that dark deed he went through with. As a father myself it was hard for me to be understanding. But I stuck by the old fool, guess that was a mistake hahaha
[1:00:03 AM] ryann foxx: The dark deed… is that referring to what he did to his son?
[1:00:14 AM] 🎄ADULT_LINK [ID]🎄: (psst hey scoot)
[1:00:41 AM] 女佣机器人: would you say he was possibly rewarded with this book, by another? Whether a “higher” power, or a normal person with similar beliefs
[1:01:11 AM] 女佣机器人: and if we can trace its origins, is it possible such knowledge could help us stop all of this?
[1:01:32 AM] ryann foxx: I think LiquidSaint/SKM/Alex has the book.
[1:02:25 AM] 女佣机器人: I wonder if there’s a way to get it from them, in some sense, but given what Jeremy has said doing so would probably have some pretty dark implications on our part
[1:02:51 AM] 女佣机器人: if so I’m not sure everyone would be on board with what that would probably entail, depending.
[1:03:31 AM] 女佣机器人: But, it could be similar to TribeTwelve’s journal situation
[1:07:35 AM] Jeremy J: No need to its use has passed at this point, the knowledge within is muddled with falsehoods. What is true would only make you like me in the end, I promise that is not something to give praise to hahaha. But the ritual occurred in the building where this whole mess started. Tyler has understood what he must do to escape. But I am here now to tell you something
[1:08:21 AM] Jeremy J: Something honestly I am a bit afraid to say, seeing as she can still see what she cant touch haha
[1:09:38 AM] Jeremy J: I told you before you will be given a choice and it is up to you, the ones involved. To finish this little legend.
[1:10:49 AM] Jeremy J: I am not going to go into detail I will be in enough trouble already
[1:11:04 AM] Jeremy J: But that choice will be
[1:11:43 AM] Jeremy J: Will you “turn off the power” so to speak
[1:12:36 AM] Jeremy J: Will you kill it?
[1:12:56 AM] ryann foxx: It?
[1:12:56 AM] Purpleleven: What exactly would we be shutting down?
[1:13:43 AM] Jeremy J: That poor amalgamation of a soul
[1:14:08 AM] Jeremy J: That sick creature trying to control it for her will
[1:14:16 AM] Grey: Amalgamation?
[1:14:20 AM] Purpleleven: We have the power to “turn off” Luna? How?
[1:14:30 AM] ryann foxx: Mr. D
[1:14:31 AM] Jeremy J: Ben
[1:14:32 AM] ryann foxx: I believe.
[1:14:36 AM] Jeremy J: Tyler
[1:14:39 AM] Jeremy J: BEN
[1:14:44 AM] Purpleleven: AH, whoops
[1:15:09 AM] Jeremy J: Mr.D also works
[1:15:23 AM] Jeremy J: It was one title it went under
[1:15:32 AM] 女佣机器人: [1:13 AM] Jeremy J:
<<< That poor amalgamation of a soul
That sick creature trying to control it for her willBetter for the world as a whole Better for the tool being used, this implies, to be ended. I would say the answer is definitely to kill it.
[1:15:52 AM] Purpleleven: That seems all to simple a solution though. I suspect that would not actually get rid of the issue that is Luna, just the symptoms as we would have to deal with them.
[1:16:22 AM] ryann foxx: I don’t know if Luna is an issue, per se, she seems at most neutral, not benevolent or malicious.
[1:16:52 AM] Jeremy J: ryann foxx - Today 3:16 AM
> I don’t know if Luna is an issue, per se, she seems at most neutral, not benevolent or malicious.
I am afraid you are mistaken
[1:17:12 AM] Purpleleven: I think we’ve known for a bit that Luna basically eats souls
[1:17:36 AM] Jeremy J: That thing most certainly would love nothing more than to have you by the neck
[1:17:36 AM] 女佣机器人: If a god has no worshippers, is it a god? D E L E T B O O K D E L E T C U L T
[1:17:54 AM] ryann foxx: Probably. Right, so Luna is an issue.
[1:18:04 AM] Jeremy J: Jeremy J - Today 3:17 AM
> That thing most certainly would love nothing more than to have you by the neck
This is a very laughable understatement hahaha
[1:18:19 AM] ryann foxx: And Mr. D gets her, or it, power?
[1:18:26 AM] Purpleleven: So, what would removing BEN do to efforts on stopping Luna?
[1:19:25 AM] ryann foxx: [1:11 AM] Jeremy J:
<<< Will you “turn off the power” so to speak
[1:19:33 AM] ryann foxx: I believe it acts as a power source, or something?
[1:25:22 AM] Jeremy J: Tyler while under the control of the “mask” acts as a sort of way point for her from this world. The giants shall then make the way for her to enter(which is and always has been their only true purpose as the giants are not who they inhabbit but beings from long before your time). However those who granted this rite power made these conditions final.
[1:26:14 AM] ryann foxx: A waypoint. Like a link?
[1:26:23 AM] ryann foxx: Hence why he was called the Harbingers’ Link.
[1:26:28 AM] 女佣机器人: Tyler becomes a vessel, perhaps?
[1:26:45 AM] Jeremy J: You could say he is a link if you like hahaha
[1:27:19 AM] Jeremy J: I need to get going
[1:27:42 AM] Jeremy J: I have put myself in danger for my loud mouth as usual
[1:28:01 AM] Jeremy J: Would not want the mess to spill over to you hahaha
[1:28:13 AM] ryann foxx: Good luck, Jeremy. Stay safe, if there’s any semblance of that thing wherever you are.
[1:28:51 AM] Purpleleven: So we shut off BEN, completely removing Tyler, but we stop Luna from gaining any more power? Good luck with whatever goes on where you are.
[1:29:10 AM] ryann foxx: Or free Tyler from the mask, maybe?
[1:29:20 AM] 女佣机器人: idk, it might be too late for that.
[1:29:33 AM] 女佣机器人: However those who granted this rite power made these conditions final.
[1:30:08 AM] BKG CircleHunter: Are there others like you willing to help?
[1:30:13 AM] BKG CircleHunter: Able to give advice?
[1:30:54 AM] Jeremy J: If you can somehow at some point get to that nice young lady for me
[1:31:04 AM] Jeremy J: Tell her I said hello again
11/19/18 - Chat with Moonman31
- ((A large amount of shitposting happens in the chat))
- moonman31 9:19 AM: Shitposting is real
- Dense 9:26 AM: OwO
- Jos 9:56 AM: I am unable to live without thebexistance of shitposting
- moonman31 10:16 AM: I mean
- moonman31 10:16 AM: what would life even be
- Dense 10:17 AM: God tier shitpost
- Jos 10:22 AM: It would be like
- Jos 10:22 AM: *Hey hello
- Jos 10:22 AM: *Hi
- Jos 10:22 AM: serious stuff
- Jos 10:22 AM: *okay bye
- Jos 10:22 AM: Anyways
- Jos 10:22 AM: How is things going over there?
- Jos 10:22 AM: Pretty good here
- Jos 10:22 AM: I just want to check
- Jos 10:22 AM: Are you unable to speak because of an non physical force?
- Wolfcat 10:28 AM: I think someone just swats his keyboard away when he's about to answer us
- Jos 10:29 AM: I dont want to feel agressive with this kind of question is just that it will always scratch the back of my head until i find solution
- moonman31 10:32 AM: Uh
- moonman31 10:32 AM: It is hard to explain
- moonman31 10:32 AM: It is a spooky-ooky thing
- Dense 10:33 AM: Do u remember what u were doing
- Dense 10:33 AM: On the morning of
- Dense 10:33 AM: 1 of
- Dense 10:33 AM: July
- Dense 10:33 AM: Of
- Dense 10:33 AM: 2010
- Jos 10:35 AM: Okay, i have an idea of it, i wont keep pushing, thanko
- moonman31 10:35 AM: What? no. do you?
- moonman31 10:35 AM: What happened in July 2010
- Dense 10:36 AM: Idk
- Jos 10:36 AM: I think he is just trying to say if you can remember your past without any problems
- Dense 10:36 AM: Just asking
- Dense 10:36 AM: Yep
- Dense 11:03 AM: https://youtu.be/uarIcqkWomQ
- Dense 11:03 AM: This is the astral observatory ost
- ((Dense posts a YouTube link to a video of an alien dancing to the Lavender Town theme.))
- moonman31 11:22 AM: wow
- Wolfcat 12:09 PM: hey moonman, have you ever met the other AO members in person? or is it just strictly an online thing?
- moonman31 8:13 PM: I've met others in person
- moonman31 8:13 PM: @Wolfcat
- Dense 8:18 PM: whom lol
- moonman31 8:41 PM: ur mom
- CircleHunter 8:41 PM: goteem
#johnisdead
#johnisdead.com
November 17th, 2018
- At 5:59 PM, ARGDov noticed that Nocta had sent him a reply the previous day, asking him “How far does your curiosity go?”
- At 6:44 PM, ARGDov responded to Nocta stating that he wanted to know the Truth, and that he no longer wished to associate with the Internet Detectives.
#johnisdeadtimeline
November 19th, 2018
- At 9:18 PM, Moonman31 became active in the Discord server. The entire chat can be read here. Below is a brief summary:
- It is hard for Moonman to describe how he cannot speak about certain subjects, calling it a “spooky-ooky thing”
- When asked if he’s ever met other Astral Observatory members in person, he says he has.
#JohnIsDeadTimeline
11/20/18 - Chat with Moonman31
- ((More mild shitposting occurs in the Discord server))
- moonman31 9:46 AM: but yeah
- moonman31 9:46 AM: other than shitposting
- moonman31 9:46 AM: ...
- Jos 9:46 AM: Buenos dias, bueno amigo
- Wolfcat 9:46 AM: mind if I ask you about a couple of other dudes you may know?
- moonman31 9:47 AM: sure
- Wolfcat 9:47 AM: do you know anything about Thomas? ryukaki's old friend?
- moonman31 9:48 AM: I know jackshit about Thomas tbh
- Wolfcat 9:49 AM: same with us
- Wolfcat 9:49 AM: it sounded like he may have been in one of the two cults, but beyond that there's no information on the guy
- moonman31 9:50 AM: nocta
- moonman31 9:50 AM: he would know about thomas
- Dense 9:50 AM: Oh good morning duds
- moonman31 9:59 AM: my dyuuude
- Wolfcat 10:05 AM: Alright, how about some kid named Hunter? I mean, there's probably a lot of kids named Hunter
- Wolfcat 10:05 AM: but you know what I mean
- Wolfcat 10:05 AM: he's another guy that seemed to just vanish from existence
- moonman31 10:06 AM: Hunter Jarvis
- moonman31 10:06 AM: ?
- moonman31 10:06 AM: Wow you are bad at replying
- moonman31 10:06 AM: https://www.youtube.com/watch?v=OWJNGNV5J9s
- ((Moonman posts a YouTube link of Sonic the Hedgehog saying "Come on, step it up!"))
- Dense 10:10 AM: Yes
- Dense 10:10 AM: Hunter Jarvis
- moonman31 10:11 AM: Anything I know about Hunter was from what Jarilo told me
- Dense 10:11 AM: Oh shit
- Dense 10:11 AM: :hidden: OH SHIT
- Wolfcat 10:15 AM: sorro im actually at work rn lol
- Wolfcat 10:15 AM: yeah the Jarvis kid
- Wolfcat 10:15 AM: damn so you actually spoke to jeremy too?
- moonman31 10:20 AM: Uh yeah a few years back
- Wolfcat 10:22 AM: damn, so you had an account on the LC forums?'
- Dense 10:23 AM: :hidden: or maybe irl
- moonman31 10:24 AM: Nah
- moonman31 10:24 AM: On skype
- Dense 10:25 AM: Oh
- moonman31 10:29 AM: Oh
- Wolfcat 10:30 AM: Oh
- Wolfcat 10:30 AM: It's magic
- moonman31 10:32 AM: ok
- Dense 10:34 AM: ok
- Wolfcat 10:40 AM: the last we spoke to Jeremy was in 2016
- Wolfcat 10:40 AM: well, actually extremely early 2017 to be precise
- Wolfcat 10:40 AM: he was in a weird situation to say the least
- Wolfcat 10:40 AM: we haven't seen him since, unfortunately
- moonman31 10:42 AM: dead?
- moonman31 10:42 AM: Yeah
- Wolfcat 10:43 AM: yeah
- Wolfcat 10:43 AM: rip, honestly, he was a nice old man
- moonman31 10:49 AM: yeah
- Jos 11:01 AM: Dead
- Jos 11:01 AM: Yeah
- Dense 11:02 AM: How you met Jeremy?
- moonman31 11:09 AM: No
- moonman31 11:09 AM: We spoke online
- Dense 11:18 AM: Wait
- Dense 11:18 AM: But
- Dense 11:18 AM: Why you talked?
- moonman31 11:39 AM: because
- moonman31 11:39 AM: I was a 'detective'
- moonman31 11:39 AM: back then
- Jos 11:43 AM: are you Tyler?
- moonman31 11:43 AM: No
- Jos 11:43 AM: You just remind me to him speaking lol
- moonman31 11:43 AM: lol
- Jos 11:43 AM: lol
- Jos 11:43 AM: ok ok
- Jos 11:43 AM: sorro
- Dense 11:44 AM: Lol
- Wolfcat 12:01 PM: Alright, so since you probably are unable to answer directly, maybe you can answer this
- Wolfcat 12:01 PM: Have you ever read this book?
- ((Wolfcat sends a picture of “Moon Magic”, the book Greth is seen reading in “never sleeping”))
- moonman31 12:01 PM: Yes
- moonman31 1:00 PM: Got all quiet after that
- Dense 1:00 PM: Yeet
- Dense 1:00 PM: Ey Moonman
- Jos 1:00 PM: Nothing much to say
- Dense 1:00 PM: Do u like pokémon
- Jos 1:00 PM: tbh
- Jos 1:00 PM: https://www.youtube.com/watch?v=iZKEhVaTrQE
- ((Jos posts a Simpsons clip))
- moonman31 1:01 PM: Pokemon is cool
- Dense 1:01 PM: Wich game is your fav?
- Jos 1:01 PM: emerald is the best
- moonman31 1:02 PM: Probably Silver tbh
- Wolfcat 1:02 PM: monstermind
- Dense 1:02 PM: Black 1 is the best
- Jos 1:03 PM: black 1 is gay
- moonman31 1:03 PM: Moon is also tight despite everyone ripping on the new games
- moonman31 1:03 PM: I would probably say Silver, Moon, Sapphire
- moonman31 1:03 PM: in that order
- Dense 1:04 PM: Yeet
- moonman31 1:04 PM: remakes included
- moonman31 1:04 PM: Silver, Moon, Sapphire, Yellow actually
- Dense 1:04 PM: SoulSilver is neat
- moonman31 1:04 PM: maybe even Sapphire / Yellow as the same spot
- Dense 1:04 PM: Also ORAS
- Wolfcat 1:04 PM: what about lets go pikachu
- Jos 1:04 PM: i love emerald because of the battle frontier
- Jos 1:04 PM: ORAS is cool but GAY for not having battle frontier
- moonman31 1:04 PM: idk havent played it
- Wolfcat 1:04 PM: looks like bab gam
- Dense 1:05 PM: But nigga
- Dense 1:05 PM: Why anyone lines V gen
- Wolfcat 1:20 PM: moonman
- Wolfcat 1:20 PM: do you like to smonk ween and go zearching
- moonman31 1:34 PM: that's literally what i'm doing rn
- Dense 1:35 PM: Oh shit
- Wolfcat 2:21 PM: What are the "Truth Seekers" on the AO forums? Is that like a little club, or just another fancy name for mods?
- because I noticed Samuel was the leader of that user group, apparently
- Jos 2:21 PM: and Nocta a member
- moonman31 2:46 PM: Well uh\
- moonman31 2:46 PM: idk? I think it's just a forum thing
- Wolfcat 3:00 PM: I see
- Wolfcat 3:00 PM: like a cool kids club
- Wolfcat 3:00 PM: user group, i mean
- moonman31 3:02 PM: I think it's just a non-owner admin usergroup
- moonman31 3:02 PM: tbh friend
- Wolfcat 3:05 PM: oh ok
- Wolfcat 3:05 PM: no Illuminati then
November 20th, 2018
- At 9:46 AM, Moonman once again became active in the Discord server. The full chat can be read here. Below is a summary:
- Moonman doesn’t know anything about Kayd’s old friend Thomas, but he says Nocta might, further connecting “Kevin Hendricks” (Nocta) and “Kayd Hendricks”.
- Moonman knows of Hunter Jarvis because Jeremy spoke to him over Skype a few years prior.
- Moonman was an Internet Detective when he spoke to Jeremy, meaning Moonma is a former player.
- When asked if he is Tyler, Moonman says no.
- Moonman has read “Moon Magic”, the same book Greth was seen reading in “never sleeping”.
- Moonman often smokes weed.
- Moonman claims that the “Truth Seekers” group that Samuel Charleston and Nocta are a part of on the Astral Observatory forums is likely just a moderator group and nothing special.
- There is now speculation that Moonman may somehow be Greth, as the two share many similarities.
- At 7:07 PM, Nocta replies to ARGdov, claiming he is merely asking if ARGdov would like to be friends.
- At 7:10 PM, ARGdov replied to Nocta, saying he would be interested.
#johnisdeadtimeline
11/24/18 - Chat with Nocta
- nocta 5:36 PM: I have seen the most incredible light
- nocta 5:36 PM: It would be easy to assume you could change anything, but you can't
- nocta 5:36 PM: Why do you insist on this?
- nocta 5:36 PM: Really
- Jos 5:40 PM: Because is the right thing to do, doing otherwise would be illogical.
- nocta 5:40 PM: What is right?
- Wolfcat 5:42 PM: What exactly are you after?
- nocta 5:42 PM: What are you after?
- Jos 5:44 PM: Well, certanly hunting down a person since 2011 is not right. yet, we only want the safety of that person.
- Wolfcat 5:44 PM: Keeping our friends safe and uncovering the truth
- nocta 5:47 PM: So, you think infiltrating my forums and worrying my friends is the way to do it?
- Dense 5:49 PM: We are not worrying your friends
- Jos 5:50 PM: No, I did not infiltrate nowere, all the people there are cool and it has been nice to meet them, and i would still be around those forums to speak to those, the thing is, is that i want Tyler safe, you care for your freinds safety, so i want him to be safe too.
- Dense 5:51 PM: Also
- Dense 5:51 PM: Where
- Dense 5:51 PM: Is
- Dense 5:51 PM: Him
- Wolfcat 5:51 PM: We don't mean any ill will among the forum goers, but it's clear that this is all connected, and there is definitely something fucked up going on beneath the surface. If they are worried, then they probably have reason to be.
- Jos 5:53 PM: And do not confuse me, i seek the same truth no matter what group i may represent. Today I can be an ID, tomorrow i can be another thing if the truth is there.
- Dense 5:58 PM: :hidden: HOLY SHIT :hidden:
- Wolfcat 6:16 PM: Look, on the off-chance that you aren't in league with that cult, I promise you we mean no harm to your friends. However, we have more than enough evidence that proves you and your website is at least connected to it.
- nocta 6:26 PM: All things are easy to believe
- nocta 6:26 PM: When you have only been spoonfed information from one side of the story
- nocta 6:26 PM: That being said, you assume too much
- Jos 6:27 PM: Then help us see the other side so we can know whats going on
- Jos 6:27 PM: Please.
- Wolfcat 6:29 PM: Your own YouTube channel raises suspicion, not to mention the appearance of your site on Johnisdead.com. We're just as suspicious of that website as you all are, so you cannot blame us for being intrigued whenever you are randomly connected to it.
- Wolfcat 6:29 PM:If you have an explanation, then please tell us, but surely you can see why we're suspicious at best.
- Jos 6:31 PM: I think we may been deceived to be confronted, i mean, i think there is a third party controlling all of this, if you say there is another side of the story
- Jos 6:31 PM: if that is the case, confronting would be illogical, we need to put all the info in the table to see whats going on.
11/26/18 - Chat with Nocta and Moonman
- ((Moonman says that it's time to clear some things up))
- Dense 1:44 PM: Yeet the fuck
- nocta 1:44 PM: what are you doing?
- Jos 1:45 PM: okay
- Jos 1:45 PM: lets me search the meaning of that term first
- Dense 1:45 PM: Oh
- Jos 1:46 PM: oh, i see, yup, i'm against no one
- ((Moonman claims that no one in this chat is enemies with one another))
- nocta 1:46 PM: Idiot
- ((Moonman asks if Nocta can just let it go))
- nocta 1:46 PM: No.
- Jos 1:47 PM: sorry my lenguage is not english i think i fucked up a little up there, i am agaisnt no one, all friendly and nice
- ((Moonman says that Nocta was calling him an idiot, not Jos))
- Jos 1:47 PM: i see
- Jos 1:47 PM: Nocta, I think we need to clarify stuff, lets sit down, and lets talk cool
- nocta 1:48 PM: Ha.
- nocta 1:48 PM: I will see you all around.
- Jos 1:49 PM: Are you sure this is the correct route?
- Jos 1:49 PM: I hope so
- Jos 1:49 PM: He is like
- Jos 1:49 PM: "you are the bad guys oooo so lets talk about it nocta and he is like no0o0o0"
- ((Moonman claims that is not how the situation actually is))
- ((Moonman believes his life might actually be in danger at this point))
- moonman31 1:51 PM: but
- moonman31 1:51 PM: I can reveal some things that I could not before
- moonman31 1:51 PM: The more you discover
- moonman31 1:51 PM: The more I can reveal
- moonman31 1:51 PM: It seems.
- Jos 1:52 PM: So, you know about this "he is trapped?"
- Jos 1:52 PM: Could mean tyler, could mean Samuel who hasnt posted a single time
- ((Moonman claims he knows nothing about that phrase))
- Jos 1:52 PM: aw
- Jos 1:52 PM: so, what is the new stuff you can reveal?
- ((Moonman says he needs to know who all is in the chat))
- Jos 1:52 PM: ok
- Jos 1:52 PM: so, we have Wolfcat, me, Circle Hunter, Dense, Glad Mans, Bianca, and Raven
- Jos 1:52 PM: no one else
- Jos 1:52 PM: x
- Jos 1:52 PM: lets see if others are here
- Jos 1:52 PM: post x
- Wolfcat 1:55 PM: I think it's just you, me, jos, and raven
- ((Moonman says he believes there is a spy among our ranks))
- Jos 1:57 PM: I trust you, I have a theory but I don't want to reveal just to mantain stuff secure
- Jos 1:57 PM: anyway, i will find the spy soon or later
- Jos 1:57 PM: and i have the perfect idea
- Jos 1:57 PM: I see
- ((Moonman says "Well..."))
- Jos 1:57 PM: Nothing else? well, We will be careful with what we say... thank you
- Dense 2:03 PM: Oh nocta left
- ((Moonman says he was waiting for a response from us))
- Jos 2:04 PM: oh, sorry, non english native so idk when something follows a reply lol
- Wolfcat 2:04 PM: Dense is also here
- ((Moonman says "Obviously"))
- Jos 2:04 PM: so, why are you at line?
- ((Moonman says we are right about some things and wrong about others))
- Jos 2:04 PM: please, tell us the wrong part so we can see the both sides of the coin
- ((Moonman says we are right about "Greth"))
- Jos 2:04 PM: Well, he is probably Nocta? The Johnisdead page points to to it, and have bunch of evidence, still, it could be wrong info.
- Jos 2:04 PM: Nocta
- ((Moonman says that Greth is not Nocta, at least not as far as he knows))
- ((Moonman confirms that he is Greth, but he doesn't know us and Greth Vlogs is not familiar to him))
- ((Moonman says that he is not the person on the front page of Johnisdead, despite being Greth))
- Jos 2:04 PM: Sorry, I have no words, im confused... Then, the guy from the front page must be another guy who looks really the same
- Wolfcat 2:11 PM: It sounds to me like some stupid magic shit is going on
- Wolfcat 2:11 PM: More time bullshit
- Jos 2:11 PM: except if you cant remember
- Jos 2:11 PM: because of the sp00ky stuff
- Jos 2:11 PM: wait
- Jos 2:11 PM: then
- Wolfcat 2:13 PM: back when YSHDT.net was up, a lot of strange things were happening with various timelines converging into one another
- Wolfcat 2:13 PM: maybe this is still happening somehow
- Wolfcat 2:13 PM: as crazy as that sounds
- Jos 2:15 PM: what if there are 3 , you, the greth from the vlogs, and the sp00ky one
- Jos 2:15 PM: for some reason
- Jos 2:15 PM: what if Patrem has been converted into a vessel for Kevin who is using the vlogs greth as vessel?
- Jos 2:15 PM: idk,
- moonman31 2:16 PM: Now you're losing me
- Wolfcat 2:17 PM: I mean, that'd be a double vessel.
- ((Moonman says he doesn't know anything about that))
- Wolfcat 2:17 PM: It seems like either way, Nocta is Kevin
- Wolfcat 2:17 PM: That much we can be certain of
- Wolfcat 2:17 PM: At least to some extent
- ((Moonman asks about Patrem))
- Jos 2:17 PM: there is this entity called patrem, it needs a vessel to survive, a physical, weak body to assimilate,
- Jos 2:17 PM: in the greth videos and the jid page, everything reffering this entity, is purple
- Jos 2:17 PM: yet
- Jos 2:17 PM: in the jid page, nocta has been referring as this purple sp00ky greth
- Jos 2:17 PM: but nocta is kevin
- ((Moonman says he's not sure about that))
- Wolfcat 2:19 PM: Maybe the "Wayward cretin" is just fucking with us some more
- Wolfcat 2:19 PM: Tenebris, I mean
- Jos 2:19 PM: What im saying "Kelbris" needs a body, maybe kevin did the same when patrem was weak, and took over patrem and then used patrem to vessel this sp00ky greth, so, kevin would be nocta at the same time of Greth vlogs
- ((Moonman says there are some very dark things happening on Astral Observatory))
- ((Moonman says he's frustrated because he believes it might be too late to stop it))
- Jos 2:19 PM: i can use a proxy and access the truth part, if you are willing to help me...
- Wolfcat 2:20 PM: Do you know if there's any possible way for us to access The Truth?
- Wolfcat 2:20 PM: or is that still just completely out of reach
- ((Moonman says that the password has been changed and that he no longer knows it))
- Jos 2:21 PM: shit, i should have asked earlier, but i didnt wanted look like impolite
- CircleHunter 2:21 PM: I am here now
- ((Moonman says the old password was "pqbxhtlopa"))
- Wolfcat 2:21 PM: oh fuck
- Wolfcat 2:21 PM: shit
- CircleHunter 2:21 PM: Whoa
- Wolfcat 2:21 PM: the shit that was on jid.com
- Jos 2:22 PM: FUCK
- CircleHunter 2:22 PM: That means
- CircleHunter 2:22 PM:Try the current title
- Jos 2:22 PM: Now is when i want a tardis you know
- Jos 2:22 PM: The timer wont reset tought
- ((Moonman asks what timer Jos is referring to))
- Jos 2:22 PM: it was an old page in jid
- Jos 2:22 PM: just a referrence tho
- ((Moonman says that it reminded him of something))
- Jos 2:22 PM: what about?
- Jos 2:22 PM: maybe its important
- Jos 2:22 PM: i can provide old images of the page if that helps
- Wolfcat 2:26 PM: Maybe "pqbxh" and "tlopa" on JiD was merely a hint towards The Truth, and not something about Nocta
- CircleHunter 2:26 PM: Damn we were too late then
- CircleHunter 2:26 PM: Has jid changed?
- Wolfcat 2:27 PM: Not on my end
- ((Moonman says a post has been deleted since he lost access to The Truth))
- Jos 2:27 PM: i will find that post
- Jos 2:27 PM it must be the new password being hidden
- Wolfcat 2:28 PM: I think it was the post in The Truth
- Wolfcat 2:28 PM: There used to be two posts in there
- ((Moonman confirms he was talking about the post that was deleted in The Truth))
- CircleHunter 2:28 PM: I want to test something
- Jos 2:28 PM: aw
- Wolfcat 2:28 PM: And the older post was deleted
- Jos 2:28 PM: it was the old one right
- Wolfcat 2:28 PM: But the newer one remained
- CircleHunter 2:28 PM: Just to be absolutely sure here, you were around for jadusable and posted the new wave bossa nova, right?
- CircleHunter 2:28 PM: Or was that this other greth?
- ((Moonman says he did in fact submit the NWBN during YSHDT.net))
- CircleHunter 2:28 PM: Ok, hmm
- ((Moonman says that the timeline seems similar up to a point))
- ((Moonman begins acting strangely and posts "Kevin, Tyler, Tenebris))
- ((Moonman then deletes this post))
- CircleHunter 2:28 PM: Please tell me someone was paying attention to that
- CircleHunter 2:35 PM: Kevin, tyler, tenebris
- ((Moonman says "save please tyler"))
- Raven 2:37 PM: He's deleting everything
- Wolfcat 2:37 PM: We'll save Tyler.
- ((Moonman then says "no save please"))
- Jos 2:41 PM: what is going on
- moonman31 2:41 PM: tylers
- moonman31 2:41 PM: STOP IT
- moonman31 2:41 PM: EVERYTHING IS TYLER AND NOTHING IS TYLE
- Wolfcat 2:42 PM: Who's doing this to you?
- moonman31 2:43 PM: t\
- moonman31 2:45 PM: he
- moonman31 2:45 PM: is
- moonman31 2:45 PM: Today at 14:16
- ((Users noticed that Moonman’s post from 2:16 now had an alien emote reaction))
- ((Wolfcat posted an image of the Bow and Arrow))
- moonman31 2:47 PM: I feel ok
- moonman31 2:47 PM: for now
- moonman31 2:48 PM: what did you do?
- Wolfcat 2:49 PM: Can you tell us who he is? Do you know? The man with the alien mask?
- Jos 2:49 PM: lets say
- Jos 2:49 PM: its sp00ky stuff too
- moonman31 2:49 PM: The what
- Jos 2:49 PM: but we did it to save you
- Jos 2:49 PM: wait, you cant remember? few seconds ago
- moonman31 2:50 PM: The man with the alien mask?
- Wolfcat 2:51 PM: Was he not the one who was just hurting you?
- moonman31 2:52 PM: I don't know what does that
- Jos 2:54 PM: lets see if this works ?
- ((Jos posts Epona's Song))
- moonman31 2:55 PM: ???
- moonman31 2:55 PM: Wait are you
- moonman31 2:55 PM: god,im ((this was originally a cipher))
- moonman31 2:55 PM: hold on
- moonman31 2:55 PM: someone is at the door
- Jos 2:55 PM: ok
- Wolfcat 2:55 PM: wait no
- Jos 2:55 PM: but dont open
- Wolfcat 2:55 PM: don't pull this
- Jos 2:55 PM: waito
- Wolfcat 2:56 PM: dude you KNOW this never ends up well
- Jos 2:56 PM: before he opens the door
- ((Jos posted an image of the Stone Mask))
- ((Moonman then posted the message "too late"))
November 24th, 2018
- At 12:09 PM, Zero noticed that Astral Observatory was offline.
- At 2:29 PM, Deadhead discovered that the site was now online, now with a new post from Nocta: “Today we had a small DDOS attack on our servers. This caused our account to be temporarily suspended. It would be easy to say it was the “Internet Detectives”, but I can’t be sure that is the case. It would be inappropriate of us to try and assume anything in this instance, so we will move forward, as we have always planned” This post had random letters that were bolded. Once the letters were put together they spelled out “he is trapped”
- At 3:18 PM, Jos found a new page on JiD - https://www.johnisdead.com/heistrapped.html. This page featured a mirrored image of a pained Greth named “trapped.gif” with the title “trapped”, with a midi version of the Astral Observatory theme from Majora’s Mask playing named “astral.mp3″.
- At 3:55 PM, Wolfcat discovered that by using view-source, the coding for astral.mp3 contained a cipher that translated to: “what do you think you can do to save them”
- At 5:36 PM, Nocta joined the Discord server containing Moonman. The entire chat can be read here. Below is a summary.
- Nocta says we cannot change anything.
- Nocta asks us what we believe is right and questions our goal.
- Nocta says that we’ve only been seeing one side of the story.
#JohnIsDeadTimeline
11/26/18 - Chat with Moonman
- moonman31 4:41 PM: I have returned for now
- Jos 4:41 PM: What happened?
- moonman31 4:41 PM: Someone came over and
- moonman31 4:41 PM: idk I felt like I had to go with them
- Jos 4:41 PM: thats a bad sing, you know that
- Jos 4:41 PM: you dont remember who?
- moonman31 4:42 PM: of course I do
- Jos 4:43 PM: who were they then lol
- moonman31 4:46 PM: no one of importance
- Jos 4:46 PM: ok ok
- Dense 4:48 PM: Ey hi
- moonman31 4:49 PM: yo.
- Dense 4:50 PM: How are you?
- moonman31 4:50 PM: idk i feel weird tbh
- moonman31 4:50 PM: I feel like I have to go somewhere
- moonman31 4:50 PM: but I don’t know where
- Jos 4:51 PM: try to resist, this is sign of a sp00ky thing and it sounds bad
- moonman31 4:51 PM: *sign
- Jos 4:51 PM: sorry
- moonman31 4:52 PM: all good
- Jos 4:52 PM: i have an idea
- Jos 4:52 PM: you are feeling like you need to go somewhere, what if you open google maps, and watch over your place and see where you feel you have to go, just saying i know it sounds weird but more weird is that feeling
- Jos 4:52 PM: and show us
- moonman31 5:00 PM: what
- Jos 5:00 PM: idk
- Jos 5:00 PM: just trying to help you know where are you feeling to go lol
- Jos 5:00 PM: i mean, when you forget something and try to recall it watching stuff, the same but seeing maps so you can tell where are you feeling to go
- Jos 5:00 PM: but nvm if its weird its weird sorro
November 26th, 2018
- At 1:44 PM, Moonman and Nocta began chatting in the Discord server. The full chat can be read here. Below is a summary:
- Moonman says that no one in the chat is enemies with one another.
- Nocta scoffs at this and calls him an idiot before leaving the server.
- Moonman says the situation with Nocta isn’t how we think it is.
- Moonman says that his own life might be in danger at this point.
- Moonman says the more we discover, the more he is able to reveal.
- Moonman knows nothing about the “heistrapped” page on Johnisdead.
- Moonman believes a spy is among the Internet Detectives.
- Moonman reveals that he is Greth, but he does not know us and does not remember the events of Greth Vlogs, and while the Greth on Johnisdead.com looks like him, it isn’t him.
Moonman asks about Patrem, not knowing much of him. He does manage to relate him to Kelbris, however. - Moonman says some dark things are happening on Astral Observatory, and that he’s frustrated that it might be too late to stop it.
- Moonman says that he hasn’t been able to access The Truth since they changed the password, which used to be “pqbxhtlopa”, two ciphers seen on Johnisdead.com.
- Moonman says that after he lost access to The Truth, a post was deleted from it.
- Moonman says he indeed took part in the original run of YSHDT.net, having posted the New Wave Bossa Nova.
- Moonman says he believes events between our point of view and his are the same up to a certain point, claiming that it all deals with “Kevin, Tyler, and Tenebris”.
- Moonman begins deleting a lot of his posts, writing “save please tyler” and “EVERYTHING IS TYLER AND NOTHING IS TYLE”.
- When asked who is causing him to act strangely, Moonman posted an emoji of an alien, hinting that it is The Watcher.
- Users posted the Bow and Arrow in an attempt to ward off The Watcher. It seems to have worked and Moonman returns to normal.
- When asked about the man with the alien mask, Moonman claims he doesn’t know who we’re talking about, claiming that he doesn’t know what hurts him like that.
- Users posted Epona’s Song, causing Moonman to ask what someone is doing and a cipher that translates to “god,im”, then claiming that someone is knocking on his door.
- Users post the Stone Mask, but a message appears from Moonman’s account reading “too late”.
- At 4:41 PM, Moonman returned and had another short chat, found here. A summary is below:
- Moonman says someone came to his house and he felt he needed to follow them.
- Moonman says their identity was of no importance, but he still has the weird urge to travel somewhere.
#JohnIsDeadTimeline
I wanted to join.. but, none of your links work.
This is our Discord link: https://discord.gg/UPykX3q
November 30th, 2018
- At an unknown time, ARGdov notices a PM he had received from Nocta the previous day: “Just keep an open mind to possibilities and we will get along well.”
- At 9:30 PM, ARGdov responds to this PM, reiterating his eagerness and patience to learn more about what knowledge Nocta may be hiding.
#timeline
#JohnIsDeadTimeline
January 11th, 2019
- At an unknown time, Escape p.2 (https://www.youtube.com/watch?v=cbYmqT_HqHM&feature=youtu.be) was uploaded to Greth Vlogs. This video begins with a man and a woman, presumably Greth and some yet unknown character, driving through the woods. They briefly converse. Though it is difficult to make out exactly what is being said, it seems as though the woman asks Greth if he is recording. After Greth says he is, the woman proceeds to give him directions. The video then shows Greth walking through the woods. At the end of the video, a loud noise plays as a pixelated image of Mac Tonight appears, a character associated with Moonman. The video’s description reads “You weren’t supposed to have this”. This is likely meant to take place after a previous Greth Vlogs video, “Escape”.
#timeline
#JohnIsDeadTimeline
January 21st, 2019
- At 12:20 AM, Yuukichan creates a thread asking if anyone has visited any haunted houses. (https://astralobservatory.net/forum/viewtopic.php?f=4&p=435&sid=553b79829b73145068005ac3dfb0db90#p434)
#timeline
#JohnIsDeadTimeline
Artist: Unknown
Track: mater.mp3
johnisdead.com update 1/27/19
#audio
January 27th, 2019
- At 11:42 PM, Yuuki posts another reply, expressing her frustrations over the corrupted picture files: “ugh these files are still corrupted. I’m sorry. I’m really trying. I wish I could will things into existence”. Players quickly noticed that the “i” in “existence” was a link to https://astralobservatory.net/forum/johnisdead.com/hh.html. Though this page did not exist on Astral Observatory, it pushed players towards a new page on johnisdead.com - (https://johnisdead.com/hh.html). This page featured a gif titled “hh.gif” (http://internetdetectives.tumblr.com/post/182555618733/hhgif-johnisdeadcom-update-12719), likely standing for haunted house, which displayed various photos of the inside of an old home rapidly flashing. The title of the page read “case file”. The page also had an audio file titled “mater.mp3” (http://internetdetectives.tumblr.com/post/182555566408/johnisdeadcom-update-12719) which was a melodic piano theme with the sound of a reversed voice at the end saying “Stop”. “Mater” is latin for “Mother”, further implying that this haunted house belonged to Yuuki, as she described her mother suffering from the effects of paranormal activity.
#timeline
#JohnIsDeadTimeline
January 30th, 2019
- At 12:52 PM, Kaiden_Zoromichi made a post (https://astralobservatory.net/forum/viewtopic.php?f=4&t=66&start=10#p502) implying he has experience with time travel. He continues to say he will explain his experiences in a YouTube series at some point. Whether or not he is simply roleplaying is unknown.
#timeline
#JohnIsDeadTimeline
January 31st, 2019
At 11:20 PM, a new comment from Greth Vlogs was discovered on Escape Pt.2 containing some binary. After ciphered, this message solved to the following: “"upon several worlds did these men stumble, each world only slight less and more than the last. inviting themselves into these folds allowed their conscious too see her”“
#timeline
#JohnIsDeadTimeline
How could you summarize the John is dead timeline for someone
Wolfcat has written a summary, it’s a nice read.
https://johnisdead.fandom.com/wiki/Story
February 1st, 2019
- At 3:46 PM, Jos discovered that https://www.johnisdead.com/heistrapped.html had been added to the list of redirects on Johnisdead.com. (Screenshot)
- At 3:53 PM, Jos noticed that Greth Vlogs’ profile picture had been changed to an upside-down image of Greth’s face with a purple filter. (Image)
- At 6:59 PM, Moonman posted another link to vaporwave in a thread about controlling the weather. (https://astralobservatory.net/forum/viewtopic.php?f=4&t=68&p=535#p535)
#timeline
#JohnIsDeadTimeline
Hey what’s poppin’ boys, doing some timeline updates after 3 months of being lazy let’s GO. We’re likely to get some more activity tomorrow since it’s 4/23.
-Wolf
2/4/19 - Chat with Moonman
moonman31 11:14 PM: “Apparently your buddy is being indoctrinated”
Wolfcat 11:15 PM: “Shit, you mean Dov or Tyler?”
moonman31 11:15 PM: “Dov”
Wolfcat 11:17 PM: “We did notice his role shift on the forums”
moonman31 11:17 PM: “Nocta just made a post to us saying he was one of us now.”
moonman31 11:17 PM: “He also purged the previous content in there”
Wolfcat 11:17 PM: “Oh yeah, in The Truth”
moonman31 11:18 PM: “No I mean, he didn't just delete an old topic, he went into the current topic and deleted the text.”
moonman31 11:18 PM: “That means he gave Dov the password”
moonman31 11:18 PM: “He does that everytime he gives it out.”
Mugen Kagemaru (K◊) 11:19 PM: “Got some archive of the old text?”
moonman31 11:20 PM: “I can't give you that”
moonman31 11:20 PM: “And even if I could”
Mugen Kagemaru (K◊) 11:20 PM: “Feh. Worth a shot”
moonman31 11:20 PM: “I don't have one.”
Mugen Kagemaru (K◊) 11:20 PM: “Simple "no" would've sufficed”
moonman31 11:20 PM: “there's a reason he deletes that shit though”
moonman31 11:20 PM: “It means that if you got that info now then he knows it”
moonman31 11:20 PM: “wasn't Dov, which means he'd suspect me”
moonman31 11:20 PM: “If that info does get reposted and then you get it, then he might suspect Dov”
moonman31 11:20 PM: “I can't be sure though.”
moonman31 11:20 PM: “Anyways I can't stay this was risky as is.”
Wolfcat 11:22 PM: “Thanks for the heads up, we'll be sure to be careful.”
Wolfcat 11:22 PM: “One last thing though, were you responsible for the video uploaded to Greth Vlogs? Escape pt. 2?”
moonman31 11:23 PM: ((Winking Emoji))
moonman31 11:23 PM: “Also keep an eye out on yuuki”
moonman31 11:23 PM: “Something is not good there”
moonman31 11:23 PM: “Okay goodbye”
Mugen Kagemaru (K◊) 11:25 PM: “...”
moonman31 11:31 PM: ”okay wait”
moonman31 11:31 PM: “actually”
moonman31 11:31 PM: “I have returned temporarily because some shit is going down”
moonman31 11:31 PM: “and now he's promoted CelestialLight”
Wolfcat 11:31 PM: “what the fuck”
moonman31 11:31 PM: “I thought I would let you know because this never happens and I am concerned”
Mugen Kagemaru (K◊) 11:32 PM: “Bruh, you're gonna draw some trouble if you stay.”
moonman31 11:32 PM: “You're actually right”
moonman31 11:32 PM: “Ok bye”
Wolfcat 11:33 PM: “Why would he promote suxx?”
February 4th, 2019
- At an unknown time, ARGdov had been promoted to the “Believer” rank, giving him access to The Truth board.
- At 11:14 PM, Moonman entered the Discord server to discuss this with the players. (http://internetdetectives.tumblr.com/post/184367929768/2419-chat-with-moonman) Below is a summary:
- Moonman says ARGdov has access to The Truth.
- Nocta has purged The Truth, which he does every time he gives someone the password.
- Nocta is watching to see if the information in The Truth spreads so that he’ll know if one of the Believers is leaking info.
- Moonman was the one who uploaded “Escape pt.2″ to Greth Vlogs.
- Something is wrong with Yuukichan.
- Another user, CelestialLight, has also been given the Believer role, and Moonman isn’t sure why.
- At 11:35 PM, ARGdov discovered a PM sent to him by Nocta: “I’ve been watching. I have recently removed some sensitive material from The Truth, but you now have access to this forum which is mostly empty, for now. The current password is ((REDACTED)). I change it every time new material is posted in there.”
- At 11:37 PM, The Truth posts were found:
- A thread posted by Nocta at 11:15 PM titled “Welcoming a new brother into our fold.”
- Nocta 11:15 PM: “ARGDov has officially been welcomed into our ranks, though he does not yet know our true purpose. These coming weeks it will be upon all of you– and if any of our other former members rejoin, them as well– to teach him about us and our mission.”
- Moonman 11:33 PM: “Okay that is an understandable thing my broham my dude my leader man But you have also promoted CelestialLight??? What the shit is happening.”
- Yuukichan 11:36 PM: “OMG ARGDOV WELCOME!~~~~~~~”
- A thread posted by Nocta months ago on November 5th, 2018 at 1:57 PM: “Internet Detectives”
- Nocta 1:57 PM: “[original post has been pruned]- nocta”
- At 11:48 PM, ARGdov responded to the welcoming thread in The Truth, thanking the others for adding him and expressing his desire to learn more.
- At 11:49 PM, Yuukichan responded to the same thread in reference to CelestialLight being promoted: “Yay!! She PMs me a lot ^________^”
- At 11:53 PM, ARGdov begins PM’ing Yuukichan in hopes of learning more information form her. As of yet, only formalities have been spoken between the two. If any important information comes to light, this section will be updated.
#timeline
#JohnIsDeadTimeline
February 5th, 2019
- At 12:22 AM, NotAHoax responds to ARGdov’s welcoming thread in The Truth: “Welcome to the ranks, brother.”
- At 12:38 AM, Yuukichan responds to a user posting hh.gif (http://internetdetectives.tumblr.com/post/182555618733/hhgif-johnisdeadcom-update-12719) in her “Haunted houses” thread. “T-those are the pictures! O O ;;; Even now they creep me out… I swore I saw a face in my viewfinder a couple times…They also came out really grainy and low res even though my camera’s pretty good…” (https://astralobservatory.net/forum/viewtopic.php?f=4&p=593#p583)
- At 12:07 PM, Wolfcat sends Yuukichan a PM: “Hey, this is just something I was wondering after seeing the haunted house thread. Forgive me if this is a personal question, but is the haunted house you visited the same house that had the writing on the walls? The one you posted a picture of a while back?”
#JohnIsDeadTimeline
#timeline
February 11th, 2019
- At 9:43 PM, Yuukichan replied to Wolfcat’s PM with the phrase “the woods” posted 110 times in a row.
#timeline
#JohnIsDeadTimeline
March 2nd, 2019
- At 10:49am,m ID member Jos discovered an update to johnisdead.com:
- the main page was titled: “Go there”
- the background image was titled: “hitilp.gif” and was of Tyler (https://internetdetectives.tumblr.com/post/184379764138/)
- the audio on the page was: “future.mp3” (https://internetdetectives.tumblr.com/post/184379860993/)
- There was nothing hidden in the source code
- At 10:54am, a new page was discovered: “/hitilp.html”
- the page title was: “here”
- the BG image was: “p_message_from.jpg” (https://internetdetectives.tumblr.com/post/184380437413/) The runes depicted on the image read: “He is waiting. Gift giving. he will be seeing you soon.”
- the audio was: “misrem_old.mp3” (https://internetdetectives.tumblr.com/post/184380513183/)
- At 1:20pm, it was discovered that the image “p_message_from.jpg” could be opened by a .zip file manager to reveal hidden content:
- a video file named: “t.mp4” (https://youtu.be/JsUb7wnAUZs) This video appears to be Tyler running through his property, then a figure (pressumably John/Tenebris) jumps out at him.
- a 2nd video file named: “j.mp4” (https://youtu.be/edmO6CTbyFA) This appears to be a video of a guy starting a car.
- an image file named: “messagefrom_.jpg” (https://internetdetectives.tumblr.com/post/184381938913/) (a breakdown of the runes depicted can be found here: https://internetdetectives.tumblr.com/post/184382019378/)
#timeline
#JohnIsDeadTimeline
4/22/19 - Chat with Moonman
moonman31 1:44 PM: "okay”
moonman31 1:44 PM: "this is epic”
Jos 1:44 PM: "Hey moonman”
Mugen Kagemaru 1:44 PM: "Well, well!”
Jos 1:44 PM: "high?”
moonman31 1:45 PM: "Not at all”
Jos 1:45 PM: "Ah”
Jos 1:45 PM: "tell us whats epic”
Jos 1:45 PM: ": p”
moonman31 1:45 PM: ":stuck_out_tongue:”
moonman31 1:45 PM: "Ascension!”
Mugen Kagemaru 1:45 PM: "... What.”
moonman31 1:45 PM: "Bet I had ya scared for a second”
Jos 1:46 PM: "Except the part of the death, ascension is cool ?”
Mugen Kagemaru 1:46 PM: "Nah, just unamused”
Dense 1:46 PM: "Hey moon”
moonman31 1:46 PM: "Actually I have been laying low”
moonman31 1:46 PM: "I'm sure you noticed”
Mugen Kagemaru 1:46 PM: "Kinda hard not to”
Wolfcat 1:46 PM: "mugens balls were bursting in fear”
Mugen Kagemaru 1:46 PM: "Not here boy”
Mugen Kagemaru 1:46 PM: "@moonman31”
Mugen Kagemaru 1:46 PM: "So what's this thing you were calling epic a few minutes ago?”
Jos 1:47 PM: "ascension!”
Mugen Kagemaru 1:47 PM: "Stop switching accounts, it's not funny.”
moonman31 1:47 PM: "I have been spending my time professionally stalking ya boys”
moonman31 1:47 PM: "and not using much internet beyond that”
Mugen Kagemaru 1:47 PM: "Oh this should be good.”
Mr t series good 1:48 PM: "who is axis”
Mugen Kagemaru 1:48 PM: "Visitor. Pay her no mind.”
moonman31 1:48 PM: "So I am basically pretty sure Nocta knows I cannot be trusted anymore 100% so I'm basically on his shitlist now since he assumes that part of the forums got posted to Dumblr”
Mugen Kagemaru 1:49 PM: "Haven't seen any of that, so I dunno what drugs he's doin.”
moonman31 1:49 PM: "I surprisingly think he still trust Dov though which was the point”
moonman31 1:49 PM: "You need him there and I cannot really give you the inside scope anymore”
Mugen Kagemaru 1:50 PM: "You never could in the first place, if I recall.”
Mugen Kagemaru 1:50 PM: "Or has that restriction been lifted?”
moonman31 1:50 PM: "Man you are cranky :moonman:”
Dense 1:50 PM: "Oh fuck”
moonman31 1:50 PM: "Ok check this”
Mugen Kagemaru 1:50 PM: "Might have something to do with Wolf and Jos, but by all means, please carry on.”
moonman31 1:50 PM: "I didn't mean Nocta when I said I was stalking ya boys”
moonman31 1:50 PM: "I meant I've been looking into a few things about our pretty unique situation”
moonman31 1:50 PM: "I had access to some stuff I can no longer access”
moonman31 1:50 PM: "Secret website shit”
moonman31 1:50 PM: "I'm not an elite hacker but there's a subspace of the observatory for all the neato cult stuff you all suspect is there anyway”
moonman31 1:50 PM: "And I was reading some garbage about parallelos and stuff is making a whole lot more sense”
Mugen Kagemaru 1:53 PM: "Oh shit son”
Dense 1:53 PM: "Damn”
Dense 1:53 PM: "Wich means”
moonman31 1:54 PM: "But the most immediate concern for y'all is what's up with my alt handle in your place”
Mugen Kagemaru 1:54 PM: "Exactly right, Dense”
Dense 1:54 PM: "Nocta is 100% ascended”
moonman31 1:54 PM: "Greth”
Dense 1:54 PM: "Ohfuck”
Dense 1:54 PM: "U rite where da fuck is greth”
Jos 1:54 PM: "Im back”
Dense 1:55 PM: "Joso”
Mugen Kagemaru 1:55 PM: "That account's been active in my abse - Wait what?”
Jos 1:55 PM: "No im back”
Jos 1:55 PM: "tell me dense”
moonman31 1:55 PM: "I'm pretty sure from some email snippets that shit is about to get heavy but I literally don't understand what the fuck they were talking about”
Dense 1:55 PM: "Just hi”
moonman31 1:55 PM: "Just they were talking about it a LOT”
moonman31 1:55 PM: "and it seemed bad”
Jos 1:55 PM: "Hi brother”
Mugen Kagemaru 1:55 PM: "I was gonna say, it was inactive up to when I left, but y'all are saying it's not there no more?”
moonman31 1:56 PM: "That's the first bit of news”
Jos 1:56 PM: "So, another subpage, the forums is a subpage, as there is one hidden huh”
moonman31 1:56 PM: "The second bit of news is an apology”
moonman31 1:56 PM: "For the bots.”
Mr t series good 1:57 PM: "that was you huh”
moonman31 1:57 PM: "I needed to slow down nocta so I literally invited scambots”
moonman31 1:57 PM: "sorro.”
Dense 1:57 PM: "Oh shit”
Mugen Kagemaru 1:57 PM: "@Jos More like the forums are the surface page and this LC shit is a subpage.”
Dense 1:57 PM: "So it was you”
Jos 1:57 PM: "That is a good strategy”
Wolfcat 1:57 PM: "no need to apologize”
Wolfcat 1:57 PM: "thanks for the local russian hookers”
Jos 1:58 PM: "Can you send spam bots to luna to slow her down jk”
moonman31 1:58 PM: "The problem is I never had control of them per se but at least it worked for a while”
Mugen Kagemaru 1:58 PM: "So how much can you tell us, whether it makes sense or not, about what they're talking about in this subpage?”
Mugen Kagemaru 1:58 PM: "Like maybe we can interpret”
moonman31 1:58 PM: "Something is going to happen with some sort of agent of Luna”
Mugen Kagemaru 1:59 PM: "Did they say what and whom? I know it likely doesn't make sense, but did they actually say it?”
moonman31 1:59 PM: "They want to bring the final piece of the puzzle into place”
Mugen Kagemaru 1:59 PM: "Hmm…”
moonman31 1:59 PM: "I know it involves the parallelos”
Jos 1:59 PM: "Tyler is already taken i guess”
Mugen Kagemaru 2:00 PM: "Bruh I get it, it don't make sense, but maybe they actually said the words?”
moonman31 2:00 PM: "I was never fully indoctrinated as you might say so I was pretty much at the same level as Dov”
Mugen Kagemaru 2:00 PM: "Meaning you won't tell us what they said literally because it doesn't make sense. Fine, whatever. We'll move on.”
moonman31 2:00 PM: "I know the real hard core cult is nocta, yuuki, kaiden”
moonman31 2:00 PM: "Samuel too”
Mugen Kagemaru 2:01 PM: "Welp, that's not good.”
Jos 2:01 PM: "Hoax is just there, in the middle…”
Wolfcat 2:01 PM: "Damn”
Wolfcat 2:01 PM: "whats up with yuuki”
Wolfcat 2:01 PM: "she sent me a weirdass PM just saying "thewoods" like 100+ times”
moonman31 2:01 PM: "She's been around on discord but neither of us has posted”
moonman31 2:01 PM: "I think she's conflicted on some things”
Jos 2:02 PM: "Why all the waifus turns out to be dangerous”
Mugen Kagemaru 2:02 PM: "@Wolfcat“
Mugen Kagemaru 2:02 PM: "I remember that, when was it again?”
Wolfcat 2:02 PM: "sometime in february”
Mugen Kagemaru 2:02 PM: "Hmm…”
Jos 2:02 PM: "when the haunted house gif was a thing”
Wolfcat 2:02 PM: "also im guessing you can't just show us this "subspace" on AO right”
Mugen Kagemaru 2:03 PM: "Yeah she said when she went to the house she learned things about The Truth that she didn't know before, which is why I thought it was dangerous for the pics to be shared carelessly.”
moonman31 2:03 PM: "I mean possibly”
moonman31 2:03 PM: "Actually”
moonman31 2:03 PM: "but I'd need time to figure out the new password”
Mugen Kagemaru 2:04 PM: "That implies it can already be seen by normal users…”
Wolfcat 2:05 PM: "just got a weird PM: " from nocta”
Wolfcat 2:05 PM: “"Tengo un diablo en mis pantalones"”
Wolfcat 2:05 PM: “wait nvm that was from jos my bad”
Mugen Kagemaru 2:06 PM: "..."
Mexican Nocta 2:06 PM: "Me cachis”
Mexican Nocta 2:06 PM: "me equivoque”
Mexican Nocta 2:06 PM: "buenas tardes”
Mugen Kagemaru 2:06 PM: "•headdesk•”
Jos 2:07 PM: "Wrong multiverse brother”
Mr t series good 2:08 PM: "mugen losing hope as always”
moonman31 2:09 PM: “”mugen losing hope as always””
moonman31 2:09 PM: "a motivational poster”
Jos 2:09 PM: "i must print one of those”
Jos 2:10 PM: "So yeah, I had the feeling the forums were just a façade”
moonman31 2:10 PM: "not really”
moonman31 2:10 PM: "more like a recruitment tool”
moonman31 2:10 PM: "but uh I had experience with the Moon Children as you know so the things set of my alarms big time and I wanted in to go undercover and it worked for a long ass time”
moonman31 2:10 PM: "I think I'm blown now though”
Mr t series good 2:12 PM: "F”
moonman31 2:12 PM: "F”
Jos 2:12 PM: "Will try to find this, true webpage, there must be a connection somewhere”
moonman31 2:13 PM: "technically speaking I'm still an Astral Child”
moonman31 2:13 PM: "but I have a feeling this is going to come to a bad place soon”
moonman31 2:13 PM: "since I'm obviously some kind of traitor”
Mugen Kagemaru 2:13 PM: "Yeah man you may wanna run for it and keep away from their places.”
moonman31 2:13 PM: "that's the idea
Jos 2:14 PM: "And develop somekind of telepathic resistance, you know their powers”
Jos 2:14 PM: "i tried”
moonman31 2:15 PM: "you should also know there used to be a bunch more members of the forums that have not rejoined”
Jos 2:16 PM: "I guess Samuel is one of them”
moonman31 2:16 PM: "that concerns me, it's been a longass time since we've been back”
moonman31 2:16 PM: "I mean at least he has an account?”
Jos 2:16 PM: "Yeah”
Jos 2:16 PM: "This is weird”
Jos 2:16 PM: "But i hope the cult didn't do anything to silence them…”
Jos 2:16 PM: "for x reason”
Wolfcat 2:18 PM: "i might have asked this already i not sure tbh”
Wolfcat 2:18 PM: "but do you know exactly what was happening in the vid you uploaded to greth vlogs”
Wolfcat 2:18 PM: "like who was the lady in that vid”
moonman31 2:19 PM: "Yeah that was something I grabbed from the site”
moonman31 2:19 PM: "I was still trying to let you know I was feeding info without tipping off nocta”
moonman31 2:19 PM: "but that was the point where he started monitoring my traffic”
moonman31 2:19 PM: "shit was cash i got a vpn”
moonman31 2:19 PM: "that only worked for so long”
Jos 2:20 PM: "The thing is that this lady knew where to go, she had to give signs to this Greth to reach the place, whatever it is, i think the lady knows more”
Wolfcat 2:20 PM: "i suspected it might have been yuuki :thinking:”
Jos 2:20 PM: "Well, Nocta is theorized to be this being capable to controling electronic stuff, you could hide everything, but if he can sense it... its hard”
moonman31 2:21 PM: "uh what”
moonman31 2:21 PM: "idk about all that he owns the domain and forums so he probably just started intensely watching IPs”
moonman31 2:21 PM: "which he did after I uploaded that vid by getting into that youtube account”
moonman31 2:21 PM: "so in retaliation I flooded the place with scambots”
moonman31 2:21 PM: "and used a vpn to blend in”
moonman31 2:21 PM: "but that only worked for so long”
Jos 2:22 PM: ""30 hot chicks near 21 km, what are you waiting for? click here"”
Mugen Kagemaru 2:23 PM: "@moonman31 But yeah do you know who's who in the video?”
moonman31 2:23 PM: "no clue”
moonman31 2:23 PM: "I just grabbed the file off the server because it seemed important and chucked it your way”
moonman31 2:23 PM: "the stuff i was seeing vs what I could directly share was always in conflict”
moonman31 2:23 PM: "I knew the instant I finally gave you a file or two”
moonman31 2:23 PM: "the war between the traitor and nocta would escalate”
moonman31 2:23 PM: "and that's exactly what happened”
Mugen Kagemaru 2:25 PM: "Wait that's a new thing”
Mugen Kagemaru 2:25 PM: "Who's this traitor you're talking about?”
Jos 2:25 PM: "moonman”
moonman31 2:25 PM: "...”
Mugen Kagemaru 2:25 PM: "I've been out of the loop lately”
Jos 2:25 PM: "he just said it top there”
Jos 2:25 PM: "he is a traitor to the astral children”
Mugen Kagemaru 2:25 PM: "A'ight a'ight”
moonman31 2:26 PM: "We're not 'the Astral Children'”
Mugen Kagemaru 2:26 PM: "You used that phrase though”
moonman31 2:26 PM: "no, cult members self identify as an Astral Child”
Mugen Kagemaru 2:26 PM: "Anyway, like I said, I've been out of the loop, seemed like something these guys learned after I left.”
Jos 2:26 PM: "okay”
moonman31 2:26 PM: "'I am an Astral Child'”
moonman31 2:26 PM: "but we are the Astral Observatory”
Wolfcat 2:29 PM: "More like the Ass observatory”
Wolfcat 2:29 PM: "but forreal tho”
Mugen Kagemaru 2:29 PM: "That's more referring to that one thing Eve has.”
Wolfcat 2:30 PM: "Ass?”
Mr t series good 2:30 PM: "Uh, i dont know what you on about”
Mugen Kagemaru 2:30 PM: "@Wolfcat Asstral Observatory”
moonman31 2:32 PM: "I'm still waiting for this one guy to join”
moonman31 2:32 PM: "he had the best selfies to meme”
Mugen Kagemaru 2:33 PM: "Oh? What's the name, we'll watch for him too”
moonman31 2:33 PM: "IsoscelesAssassin”
Mugen Kagemaru 2:34 PM: "Better than "ScaleneKiller"”
Mr t series good 2:34 PM: ":rofl:”
moonman31 2:34 PM: "There was also the Spanish guy”
Mr t series good 2:34 PM: "spanish guy?”
Mr t series good 2:34 PM: ”:thinking:”
moonman31 2:35 PM: "Yeah I don't remember his handle though”
Mugen Kagemaru 2:35 PM: "Jordi something, I think. (Kidding)”
moonman31 2:35 PM: "no”
Mr t series good 2:35 PM: ":joy:”
Mugen Kagemaru 2:35 PM: "I'm kidding, dude.”
Jos 2:35 PM: "jos, dense,,”
Jos 2:35 PM: "Ummm”
Jos 2:35 PM: "thinking”
Mr t series good 2:35 PM: "well i guess we dont know that spanish guy”
moonman31 2:35 PM: "oh, pardon, if that was a reference™ I didn't get it”
Jos 2:36 PM: "jacobtheguy”
Mugen Kagemaru 2:36 PM: "More of a joke, and don't worry, we'll explain someday”
Jos 2:36 PM: "idk”
Mugen Kagemaru 2:36 PM: "You're not the only one under restrictions”
April 22nd, 2019
- At 1:44 PM, Moonman entered the Discord server. The full conversation can be read here (https://internetdetectives.tumblr.com/post/184393963073/42219-chat-with-moonman) below is a summary:
- Moonman has been inactive because he has been covertly watching us and members of the Astral Observatory.
- Nocta no longer trusts Moonman because confidential information was posted on the Internet Detectives tumblr (oops).
- There is a secret section of Astral Observatory aside from The Truth where cult subjects such as Parallelos are discussed. Moonman says this information made our situation “make more sense” to him.
- Moonman read some email snippets from others in the Astral Observatory and believes something bad is about to happen, though he didn’t understand exactly what they were discussing, it seems to involve Greth.
- Moonman is responsible for the spambots on Astral Observatory and used the to slow down Nocta.
- “Something is going to happen with some sort of agent of Luna. They want to bring the final piece of the puzzle into place. I know it involves the parallelos”
- Moonman was never fully indoctrinated so he doesn’t know much more than the players.
- Nocta, Yuuki, Kaiden, and Samuel are within the inner circle of the cult.
- Yuuki hasn’t been too active and is conflicted on something.
- It would be possible for players to gain access to this secret part of Astral Observatory but we would need a password.
- The Astral Observatory Forums can be viewed as a “recruitment tool” for the cult.
- “Escape pt.2″ was a video Moonman discovered on the Astral Observatory, and he doesn’t know who the people in it are.
- There are still other members who have not joined the forums yet.
#timeline
#JohnIsDeadTimeline
4/23/19 - Chat with Moonman
moonman31 5:50 PM: "big news boys”
Mugen Kagemaru 5:50 PM: "?”
Jos 5:50 PM: "hello friend”
Jos 5:50 PM: "bad news i guess”
moonman31 5:51 PM: "https://www.youtube.com/watch?v=V3KuJCX54Bo - this is my theme song”
moonman31 5:51 PM: "but more importantly”
moonman31 5:51 PM: "I have convinced someone to give me some cool stuff”
Jos 5:51 PM: "yeah?”
moonman31 5:51 PM: "I may have acquired some new videos”
Jos 5:52 PM: "Send the producto, amigo”
Mugen Kagemaru 5:52 PM: "I take it that's the ones I linked above?”
moonman31 5:52 PM: "no sir”
moonman31 5:52 PM: "they're taking a while to render and upload so be patient”
moonman31 5:52 PM: "but I am hijacking someone's youtube to do this”
moonman31 5:52 PM: "I already got ya one”
Jos 5:52 PM: "silentdork”
moonman31 5:52 PM: "sacredartifact.mp4”
Jos 5:52 PM: "ah”
Mugen Kagemaru 5:52 PM: "Yep I posted that one above”
moonman31 5:53 PM: "yes”
Wolfcat 5:53 PM: "epic”
Jos 5:53 PM: "what he is gonna do with a plastic cartridge, throw it at someone?”
moonman31 5:53 PM: "there is more coming”
Mugen Kagemaru 5:53 PM: "So who has the cartridge?”
moonman31 5:53 PM: "I convinced one of the culties to help me leak them”
moonman31 5:53 PM: "i dont know”
moonman31 5:53 PM: "I'm just smoking weed and :b:osting illegal videos”
Jos 5:53 PM: "brother?”
Mugen Kagemaru 5:54 PM: "Would probably help if ya got clean, but whatever”
Wolfcat 5:54 PM: "probably dangerous to say”
Mugen Kagemaru 5:54 PM: "Nah he legit doesn't know”
Jos 5:54 PM: "Send some weed here”
moonman31 5:54 PM: "yeah this shit always leaks seemingly now that nocta's on the radar”
moonman31 5:54 PM: "tbh I'm probably fucked pretty soon”
Mugen Kagemaru 5:54 PM: "Well play it safe”
moonman31 5:54 PM: "but I gotta help the anti-luna taskforce known as ID”
Jos 5:54 PM: "just tell nocta everything was a social experiment”
Mugen Kagemaru 5:55 PM: "Wouldn't go that far”
Mugen Kagemaru 5:55 PM: "@Jos I don't think he'd buy that”
Jos 5:55 PM: "of course not”
Jos 5:55 PM: “woosh”
moonman31 5:55 PM: "anyways i think the videos are related to what I was reading about before”
Jos 5:56 PM: "i just wonder what we could do”
Jos 5:56 PM: "to stop them”
Wolfcat 5:56 PM: "An "agent of Luna" definitely sounds like Tenebris talk”
Wolfcat 5:56 PM: "not good for that cartridge to still be making the rounds”
Mugen Kagemaru 5:57 PM: "Yeah it's been my theory that every time a person who has been in one of the cults talks about Luna they unknowingly mean Tenebris”
Jos 5:57 PM: "What if Tenebris is using Luna name as a cover to emerge from the soul realm to reality?”
Jos 5:57 PM: "What if Luna doesn't exist?”
Mugen Kagemaru 5:58 PM: "Oh she does”
Mugen Kagemaru 5:58 PM: "I just don't think we're fighting her”
Mugen Kagemaru 5:58 PM: "Just Tenebris”
moonman31 5:58 PM: "Ok so check this sweet theory”
moonman31 5:58 PM: "I think here on my side”
moonman31 5:58 PM: "Nocta is acting on behalf of someone giving orders”
Mugen Kagemaru 5:58 PM: "And I think we know who”
moonman31 5:59 PM: "I say that because in the old site Nocta was pretty openly controlling”
Jos 5:59 PM: "He does, he shows lack of motives but yet keep doing stuff”
moonman31 5:59 PM: “Nice facade but you know, diactatorish”
moonman31 5:59 PM: "He's been pretty quiet as a hand which is very unlike him”
moonman31 5:59 PM: "Which means someone else is in charge I think”
Mugen Kagemaru 5:59 PM: "@Jos “What if Tenebris is using Luna name as a cover”
Mugen Kagemaru 5:59 PM: "This is basically my theory”
Jos 5:59 PM: "i adopt it as well”
Mugen Kagemaru 6:00 PM: "Just that part though”
Wolfcat 6:00 PM: "you think theres someone higher up in the AO?”
Jos 6:00 PM: "Well, let's just say that probably Nocta is being possessed”
Mugen Kagemaru 6:00 PM: "Maybe not that far Jos”
moonman31 6:00 PM: "Hmm”
Mugen Kagemaru 6:00 PM: "@Wolfcat And it's likely we know who it is”
moonman31 6:00 PM: "No not in the AO”
Jos 6:01 PM: "I think this is that far when Nocta can control ips 24/7”
moonman31 6:01 PM: "I think Nocta has been contacted by something from your, uh, timeline”
moonman31 6:01 PM: "or whatever”
moonman31 6:01 PM: "I think that's who he answers to”
Mugen Kagemaru 6:01 PM: "That doesn't require possession though, it'd be easy to do that mundanely @Jos”
moonman31 6:01 PM: "Yeah Nocta is just relegating himself to admining the board and hunting me down via the internet these days”
moonman31 6:01 PM: "I don't know any of the cult stuff inasfar as what I've already said”
moonman31 6:01 PM: "Whoops gotta go”
moonman31 6:01 PM: "or Brb even not sure”
April 23, 2019
- At 5:45 AM, Jos noticed a new video had been uploaded to Tyler’s YouTube channel - LevANnhUa (https://www.youtube.com/watch?v=anzCg-xN6fc)
- Summary: A green distorted video of someone holding an object. An image of a gate flashes on screen followed by a cipher. Most of this cipher has been solved: “Come home today”, with the remaining part left unsolved: “//’X<; pg2:It”
- Description: A cipher that solved to: "Your time away from us has come to a close You are coming to see us now Final day Did you expect us to start counting for you? After the bridge, the next destination is the gate.“
- Tags: ”Luna, Tyler, Mistake, Tenebris awaken, lostinforest“
- At 6:15 AM, Pedropi3 noticed Tyler was now livestreaming on YouTube. His stream was titled “Good Morning” and mostly consisted of him walking around his dark yard early in the morning. Tyler states he has not been sleeping well and hears a noise outside his home. He walks over to an area where he says strange stuff usually happens in his yard and suddenly falls asleep. (https://www.youtube.com/watch?v=4fLzZH2CBAU)
- At an unknown time, a video titled 111111 was uploaded to Silentdork. The video is incredibly dark, yet outdoor ambiance and footsteps can be heard. (https://www.youtube.com/watch?v=nJwQfFK4_ik)
- At 6:40 AM, Jos noticed that Tyler was once again livestreaming, this time it was titled “awake”. Tyler has woken up from his sudden sleep and continues talking. He says the detour sign in his yard no longer works, yet he still hears noises from it. He also comes to the realization that today is 4/23 and strange things always happen on this day. He then acts as if he is in a trance-like state and echos the description from “LevANnhUa”, saying he needs to cross a bridge and go through a gate. (https://www.youtube.com/watch?v=WslHOCdJ4WI)
- At 8:14 AM, Deadhead noticed a video had been uploaded to Greth Vlogs - “sacredartifact.mp4″. a short video showing the haunted Majora’s Mask cartridge. (https://www.youtube.com/watch?v=t7cevXpUOzY)
- At 4:25 PM, Mugen found a new video uploaded to Silentdork - “423″. This short video showed a man kneeling over some square object with the Song of Unhealing playing. A strange, white, featureless entity stood in front of him. (https://www.youtube.com/watch?v=PtOWnWaoXKk)
- At 5:50 PM, Moonman entered the Discord server and had a conversation with the players. Below is a summary. The full conversation can be read here: (https://internetdetectives.tumblr.com/post/184416634433/42319-chat-with-moonman)
- Moonman says his theme song is a vaporwave version of “Out of Touch” - (https://www.youtube.com/watch?v=V3KuJCX54Bo)
- Moonman has convinced someone within the Astral Observatory to leak him some more videos. “sacredartifact.mp4″ was one of these videos.
- Moonman has “hijacked” Greth Vlogs to upload these videos.
- Moonman believes these videos are connected to the email snippets he read the day prior.
- Moonman believes that Nocta is being given orders by something from “our timeline”.
- At 6:11 PM, Jos noticed a face or mask was barely visible in the “111111″ video once brightened. A brightened version of the video is available here. (https://www.youtube.com/watch?v=HIOTlt1yMuE)
- At 6:41 PM, Mugen noticed a new video on Greth Vlogs - “guidance.mp4″. (https://www.youtube.com/watch?v=wrIBKYQGX9Q)
- Summary: A man who looks similar to either Greth or Kevin is seen kneeling before the same white entity from the “423″ video. The man rises and another man wearing a gas mask stands behind the white entity. The white entity and the masked figure raise their arms in unison. The kneeling man can now be seen wearing some sort of mask. The gas masked figure reaches out to the masked man and the video ends.
- Tags: ”Enemies will attack even if you’re not ready!“ - This same phrase was seen in a Johnisdead.com image from ¾/18.
- At 6:55 PM, Mugen noticed another video on Silentdork - “soon″. This video was incredibly short, yet it shows the second giant, Alex, under a green filter with the detour sign overlayed. Text reading “We will show you where later” is also seen. (https://www.youtube.com/watch?v=hoJ_BAf98pg)
- At 7:04 PM, Mugen found another video on Silentdork - “g4″, a followup to “soon”. (https://www.youtube.com/watch?v=iX1htdb2m-Y)
- Summary: Alex/Jadusable is seen. The camera falls as strange sigils appear - the parallelos sigil, the Lunarum Oculus, and two other unknown sigils consisting of arrows. (https://internetdetectives.tumblr.com/post/184417862128/42319-g2-screenshots-sigils) The pig-mask webm plays while Alex speaks, linking him as the second giant even further. Alex says “He took the trip”. Images of the runes from Johnisdead.com and a long-haired person flash on screen. We then see Greth running towards the camera as someone scrambles over the detour sign. Alex says “We will show you where later”, and see more footage of someone running towards the camera followed by footage of a bridge. (https://internetdetectives.tumblr.com/post/184417929668/42319-g2-screenshots-miscellaneous)
- At 7:48 PM, Mugen noticed a video on Greth Vlogs - “a poem of serious reflection, typically a lament for the dead.”. This video started with a shot of the same white entity from before, followed by footage of someone praying over a ritual table of some sort. The Song of Unhealing plays in the background. (https://www.youtube.com/watch?v=yd7ZdwM8HMw)
- At an unknown time, the Astral Observatory forums became inaccessible. Users who attempted to enter were met with the message “Punish ye who have traitorous roots in holy soil”.
#timeline
#JohnIsDeadTimeline
April 24th, 2019
- At 9:29 AM, Wolfcat noticed that the name and description of “Escape p.2″ had changed. The title was now “joyous parallelos” and the description changed from “You weren’t supposed to have this” to “I’m glad you have this.”
- At 11:05 AM, users realized that the bridge seen and spoken of in multiple videos is likely the same one seen in “Escape p.2″ in what appears to be a park.
- At 11:24 AM, Jos solved the ciphered tags on the “a poem of serious reflection” video - “YOU ARE UNDER ATTACK!”
#timeline
#JohnIsDeadTimeline
April 25th, 2019
- At 11:51 AM, Wolfcat noticed that the message on the Astral Observatory forums had changed. This message would continue to change throughout the day:
- 11:51 AM - “Did you think that would work?”
- 11:58 AM - “That’s not going to work, either.”
- 11:58 AM - “The more you try, the more you will fail.”
- 12:11 PM - “It is amusing to see you flounder with every attempt, hacker. Whats secrets do you hope to gain from this?”
- 12:29 PM - “020224 200414 14212411 0414152106162123″
#JohnIsDeadTimeline
#timeline
April 30th, 2019
- At 4:30 PM, players noticed that the cipher message on the Astral Observatory Forums had once again changed, now with letters slowly replacing numbers. This continued happening throughout the day.
- 4:30 PM - “ON24 200414 14212411 0414152106162123″
- 5:28 PM - “ON24 20A14 14212411 04141521061621D”
- 7:52 PM - “ONE 20AS B212411 04141521061621D”
JohnIsDeadTimeline
#timeline
May 1st, 2019
- At 8:48 PM, Jos solves the cipher on the Astral Observatory Forums. “ONE HAS BEEN ASCENDED”. It is now believed that Nocta forcefully ascended Moonman to silence him.
#timeline
#JohnIsDeadTimeline
does nocta is gay
yes
6/5/19 - Chat with Moonman
- ((Moonman posts a meme featuring Mac Tonight and the text “When you idle so long the homies think u dead but you really just fapping”))
- moonman31: oh shit you banned mugen
- moonman31: damn everyone :b: oolin
- moonman31: bye i guess
- Wolfcat: o shit
- Wolfcat: moonman confirmed not dead yet
- moonman31: yeah been shit posting on facebook where’s mugen
- Wolfcat: i kicked him after he was being too mugen and also claimed to have reported you to nocta
- Wolfcat: i mean he later said he was lying but in the moment he was being dummy
- moonman31: but he was the main source of cringe
- Wolfcat: thats usually the main reason we keep him around but i didnt want him causing any actual trouble this time
- Wolfcat: but anyway
- Wolfcat: AO said that apparently someone had ascended
- Wolfcat: do you know whom that is?
- moonman31: not until you bring back mugen
- Wolfcat: you drive a hard bargain
- ((Mugen Kagemaru is added to the group))
- Mugen Kagemaru: Pretty damn hard
- moonman31: Ah, there he is
- Mugen Kagemaru: And yes, I did lie about ratting you out. Was just pissed over dumb shit
- Mugen Kagemaru: So I hear we have another one to deal with.
- moonman31: I know that
- moonman31: That’s why I asked them to bring you back
- Jos: A
- moonman31: I went full under for you Moogs
- moonman31: I’ve been naughty
- ((Moonman posts a screenshot of Nocta’s PM’s, many of which are from another player, CelestialLight))
- Jos: BY THE NINE you are alive
- Mugen Kagemaru: Aw hell it’s her?
- Jos: suxx
- moonman31: I’m in nocta’s account
- Jos: yeah
- moonman31: it took a while so I had to lay low
- Jos: wow
- Jost: there is anything interesting?
- moonman31: Mostly not
- Jos: mmm
- Jos: i wonder what we could do with nocta account
- Mugen Kagemaru: Probably not a good idea to for all of us to get in there
- Mugen Kagemaru: It’s enough of a risk that YOU are in there Moony
- Wolfcat: any possible way to restore the internet detectives post he deleted?
- Wolfcat: or at least see what it was?
- moonman31: uuuuuuuuuuuuuhhhhhh let’s find out
- moonman31: but i did get the new password
- moonman31: :3
- Wolfcat: for the spooky subspace section or w/e?
- ((Moonman posts another screenshot of CelestialLight making conversation with Nocta))
- moonman31: Anyways the way into the subspace is through the truth last i recall
- moonman31: but he may have moved it
- Jos: remember
- Jos: use proxy
- Jos: just in case
- Jos: wait
- Jos: we cant create accounts
- Jos: awa
- Jos: i will use mine
- Jos: i will sacrifice
- Wolfcat: we could fuck with suxx with this account
- Wolfcat: nocta’s
- Wolfcat: but thats probably not a good idea
- Jos: gonna enter the truth
- Jos: wish me luck
- Wolfcat: i mean wait
- Mugen Kagemaru: Def not
- Wolfcat: on one hand moonman’s already pretty much outed as a traitor
- Wolfcat: so i guess we wouldnt be putting him in danger
- Wolfcat: but yeah your account will be screwed
- Jos: i think nocta already wants to fuck moonman already
- Jos: and i only post stupid simpsons stuff on mine lol
- Mugen Kagemaru: Let’s focus on getting info, leave Mollie alone.
- Wolfcat: so is there a way for us to actually access this subspace? like a login page at the very least?
- Wolfcat: also damn suxx really wants to just play some vidya with nocta
- Jos: its inside the truth
- Jos: moonman said it
- Jos: i havent logged in
- Wolfcat: i mean i imagine it’d just be a link to another page on the site
- Wolfcat: thats behind a password wall
- Mugen Kagemaru: Anyone got screencaps?
- moonman31: anyways i have to lay low again soon
- moonman31: so im about to pull my final act of defiance
- ((Moonman makes all of the Internet Detectives on the site moderators))
June 5th, 2019
- At 11:23 AM, Moonman joined the Discord server and had a conversation with the players. Below is a summary. The full chat can be read here (https://internetdetectives.tumblr.com/post/185728429383/6519-chat-with-moonman)
- Moonman is actually alive and not ascended, he has just been laying low.
- Moonman has gained access to Nocta’s account on Astral Observatory.
- The last place one could access the secret “subspace” on Astral Observatory was through The Truth board, though it may have been moved.
- Moonman is about to do one final act of defiance.
- At 11:59 AM, users discovered a new topic created by Moonman using Nocta’s account titled “!?!”. The topic simply read “be free internet detectives”. Users then realized they had moderator powers and began combing the site.
- At 12:13 PM, users discovered that Nocta had deleted a few topics.
- A topic from Yuukichan was deleted back on January 20th that no one had seen before. The topic was titled “ascension” and simply read “are you awake?” Yuukichan was the one who was ascended, and has been for quite some time.
- A topic created by Nocta himself had been deleted from The Truth on November 12th titled “The History of Us” The thread’s contents could not be recovered.
- A test topic created by Nocta himself. The contents could not be recovered and it is likely not relevant.
- At 12:17 PM, Jos deleted Moonman’s “!?!” thread in the hopes of covering his tracks.
#johnisdead
#JohnIsDeadTimeline
#timeline
July 9th, 2019
| | | | | |
#video
July 9th, 2019
wolfcat22
#video
July 9th, 2019
For Solifera C
#video
July 9th, 2019
- At 7:39 PM, Mugen Kagemaru noticed a new upload to Silentdork - “| | | | | |” (https://internetdetectives.tumblr.com/post/186190601438/july-9th-2019). This video shows an indiscernible object moving in a dark room. The description read “l l l l l”.
- At 8:06 PM, “| | | | | |”’s title changed to “3 questions will be answered” and the description now read “Boredom and habit has forced our hand yet again.”
- At 9:05 PM, a video titled “wolfcat22″ was uploaded. (https://internetdetectives.tumblr.com/post/186190615973/july-9th-2019-wolfcat22) The video played a corrupted version of the Song of Storms while someone explored a house in the online game Roblox. When they look out the window, a figure turns towards them and runs at them. The description read “llllll ᚸ llllll”, and the video had a single tag reading “kevi”.
- At 9:14 PM, “| | | | | |”’s description changed once more: “Dont bore me, WE Have wAiTed a long timE for this. He’ll be taking a bris walk while I May wait.” The capitalized letters spell out “WE HATE HIM”.
- At 9:18 PM, players began noticing comment replies left by Silentdork. Many comments were made, which can be read here: (https://internetdetectives.tumblr.com/post/186190521593/7919-silentdork-youtube-comments). (https://internetdetectives.tumblr.com/post/186191161283/7919-silentdork-youtube-comments-p-2) (https://internetdetectives.tumblr.com/post/186191453898/7919-silentdork-youtube-comments-p-3) Below are the questions and replies:
- Mugen: “Where are the questions to be submitted?”
- Silentdork: “||||||”
- xXGaBoXx012: “Where is tyler?”
- Silentdork: “Parallelos Our worlds”
- Wolfcat: “How did you get this footage?” (wolfat22 video)
- Silentdork: “Play foolish games, get great prizes. We want it to all be over.” (In the form of a cipher)
- squishie isshie: “what do you want?“
- Silentdork: “I want to end this after all these years but It wont let me. He is always ruining us and bringing it all back to Null. We will never be free and Im afraid Luna will take everything.”
- Wolfcat: “How many of you are there?”
- Silentdork: “Spectrum”
- Solifera C: “So…whats next?.. show me your reality.. I want more ;)“
- Silentdork: “Ok”
- Chu Pala: “Why did you disappear for so long?”
- Silentdork: “If we can let it die I can be free. But “I” still wants to finish. I will kill him.”
- Juan Rojas: “Will you kill him ? When you find he or she what are you going to do? Will you delete your channel when this finish?”
- Silentdork: “|||”
- Jose Mi: “Who do you hate and why?”
- Silentdork: “|||”
- squishie isshie: “what do you want to tell us?“
- Silentdork: “Please see through this. He always does this kind of thing to throw everyone off. It happened once before back in april 2012. There is always Methods to his madness. This is one of the only times I think I of the 3 will be able to speak without my symbols the way I had to set them up. Please stay alert.”
- xXGaBoXx012: “What is lunarchildren?”
- Silentdork: “A nearly used up tool of ours”
- senorita misteriosa: “What do you mean, boredom and habits have forced your hand again?“
- Silentdork: “|||”
- Darice The demon: “I can help you, just talk to me.”
- Silentdork: “This may not be changed”
- At 9:58 PM, “| | | | | |”’s description changed to “BRIS”
- At 10:05 PM, “| | | | | |”’s description changed to “Dont bore me, I have waited a long time for this. I’ll be taking a walk while you all wait.”
- At 10:19 PM, “| | | | | |”’s title changed to “3 questions will be answered. You have 1 hour to decide them.”
- At 10:35 PM, Jos noticed the description on “wolfcat22″ had been extended with the following: “Stolen from him Laugh Send toys I my punish to interfering Detectives Children Harbingers End Kill all to end”
- At 11:03 PM, “| | | | | |”’s title changed to “3 questions will be answered.”
- At 11:14 PM, Mugen Kagemaru noticed a new upload from Silentdork - “Solifera C”. (https://internetdetectives.tumblr.com/post/186190632073/july-9th-2019-for-solifera-c) This video showed cryptic imagery. The description reads “A prisoner A prison A prophecy Just a glimpse”.
- At 11:54 PM, “| | | | | |”’s title changed to “3 questions answered.” and the description had changed as well, now showing three of the questions and answers:
- Senorita misteriosa: I pull us to null but he works the forces that desire us to carry on. I will be free when this dies but it makes me work more and more. Im very tired, this body is a cage. When I finally stagnate he stabs me again and we must fight all over again. Over and over, forever.
- Juan Rojas: We will be able to die. It promised me if I die I die.
- Jose Mi: He is us. I want to stop. I want to sleep. I want null. I want to end.
- At an unknown time, “Solifera C”’s title changed to “For Solifera C” indicating that this video was uploaded in response to the user Solifera C asking to see more of Silentdork’s world earlier.
johnisdead
#johnisdead timeline
#timeline
July 9th, 2019
Adventures of Kaiden Zoromichi ABRIDGED (Ep. 1)
July 19th, 2019
- Kaiden_Zoromichi made a number of forum posts on the Astral Observatory forums:
- 3:20 PM: “I would say there’s a reason most of us have been quiet but I wouldn’t worry about it too much…” - In response to users being inactive.
- 3:22 PM: “Kingdom Hearts III, Assassin’s Creed Odyssey for right now… Well, that’s what I’m playing, anyway.” - In response to being asked what his favorite games were.
- 3:30 PM: “Odd to add more to the ‘ranks’ considering everything that’s happened.“ - In response to ARGdov and CelestialLight’s welcoming thread in “The Truth”.
- 3:31 PM: “Coward.“ - In response to nocta deleting the contents of the “Internet Detectives” thread in “The Truth”.
- 3:35 PM: “Hmmm… Well outside of this place/these people, not terrible. Been working on an abridged lore video for my character… I need some art for it though.” - In response to being asked how his day is going.
- 3:39 PM: “PM sent.” - In response to Wolfcat offering to provide art for his aforementioned “lore video”.
- 4:01 PM: “I once heard a rumor that Tiamat may be real. That was a long time ago…” - In response to the “Dragons” thread.
- 4:02 PM: “Tch. Trying too hard to be edgy…“ - In response from a cryptic post from Jos.
At 7:15 PM, Kaiden_Zoromichi created a topic titled “Adventures of Kaiden Zoromichi: Abridged“, which read the following: “I made a video for some of my RP escapades. https://www.youtube.com/watch?v=xI_fltggv6E If you guys like this, maybe I will make more…” The link leads to a new YouTube channel belonging to Kaiden himself, where he has uploaded “Adventures of Kaiden Zoromichi ABRIDGED (Ep. 1)”, which depicts a roleplay that Kaiden and Yuukichan once took part in. (https://internetdetectives.tumblr.com/post/186428407993/july-9th-2019-adventures-of-kaiden-zoromichi) - At 8:08 PM, nocta replied to Kaiden’s “lore video” thread with the following: “…cute, Kaiden. We should talk.”
- At an unknown time, nocta’s reply was deleted.
- At 11:53 PM, Kaiden_Zoromichi posts a link to a song that Yuukichan used to listen to. “Yuuki listens to this a lot…
https://www.youtube.com/watch?v=WBff4F5egLc“ - At 11:56 PM, moonman31 responded to Kaiden’s lore video thread with “Glad I could help you out buddy“, likely in reference to his brief appearance at the end of the video in which he says “ok cuck”.
- At 11:59 PM, moonman31 responds to Yuuki’s song with a simple heart emoji: “<3“
#Johnisdead
#timeline
#johnisdead timeline
July 21st, 2019
- At 11:53 PM, Kaiden_Zoromichi created a topic titiedl “Vague Memories” which read the following: “Does anyone know how to better access memories that you can’t quite seem to fully…grasp? I have a lot of dreams that I believe to be memories. Mostly of my time at an orphanage when I was young and… some other things.” (https://astralobservatory.net/forum/viewtopic.php?f=4&t=1945&sid=ba265c519509a0a383db76746e4d81ef)
#timeline
#JohnIsDeadTimeline
July 22nd, 2019
- At 12:52 PM, Wolfcat submitted the New Wave Bossa Nova in a player-created thread in The Truth titled “Controller”. This was done in the hopes that Yuukichan would be able to contact us.
- At 5:35 PM, Jos discovered a comment from Silentdork posted on the music video “getting better” by “nelward”. The comment contained a cipher that translated to “This goes out to an old friend. hope to see you again Jacob8.”
- At 6:01 PM, ARGdov replied to the previous YouTube comment with “who do you mean?”
- At 7:02 PM, ARGdov noticed Silentdork had replied to his comment with another cipher.
This cipher translated to “https://www.youtube.com/watch?v=gsbXyIAf7wo&lc=UgxghE8RQrW1ET5z17p4AaABAg&ab_channel=silentdork”, a YouTube link that led to a specific comment on the video “For Solifera C”. The comment in question is from a user named “bluecat 04″, reading “IM GOING TO CATCH YOU“. Two ciphers from Silentdork are posted as replies to bluecat’s comment containing ciphers. - These ciphers translated to “https://www.youtube.com/watch?v=D7chqmf2ThM&lc=Ugx423L2IYUmE3xWz2V4AaABAg&ab_channel=nelward”.This link led to another highlighted Silentdork comment on the music video “GHOSTS” by “nelward”, which contained the same type of corrupted spaces we’ve seen previously in the ARG that reverses text.
#timeline
#johnisdead timeline
July 26th, 2019
Slinking
July 26th, 2019
fascie
7/26/19 - Chat with Tyler00 - 1
- 4:54 PM Tyler00: “Hello, you've been looking for me.”
- 4:54 PM Tyler00: ((Hello.gif is posted))
- 4:56 PM Slinky stinks: “Cool”
- 4:56 PM Tyler00: “ Being honest with you”
- 4:56 PM Tyler00: “I don't know where I am.”
- 4:57 PM Slinky stinks: “ Now are we getting into the arg lmao“
- 4:58 PM Tyler00: “Everything is... dark, I can hear birds, and the sounds of the leaves being crushed on my steps.”
- 4:59 PM Tyler00: “But there is nothing, no space, no dimensions, yet I have a feeling of being outdoors.”
- 4:59 PM Tyler00: “I feel like, i'm ll̖̣̘o͔̘s̗͙ͅţͅ ̩̹i̪̮̕n̲̩ ̜̀f͇͘o̜͖̗r͔e̟s̖̥͙t͖̟ͅ”
- 5:00 PM Slinky stinks: “ Parallelos?”
- 5:00 PM Slinky stinks: ”Maybe the detour sign?“
- 5:03 PM yoshi: “spooky“
- 5:03 PM Slinky stinks: “Lvl 100 spooky“
- 5:03 PM Tyler00: “That word... where did I hear it? I don't know, is dark, and they are coming, they want me, a ritual that started years ago must be finished. Wait, why do I know that?”
- 5:04 PM Slinky stinks: “ Fuck”
- 5:04 PM Slinky stinks: ”11/11″
- 5:04 PM Tyler00: “This is confusing.“
- 5:04 PM Slinky stinks: “Uuuh”
- 5:04 PM Slinky stinks: ”The song!“
- 5:04 PM Tyler00: “What song? What are you talking about?“
- 5:04 PM Slinky stinks: “I need the song”
- 5:04 PM Slinky stinks: “Wait”
- 5:04 PM Slinky stinks: “Fuck”
- 5:04 PM Slinky stinks: “I dont find it on the archives”
- 5:08 PM Tyler00: “We used to link music on the forums. Wait, why I know this, who is telling me all of this? What the hell is happening!“
- 5:08 PM Slinky stinks: “Oh shit“
- 5:10 PM Tyler00: “GET THE FUCK OUT”
- 5:10 PM Tyler00: “I AM IN CONTROL NOW”
- 5:10 PM Tyler00: “YOU ARE JUST A INSIGNIFICANT ONE NOW”
- 5:10 PM Tyler00: “NO I DONT WANT TO GO BACK“
7/26/19 - Chat with Tyler00 - 2
- 6:23 PM Slinky stinks: “Me cago en dios“
- 6:24 PM Wolfcat: “which one are you?“
- 6:25 PM Tyler00: “It's me, Tyler“
- 6:25 PM Wolfcat: “Do you remember speaking to us back in 2015?“
- 6:29 PM Tyler00: “Yes, I do... Can i ask for something? I'm looking for substance, can I have some?“
- 6:29 PM Wolfcat: “Ah, I see”
- 6:29 PM Wolfcat: ”One momeny“
- 6:29 PM Wolfcat: ((Marijuana emojis are posted))
- 6:30 PM Tyler00: “It's a bit weird I know but It is of primary importance“
- 6:30 PM Wolfcat: “I hope this will empower you on your journey my friend“
- 6:30 PM Tyler00: “Not that substance”
- 6:31 PM Wolfcat: “what substance do you desire“
- 6:31 PM Tyler00: “I was refering to £å¢ê§, the essence.”
- 6:31 PM Tyler00: “I need them.“
- 6:33 PM Wolfcat: “faces?“
- 6:33 PM yoshi: “o”
- 6:33 PM Slinky stinks: “Yea that's what I got too”
- 6:33 PM Slinky stinks: “Oh in the description he talked about faces too”
- 6:33 PM Slinky stinks: “Masks maybe?”
- 6:33 PM Wolfcat: ((An emoji of the player Mugen Kagemaru’s face is posted))
- 6:33 PM Wolfcat: “Does this face work?”
- 6:33 PM Wolfcat: ((An emoji of Greth’s face is posted))
- 6:33 PM Wolfcat:
“what about this one?” - 6:37 PM Tyler00: “We must 𝒶丂ѕ𝓲мιlάtᗴ them for Ꮇą₴kᔕ“
July 26th, 2019
- At 4:54 PM, a user named “Tyler00″ joined the Internet Detectives Discord server and began speaking with players. The full conversation can be read here (<a href="https://internetdetectives.tumblr.com/post/186589436948/72619-chat-with-tyler00-1">https://internetdetectives.tumblr.com/post/186589436948/72619-chat-with-tyler00-1</a>). Below is a summary:
- Tyler00 is apparently Tyler, who is currently lost in some sort of forest-like environment.
- Tyler00 is being chased by people who want to finish a ritual started a few years ago.
- Tyler00 has vague memories from before, but it is still hazy for him.
- At 5:58 PM, Mugen Kagemaru noticed a new video had been uploaded to Silentdork - “Slinking” (<a href="https://internetdetectives.tumblr.com/post/186589199958/july-26th-2019-slinking">https://internetdetectives.tumblr.com/post/186589199958/july-26th-2019-slinking</a>). The description read: “That is what I caught this urchin doing Just like the rest they must all use faces Just like the rest they must all use names Its been a long time. We are just like them but better. I cant stop it. The game will continue soon. #yyyyyyyyyyyyyyyyyyyyy.finish Maybe this one will keep this face, but never take MY name.“ and the tags “tyler tyer tyler, TYLER, tyler“. The video featured a faint image of the player Mugen Kagemaru’s face.
- At 6:23 PM, Tyler00 rejoined the Internet Detectives Discord server and began speaking once again. The full conversation can be read here (<a href="https://internetdetectives.tumblr.com/post/186589622383/72619-chat-with-tyler00-2">https://internetdetectives.tumblr.com/post/186589622383/72619-chat-with-tyler00-2</a>) Below is a summary:
- Tyler00 asks the players for faces.
- Tyler00 claims the faces must be assimilated for masks.
- At 7:07 PM, Mugen Kagemaru noticed a video was about to premiere on the Silentdork channel. Some could be seen chatting using the Silentdork account in the video premiere chat:
- Silentdork: “I cant stop us”
- Silentdork: “it will finish soon”
- The video “fascie” was uploaded. (<a href="https://www.youtube.com/watch?v=x8up-ngPKZw">https://www.youtube.com/watch?v=x8up-ngPKZw</a>). Featured in the video were several quick flashes of profile pictures belonging to users who had commented on “Slinking”. The description read “And they will take more. They will build up my world with you. His world was fake, ours will be real, because it was never his it was mine and ours. g𝐢𝓋є υŞ 𝓶o尺ᗴ m̷͇̮̭̫̰̼̯̦̬̈̈̈́͊̉̀͗͠αʂƙʂ” and the tags were “not R world”.
- At 10:58 PM, a new character joined the Astral Observatory forums - IsocelesAssassin, the returning member mentioned previously by Moonman and Kaiden_Zoromichi. Isoceles made several posts on the Astral Observatory forums:
- At 10:58 PM, IsocelesAssassin made his own introduction thread - “<a href="https://astralobservatory.net/forum/viewtopic.php?f=8&t=1947#p2709">Seems we are back.”</a>, where he claimed he has been associating with a different group. Moonman claims there are some time discrepancies regarding what IsocelesAssassin claims.
- 10:58 PM IsocelesAssassin: “Hello, everyone; I see faces old and new.“
- 11:39 PM moonman31: “SHIT IS GETTING REAL“
- 11:42 PM IsocelesAssassin: “It's always been 'real', Greth.”
- 11:45 PM moonman31: “Ssshhh that's the no no name in these parts, also where you been? I seriously thought you were dead. No sarcasm.”
- 11:46 PM IsocelesAssassin: “Been associating with some other people for a couple of years; we have a mutual interest.”
- 11:48 PM moonman31: “Hey now, you haven't been gone THAT long.“
- 11:49 PM IsocelesAssassin: “Don't worry about it right now.”
- At 11:13 PM, IsocelesAssassin responded to Wolfcat’s “Controller” thread in “The Truth”.
- 11:13 PM IsocelesAssassin: “Surprised you didn't post a different video.“
- At 11:26 PM, IsocelesAssassin replied to Nocta’s “Internet Detectives” thread.
- 11:26 PM IsocelesAssassin: “Play me a song, you're the ocarina man, play me a song tonight...“
- At 11:29 PM, IsocelesAssassin responded to Kaiden’s “Vague Memories” thread. IsocelesAssassin posts the “Sonata of Awakening”, implying that he might have song powers.
- 11:29 PM IsocelesAssassin: “Here's an idea: <a href="https://www.youtube.com/watch?v=wOIOhTbSYoE">https://www.youtube.com/watch?v=wOIOhTbSYoE</a>“
- 11:38 PM Kaiden_Zoromichi: “Not sure what you're getting at IA (welcome back, by the way), but I did remember something. I fill you in on the details. Do you still have Skype?”
- 11:40 PM IsocelesAssassin: “I'd say we just discuss it here, Kaiden. The others could be of help too.”
- At 11:47 PM, Moonman posted in the Discord Server, notifying everyone that IsocelesAssassin had rejoined the forums:
- 11:47 PM Moonman: “SHIT IS BUCK WILD FOLKS”
- 11:47 PM Moonman: “<a href="https://astralobservatory.net/forum/viewtopic.php?f=8&t=1947">https://astralobservatory.net/forum/viewtopic.php?f=8&t=1947</a>″
- At 11:51 PM, IsocelesAssassin sent the player Wolfcat a PM: “You called for me. And now I'm here.”, implying that the New Wave Bossa Nova summoned IsocelesAssassin.
#timeline
#johnisdeadtimeline
July 27th, 2019
- At 8:42 PM, IsocelesAssassin replied to Kaiden’s lore video thread with the following: “Pretty bold to slip in footage of Nocta there Kaiden”. This implies that the man we see in Kaiden’s video when it corrupts near the end is actually Nocta himself.
- At an unknown time, Slinky discovered another comment posted by Silentdork on Nelward’s music video “Sleepwalk”. The comment was a cipher that translated to “Vincent, wake up”.
#timeline
#JohnIsDeadTimeline
July 29th, 2019 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:37 PM: “sᴇᴇᴍs ᴏʙᴠɪᴏᴜs ᴛᴏ ʀᴇꜰᴇʀᴇɴᴄᴇ ᴛʜᴀᴛ, ʙᴜᴛ ɪꜰ ɪᴛ's ᴀɴʏ ᴄᴏɴsᴏʟᴀᴛɪᴏɴ, ʏᴏᴜ'ʀᴇ ᴀʟsᴏ ᴀʟʟ ɪᴅɪᴏᴛs.”
- Jos at 9:38 PM: “I love your font”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:39 PM: “ᴀɴ ɪɴᴅɪᴄᴀᴛᴇᴅ ᴛᴇxᴛ ꜰᴏʀᴍᴀᴛ ᴅᴏᴇsɴ'ᴛ ʀᴇᴀʟʟʏ ǫᴜᴀʟɪꜰʏ ᴀs ᴀ ꜰᴏɴᴛ; ʜᴏᴡᴇᴠᴇʀ, ɪ ᴀᴄᴄᴇᴘᴛ ʏᴏᴜʀ ᴄᴏᴍᴘʟɪᴍᴇɴᴛ. ᴛʜᴀɴᴋ ʏᴏᴜ.”
- Jos at 9:40 PM: “It's true”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:41 PM: “ᴀɴʏᴡᴀʏs ᴄᴏɴsɪᴅᴇʀ ᴍᴇ ᴀ ᴄᴀsᴜᴀʟ ᴏʙsᴇʀᴠᴇʀ ꜰᴏʀ ᴛʜᴇ ᴛɪᴍᴇ ʙᴇɪɴɢ, ʙᴜᴛ ɪꜰ ɪᴛ sᴀᴛɪᴀᴛᴇs ᴀɴʏ ᴄᴜʀɪᴏsɪᴛʏ ʏᴏᴜ ᴍᴀʏ ʙᴇ ʜᴀᴠɪɴɢ, ɪ'ᴍ ʜᴇʀᴇ ᴏɴ ʙᴇʜᴀʟꜰ ᴏꜰ sᴏᴍᴇᴏɴᴇ ᴇʟsᴇ.”
- Jos at 9:44 PM: “I guess that someone has to be kept in secret, I will just ask, what do you need? Where do you came from?”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:45 PM: “ɪ ʜᴀᴠᴇ ᴅᴇᴀʟᴛ ᴡɪᴛʜ ᴀ ɴᴜᴍʙᴇʀ ᴏꜰ ʏᴏᴜ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇs ʙᴇꜰᴏʀᴇ; ᴀs ᴀ ꜰᴀᴠᴏʀ ᴛᴏ ᴀɴᴏᴛʜᴇʀ, ɪ ʜᴀᴠᴇ ᴄᴏᴍᴇ ᴛᴏ 'ʜᴇʟᴘ'. ɪ ᴀᴍ ɴᴏᴛ sᴜʀᴇ ɪ ᴀᴍ ɢᴏɪɴɢ ᴛᴏ ʜᴏɴᴏʀ ᴛʜᴇ ʀᴇǫᴜᴇsᴛ ʏᴇᴛ ᴛʜᴏᴜɢʜ. ᴛɪᴍᴇ ɪs ᴘʀᴇᴄɪᴏᴜs ᴀɴᴅ ʏᴏᴜ ʟᴏᴛ ʜᴀᴠᴇ ᴅɪsᴀᴘᴘᴏɪɴᴛᴇᴅ ᴍᴇ ɪɴ ᴛʜᴇ ᴘᴀsᴛ.”
- Mugen Kagemaru at 9:46 PM: “(Text format)
How even do you do that? I'm legit curious.” - ɢʜᴏsᴛʙᴀʙᴇʟ at 9:47 PM: “ɪ ʜᴀᴠᴇ ᴍʏ ᴡᴀʏs, ᴀs ʏᴏᴜ ʜᴀᴠᴇ ʏᴏᴜʀs. ɪ ᴄᴏᴜʟᴅ ᴘᴏᴛᴇɴᴛɪᴀʟʟʏ ʙᴇ ᴀɴ ᴀssᴇᴛ ɪɴ ʏᴏᴜʀ ᴄʀᴜsᴀᴅᴇ, ʙᴜᴛ ᴛʜᴇ ᴛʜᴏᴜɢʜᴛ ᴏꜰ sᴘᴇɴᴅɪɴɢ ᴀ sɪɢɴɪꜰɪᴄᴀɴᴛ ᴀᴍᴏᴜɴᴛ ᴏꜰ ᴛɪᴍᴇ ᴏɴ ʏᴏᴜʀ ʙᴇʜᴀʟꜰ ɢɪᴠᴇs ᴍᴇ sᴏᴍᴇᴛʜɪɴɢ ʟɪᴋᴇ ᴍᴇɴᴛᴀʟ ᴀᴄɪᴅ ʀᴇꜰʟᴜx.”
- Jos at 9:47 PM: “Online text converters”
- Mugen Kagemaru at 9:48 PM: “Also yeah not surprised that you wouldn't be impressed. Our more competent members are rare and far between”
- otherLiam at 9:48 PM: “What, exactly, could you do for us, if you were so inclined?”
- Mugen Kagemaru at 9:48 PM: “And yeah I was referring to your text format.”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:48 PM: “@Mugen Kagemaru ʏᴏᴜ ᴄᴀɴ sᴇᴛ ɪᴛ ᴀs ᴀ ᴄʜᴀʀᴀᴄᴛᴇʀ ᴀᴛᴛʀɪʙᴜᴛᴇ ᴜsɪɴɢ ᴀ sɪᴍᴘʟᴇ ᴄᴏᴍᴍᴀɴᴅ. ᴀʟᴛʜᴏᴜɢʜ ɪ ᴛʜɪɴᴋ ɢᴏᴏɢʟᴇ ᴡᴏᴜʟᴅ ᴇxᴘʟᴀɪɴ ɪᴛ ᴡᴇʟʟ ᴇɴᴏᴜɢʜ.”
- Mugen Kagemaru at 9:49 PM: “Feel free to share in PMs for convenience's sake”
- Jos at 9:49 PM: “Just search goddamit”
- Mugen Kagemaru at 9:49 PM: “As you can see, Jos is NOT one of those rare few.”
- Wolfcat at 9:49 PM: “mugen is very component”
- Mugen Kagemaru at 9:50 PM: “I'm more moderate as I do lack some specific skills.”
- otherLiam at 9:52 PM: “Y'all aren't really helping the cause of making us look less dissapointing, here.
@ɢʜᴏsᴛʙᴀʙᴇʟ , I don't really expect people to help for nothing. Maybe there's something we can do for you, for you to help us. Rather than you just doing it out of the goodness of your heart. First we'd need to know what you could help us with though.Would that be less nauseating for you?” - Mugen Kagemaru at 9:53 PM: “Least I'm not a total dummy like, say, Yoshi.”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:53 PM: “ɪ ᴡᴏᴜʟᴅ ʟᴇᴛ ʏᴏᴜ ᴋɴᴏᴡ ᴡʜᴇɴ ᴛʜᴇ ᴛɪᴍᴇ ᴄᴀᴍᴇ, ʙᴜᴛ ɪ ᴀᴍ sɪᴍᴘʟʏ ᴏʙsᴇʀᴠɪɴɢ ᴛʜᴇ ɴᴀᴛᴜʀᴀʟ ʜᴀʙɪᴛᴀᴛ ᴏꜰ ᴛʜᴇ 'ɪᴅ' ꜰᴏʀ ɴᴏᴡ. ʟᴇᴛ ᴜs sᴀʏ ɪ ᴀᴍ ɢᴏᴏᴅ ᴡɪᴛʜ ᴄᴏᴍᴘᴜᴛᴇʀs. ɪʀᴏɴɪᴄᴀʟʟʏ ᴛʜᴇ ᴏɴʟʏ ᴏɴᴇ ᴏꜰ ʏᴏᴜ ɪ'ᴠᴇ ɪɴᴛᴇʀᴀᴄᴛᴇᴅ ᴡɪᴛʜ ɪɴ ʜᴇʀᴇ ɪɴ ᴀʙsᴛᴇɴᴛɪᴀ.”
- Jos at 9:55 PM: “Welcome, judt feel like home okay”
- Mugen Kagemaru at 9:55 PM: “is absent, you mean”
- otherLiam at 9:55 PM: “Who was that?”
- Mugen Kagemaru at 9:55 PM: “Ironically this isn't our main place. Just in the transition process of being the hub of our operations against the Lunar Children and whatever the Astral Observatory is supposed to be.”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:55 PM: “ɪᴇ: sᴇᴇᴍs ᴛᴏ ʙᴇ ᴀʙsᴇɴᴛ, ꜰᴏʀ ᴛʜᴏsᴇ ᴏꜰ ʏᴏᴜ ᴘᴏᴏʀ ɪɴ ʙᴀsɪᴄ ʟᴀᴛɪɴ. @CircleHunter ᴛʜɪs ᴏɴᴇ.”
- otherLiam at 9:57 PM: “You said you'd dealt with "a number" of us before. Does that mean more than one, and if so, was it a different group than ours that you were associating with?”
- Mugen Kagemaru at 9:57 PM: “He pops in now and again I know I've seen him more recently”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:58 PM: “ɪ ᴡɪʟʟ ɴᴀᴍᴇ ᴏꜰꜰ ᴀ ꜰᴇᴡ ᴏᴛʜᴇʀs ɪ ʀᴇᴍᴇᴍʙᴇʀ: ᴀᴀᴠᴇʀ, ᴍᴏᴏɴᴅᴀɴᴄᴇʀ, sᴄᴏᴜᴛ, ᴏᴄᴇᴀɴsᴛᴜᴄᴋ.”
- Wolfcat at 9:58 PM: “lets add them all here”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 9:58 PM: “ᴄʜɪʟᴅʀᴇɴ ᴍᴏsᴛʟʏ.
ᴀʜ ʏᴇs, ᴀɴᴅ ᴛʜᴇ ᴏɴᴇ ᴡʜᴏ ʟɪᴋᴇs ʙᴇᴇs.” - Wolfcat at 9:58 PM: “just kidding i do not think that would turn out well”
- Mugen Kagemaru at 9:58 PM: “Only Scout is active last I checked”
- Jos at 9:59 PM: “Buzz”
- Mugen Kagemaru at 9:59 PM: “I haven't seen Aaver since the Truth Arc ended, Oceanstuck vanished at some point around then, and Moondancer left amid a certain shitstorm. And frankly I would only be interested in Aaver and maybe Moondancer returning”
- otherLiam at 10:00 PM: “Anything in particular we can do to make you think we're worth bothering with? Or, are we just gonna hear from you whenever you decide?”
- Mugen Kagemaru at 10:00 PM: “To MAKE him think so? Bit over the line, no?”
- otherLiam at 10:00 PM: “To convince him. Not force him.”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 10:01 PM: “ɪ ᴡᴀɴᴛ ᴛᴏ sᴇᴇ ʜᴏᴡ ʏᴏᴜ ʜᴀɴᴅʟᴇ ᴛʜɪɴɢs ɴᴏᴡᴀᴅᴀʏs ᴀ ʙɪᴛ ꜰɪʀsᴛ.”
- Mugen Kagemaru at 10:01 PM: “Well that answers one question we had. I'll consider that help. Would you object strongly to us inviting him here? If I recall a few of us here are from there too”
- Jos at 10:02 PM: “Any info here is safe from bad eyes, you can be sure.”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 10:02 PM: “ʜᴇ ʜᴀs ʀᴇᴀsᴏɴ ɴᴏᴛ ᴛᴏ ʙᴇ ʜᴇʀᴇ, ᴀɴᴅ ᴛʜᴀᴛ's ᴡʜʏ ɪ'ᴍ ʜᴇʀᴇ. ɪ'ᴍ ᴀʟsᴏ ɢᴏɪɴɢ ᴛᴏ ʀᴇᴍᴏᴠᴇ ᴛʜᴀᴛ ᴘʀᴇᴠɪᴏᴜs ᴍᴇssᴀɢᴇ ʙᴇꜰᴏʀᴇ ɪᴛ ɢᴇᴛs sᴘʀᴇᴀᴅ ᴛᴏ ᴜɴᴡᴀɴᴛᴇᴅ ᴘᴀʀᴛs.”
- Mugen Kagemaru at 10:02 PM: “Um, I just noticed something. Where's Slink?”
- Jos at 10:02 PM: “Always do”
- otherLiam at 10:03 PM: “He left this server.”
- Mugen Kagemaru at 10:03 PM: “Did he say why?”
- otherLiam at 10:04 PM: “I guess the main question I have left is, how can we know we can trust either you or your contact?”
- Wolfcat at 10:04 PM: “slinky said it was too smelly in here”
- Jos at 10:05 PM: “I heard there is a secret sub forum, yet Nocta moved it, no clue about that?”
- ɢʜᴏsᴛʙᴀʙᴇʟ at 10:05 PM: “ɪ ᴡᴏᴜʟᴅɴ'ᴛ ᴛʀᴜsᴛ ᴍᴇ, ʙʏ ᴀ ʟᴏɴɢsʜᴏᴛ. ʙᴜᴛ ɪ ᴅᴏɴ'ᴛ sᴇᴇ ʏᴏᴜ ʜᴀᴠɪɴɢ ʟɪᴛᴛʟᴇ ᴄʜᴏɪᴄᴇ, ᴡɪᴛʜ ʜᴏᴡ ᴛʜɪɴɢs ᴀʀᴇ ɢᴏɪɴɢ ᴛᴏ ʙᴇ ɢᴏɪɴɢ ꜰʀᴏᴍ ʜᴇʀᴇ ᴏɴ ᴏᴜᴛ. ᴍʏ ᴄᴏɴᴛᴀᴄᴛ ɪs sᴏᴍᴇᴏɴᴇ ʏᴏᴜ ᴄᴀɴ ᴛʀᴜsᴛ ᴛʜᴏᴜɢʜ.ᴡʜᴇɴ ᴄɪʀᴄʟᴇʜᴜɴᴛᴇʀ ʀᴇᴛᴜʀɴs ɪ'ᴍ sᴜʀᴇ ʜᴇ'ʟʟ ɢɪᴠᴇ ʏᴏᴜ ᴀ ꜰᴀɪʀ ᴡᴀʀɴɪɴɢ ᴀʙᴏᴜᴛ ᴍᴇ, ᴀɴᴅ ɪ ᴡᴏᴜʟᴅɴ'ᴛ ɢᴏ sᴏ ꜰᴀʀ ᴀs ᴛᴏ sᴀʏ ʜᴇ ᴡᴏᴜʟᴅ ʙᴇ ᴡʀᴏɴɢ ᴀʙᴏᴜᴛ ᴀɴʏ ᴏꜰ ɪᴛ.ʙᴜᴛ ɪ ʜᴀᴠᴇ ɴᴏ ɪɴᴛᴇɴᴛɪᴏɴ ᴏꜰ ʙᴇᴛʀᴀʏɪɴɢ sᴏᴍᴇᴏɴᴇ ᴡʜᴏ ʜᴇʟᴘᴇᴅ ᴍᴇ ᴘᴇʀsᴏɴᴀʟʟʏ ᴏɴ ᴀ sɪɢɴɪꜰɪᴄᴀɴᴛ ʟᴇᴠᴇʟ, ᴀɴᴅ ᴍʏ ᴄᴏɴᴛᴀᴄᴛ ɪs sᴏᴍᴇᴏɴᴇ ɪ ᴏᴡᴇ ᴛʜᴀᴛ ʟᴇᴠᴇʟ ᴏꜰ ᴅᴇʙᴛ ᴛᴏ.”
July 29th, 2019
- At 6:24 PM, ARGdov sent IsocelesAssassin a PM asking him about the current state of the forums.
- At 7:43 PM, IsocelesAssassin replied to ARGdov: “As far as i can tell the password is ’((Censored))’. Maybe you type too fast?“
- At 9:23 PM, IsocelesAssassin send ARGdov another PM - “I know who you are Dov”
- At 9:37 PM, a new character named “GHOSTBABEL” joined the Discord server. The full conversation can be read here: (https://internetdetectives.tumblr.com/post/186653505208/july-29th-2019-chat-with-ghostbabel) Below is a summary:
- Ghostbabel here to help the players, having been sent as a messenger by another undisclosed character.
- Ghostbabel has spoken to several of the players before.
- The person Ghostbabel is working for can be trusted, and for the time being, Ghostbabel is simply acting as an observer.
- At 9:54 PM, Wolfcat submitted Kafei’s Mask in an attempt to contact a ghost. (https://astralobservatory.net/forum/viewtopic.php?f=6&t=1951)
- At 10:11 PM, IsocelesAssassin replied to Kafei’s Mask - “I like this idea, Wolfcat.”
- At 10:22 PM, Yuukichan’s account posted a garbled image in response to Kafei’s Mask - (https://internetdetectives.tumblr.com/post/186653561878/july-29th-2019-yuukichans-images)
- At 10:30 PM, Kaiden_Zoromichi responded to Yuuki’s messages with “….what the hell!”
- At 11:24 PM, the player TheOtherLiam submitted the Lens of Truth in an attempt to obtain a clearer version of the image Yuukichan posted.
- At 11:47 PM, Yuukichan posted an altered version of her previous image. (https://internetdetectives.tumblr.com/post/186653561878/july-29th-2019-yuukichans-images)
August 1st, 2019 - Chat with GHOSTBABEL and Moonman31
- Jos 2:42 PM: “AAAAAAAAAAAAAAAAAAAAAAAa”
- Mr t series good 1:42 PM: “Jos chill”
- Jos t 2:42 PM: “AAAAAAAAAAAAAAAAAAAAAAAa”
- Jos t 2:42 PM: “AAAAAAAAAAAAAAAAAAAAAAAa”
- Jos 6:44 PM: "AAAAAAAAAAAAAAAaa”
- otherLiam 7:02 PM: ”…you alright there bud?”
- Mr t series good 7:06 AM: “Hes Just shitposting dont mind him”
- Wolfcat 12:30 PM: “ghostbaba”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:48 PM: “ᴜᴘ ᴛᴏ ʏᴏᴜʀ ᴜsᴜᴀʟ ᴛʜᴇɴ, ɪ sᴇᴇ.”
- Wolfcat 7:48 PM: "baba”
- otherLiam 7:48 PM: "Pretty much, yeah.”
- Mugen Kagemaru 7:48 PM: "They do that when there’s nothing to do”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:48 PM: “ᴀʙᴏᴜᴛ ᴀs ᴇxᴘᴇᴄᴛᴇᴅ.”
- Jos 7:49 PM: "Hello Ghost, have a nice day over there”
- Mugen Kagemaru 7:49 PM: "It does get grating at some point but honestly just better to give them something to do”
- otherLiam 7:49 PM: "If you were expecting people on the internet to not goof off sometimes, stand by to be disappointed.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:49 PM: "ᴡᴇʟʟ ᴛʜᴇ ᴇᴠᴀɴɢᴇʟɪᴜᴍ ᴏꜰ ᴍʏ ʀᴇᴀᴘᴘᴇᴀʀᴀɴᴄᴇ ɪs ᴛᴏ ʟᴇᴛ ʏᴏᴜ ᴋɴᴏᴡ ᴛʜᴀᴛ ɪᴛ sᴇᴇᴍs ᴍʏ ʜᴇʟᴘɪɴɢ ʏᴏᴜ ɪs ʀᴀᴛʜᴇʀ ɴᴏɴ-ɴᴇɢᴏᴛɪᴀʙʟᴇ, sᴏ ɪ ᴇxᴘᴇᴄᴛ ɪ ᴄᴀɴ sʜᴇᴅ ᴀ ʟɪᴛᴛʟᴇ ꜰᴜʀᴛʜᴇʀ ʟɪɢʜᴛ.”
- Mugen Kagemaru 7:50 PM: "By all means, go ahead. WE WON’T INTERRUPT.”
- Wolfcat 7:52 PM: "funny, mugen”
- Wolfcat 7:52 PM: "you’re killing me”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:52 PM: "ᴡᴇʟʟ ᴛʜᴇʀᴇ’s ᴀ ᴄᴇʀᴛᴀɪɴ ᴘᴀʀᴛ ᴏꜰ ᴛʜɪs ᴡᴇʙsɪᴛᴇ ʏᴏᴜ ɴᴇᴇᴅ ᴛᴏ ɢᴀɪɴ ᴀᴄᴄᴇss ᴛᴏ, ʀɪɢʜᴛ?”
- Mugen Kagemaru 7:53 PM: "Yep”
- otherLiam 7:53 PM: "Apparently there’s a "subspace” where they do all the interesting stuff, yes.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:54 PM: “ɪ'ᴍ sᴜᴘᴘᴏsᴇᴅ ᴛᴏ ʜᴇʟᴘ ʏᴏᴜ ɢᴇᴛ ᴀᴄᴄᴇss ᴛᴏ ɪᴛ; ʜᴏᴡᴇᴠᴇʀ ᴛʜᴇ ᴍᴇᴛʜᴏᴅs ᴛᴏ ᴅᴏ sᴏ ɪɴᴠᴏʟᴠᴇ sᴏᴍᴇ ᴘʟᴀɴɴɪɴɢ ᴀɴᴅ ᴇxᴇᴄᴜᴛɪᴏɴ. ᴅᴇᴛᴀɪʟs ᴀʀᴇ sᴄᴀɴᴛ, ᴀs ɪꜰ ᴛʜᴀᴛ ɪs ᴀɴʏᴛʜɪɴɢ ɴᴇᴡ. ʙᴜᴛ ɪᴛ ɪɴᴠᴏʟᴠᴇs ᴛʜᴇ ᴛʀᴜᴛʜ ᴘᴏʀᴛɪᴏɴ ᴏꜰ ᴛʜᴇ ʙᴏᴀʀᴅ.”
- Jos 7:54 PM: "I can get there”
- otherLiam 7:55 PM: "That’s not difficult, we have access to that.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:55 PM: "ᴡᴇ ʜᴀᴠᴇ ʏᴇᴛ ᴛᴏ ᴘᴜᴛ ᴀʟʟ ᴏꜰ ᴏᴜʀ ᴄʜᴇss ᴘɪᴇᴄᴇs ɪɴ ᴘʟᴀᴄᴇ. ᴊᴜsᴛ ʜᴀᴠᴇ ᴀ ʟɪᴛᴛʟᴇ ᴘᴀᴛɪᴇɴᴄᴇ.”
- Mugen Kagemaru 7:56 PM: "And since Nocta specifically put up a rule against breaking into The Truth, we can assume he has some way of knowing or detecting entries into that area.”
- Jos 7:56 PM: "Fuck the noct”
- Mugen Kagemaru 7:56 PM: "We’re trying, stupid.”
- otherLiam 7:56 PM: "Sure. Feel free to ask here if you need any pawns.”
- Wolfcat 7:56 PM: "we’re trying to fuck nocta?”
- Jos 7:57 PM: "Control yourself mugen”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:57 PM: "ɪ ʙᴇʟɪᴇᴠᴇ ᴀᴛ ᴏɴ ᴘᴏɪɴᴛ ɪɴ ᴛɪᴍᴇ ɪɴ ʏᴏᴜʀ ʜɪsᴛᴏʀʏ ʏᴏᴜ ᴡᴇʀᴇ ᴀʟʟ ᴅɪᴠɪᴅᴇᴅ ᴀɴᴅ ᴀ ᴄᴇʀᴛᴀɪɴ ꜰɪɢᴜʀᴇ ʜᴀᴅ ᴛᴏ ʜᴇʟᴘ ʏᴏᴜ ᴄᴏᴍʙɪɴᴇ ʏᴏᴜʀ ᴇꜰꜰᴏʀᴛs. ᴅᴏ ʏᴏᴜ ʀᴇᴍᴇᴍʙᴇʀ ᴛʜɪs ɪɴᴄɪᴅᴇɴᴛ?”
- Mugen Kagemaru 7:57 PM: "Yes, Wolf. Not in the sexual way, but you already knew that, right?”
- Jos 7:57 PM: "there have been multiple points”
- otherLiam 7:57 PM: "Likely before my time.”
- Mugen Kagemaru 7:58 PM: ”@ɢʜᴏsᴛʙᴀʙᴇʟ You’ll need to specify.”
- Jos 7:58 PM: “There been the time the channels dissapeared and we split in two then the mugen fake id skype group”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:58 PM: "ᴛʜɪs ᴄᴏɴᴄᴇʀɴs ᴀ sᴘᴇᴄɪꜰɪᴄ ᴛɪᴍᴇ ᴡɪᴛʜ sᴏᴍᴇᴏɴᴇ ᴄᴀʟʟᴇᴅ ‘ᴛʜᴇ ɢʀᴀʏ ᴍᴀɴ’.”
- Mugen Kagemaru 7:59 PM: ”@Jos That group was meant to serve the purpose that was eventually served by #johnisdead in the past, and this room in the present.”
- otherLiam 7:59 PM: “That’s a throwback.”
- Mugen Kagemaru 7:59 PM: "Ah yes, when Circle got Helper’s hat.”
- Jos 8:00 PM: "You mean Helper as a figure?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:00 PM: "ᴘᴇʀʜᴀᴘs ʏᴏᴜ ɴᴇᴇᴅ ᴛᴏ ɢᴏ ʙᴀᴄᴋ ᴛᴏ ᴛʜᴇ ᴍᴇɴᴛᴀʟ sᴇᴛᴛɪɴɢ ᴏꜰ ᴛʜᴀᴛ sɪᴛᴜᴀᴛɪᴏɴ, ʙᴇᴄᴀᴜsᴇ ɪ ᴀᴍ ɴᴏᴛ ɴᴇᴀʀʟʏ ᴀs ᴘᴀᴛɪᴇɴᴛ. ʏᴏᴜ sʜᴏᴜʟᴅ ᴀʟsᴏ ᴍᴀʏʙᴇ ᴄᴏɴsɪᴅᴇʀ ʀᴇᴛʀᴀᴄɪɴɢ sᴏᴍᴇ ᴏꜰ ᴛʜᴏsᴇ sᴛᴇᴘs ɪɴ ᴀ ᴍᴏʀᴇ ʟɪᴛᴇʀᴀʟ ꜰᴀsʜɪᴏɴ.”
- Wolfcat 8:01 PM: "the gray man wasn’t exactly patient in the first place”
- Mugen Kagemaru 8:01 PM: ”@Wolfcat Which should tell you how patient Ghost here is”
- otherLiam 8:01 PM: “You think we should pick someone to lead and unite us towards a common goal?”
- Wolfcat 8:02 PM: "I pick Nocta”
- Mugen Kagemaru 8:02 PM: "However, we’re not exactly patient ourselves, and have no time for cryptic vagueness. And lo and behold, Wolf is the new Eve”
- otherLiam 8:02 PM: "If we’re to literally retrace those steps, we’d need to invoke the Postman’s Hat. Which I’m not sure we even have anymore.”
- Jos 8:02 PM: "We do have it. As the mask we have used”
- otherLiam 8:03 PM: "Then we’d need to give it to someone.”
- Jos 8:03 PM: "the question is IA or the counterpart circle”
- Jos 8:03 PM: "must be the first”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:04 PM: "ɪ ᴛʜɪɴᴋ ʏᴏᴜ ʜᴀᴠᴇ ᴇɴᴏᴜɢʜ ʜᴇʟᴘ ᴀs ɪᴛ ɪs. ᴘᴇʀʜᴀᴘs ɪᴛ ɪs ᴛɪᴍᴇ ᴛᴏ ᴄᴏɴsɪᴅᴇʀ ᴏᴛʜᴇʀ ᴇꜰꜰᴏʀᴛs. ʏᴏᴜʀ ꜰʀɪᴇɴᴅ ᴀʀɢᴅᴏᴠ sʜᴏᴜʟᴅ ɴᴏᴛ ʙᴇ sᴏ sᴜsᴘɪᴄɪᴏᴜs ᴏꜰ ʜɪs ɴᴇᴡᴇsᴛ ᴄᴏɴᴛᴀᴄᴛ.”
- otherLiam 8:04 PM: "GB seems to just want us to unite under a common leader so we all act as one when the time comes.”
- Mugen Kagemaru 8:04 PM: "Dov wouldn’t work with us”
- otherLiam 8:04 PM: "He works with us just fine. He just doesn’t wanna be in this room.”
- Mugen Kagemaru 8:05 PM: "And that’s the problem”
- Mugen Kagemaru 8:05 PM: "There are those supposedly involved in these events who are not here”
- Mugen Kagemaru 8:05 PM: "That, first and foremost, should be rectified”
- moonman31 8:06 PM: "wow what is happenin here”
- Jos 8:06 PM: "Hey moon”
- Jos 8:06 PM: "how are ya”
- moonman31 8:06 PM: "I am good buddy”
- Mugen Kagemaru 8:06 PM: "Either everyone involved needs to have access to the same space that is used for participation, or those who refuse to cooperate in that regard should be excised.”
- Mugen Kagemaru 8:06 PM: "Allo Moon”
- Jos 8:07 PM: "Is neat you are doing good buddy”
- Mugen Kagemaru 8:07 PM: ”:arrow_up:”
- otherLiam 8:07 PM: “Hi, Moonman. Good to meet you.”
- Wolfcat 8:07 PM: "Everyone has access to the same information regardless if they are here or not”
- Wolfcat 8:07 PM: "It’s not that big of an issue”
- Mugen Kagemaru 8:08 PM: "Size is irrelevant, it shouldn’t be an issue at all.”
- Wolfcat 8:08 PM: "That’s what she said”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:08 PM: "ɪ ᴛʜɪɴᴋ ᴇᴠᴇʀʏᴏɴᴇ ᴛʀʏɪɴɢ ᴛᴏ ᴅᴏ ᴛʜᴇ sᴀᴍᴇ ᴛʜɪɴɢ ᴀᴛ ᴏɴᴄᴇ ɪs ᴀɴ ᴇᴀsʏ ᴡᴀʏ ᴛᴏ ᴛɪᴘ sᴏᴍᴇᴏɴᴇ ᴏꜰꜰ.”
- moonman31 8:08 PM: "wow nice font buddo”
- moonman31 8:08 PM: "talk a superiority complex”
- Mugen Kagemaru 8:08 PM: "He’s our help from outside. I’m sure you can be caught up in a secure environment.”
- otherLiam 8:09 PM: "So you want us to back off the Truth while you fiddle with it. What should we do in the meantime?”
- moonman31 8:09 PM: "hm”
- otherLiam 8:10 PM: "Also Moonman, meet our new ally. Apparently he’s made of computers.”
- Mugen Kagemaru 8:10 PM: "Literally what I just said, with the exception of the computer bit”
- otherLiam 8:10 PM: "Yeah but I said it, so it’s better.”
- moonman31 8:11 PM: "uh”
- moonman31 8:11 PM: "what”
- Mugen Kagemaru 8:11 PM: "Duo, you are not. Let’s avoid that kind of attitude.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:11 PM: "ɪ'ᴍ ɴᴏᴛ sᴜʀᴇ ʙᴀᴄᴋɪɴɢ ᴏꜰꜰ ɪs ᴡʜᴀᴛ ɪ ᴍᴇᴀɴᴛ. ʙᴜᴛ ᴛᴀᴋᴇ ɪᴛ ʜᴏᴡ ʏᴏᴜ ᴡɪʟʟ. ᴘᴏɪɴᴛ ʙᴇɪɴɢ ɪs ᴡʜᴇɴ ɪ ʜᴀᴠᴇ ᴍᴏʀᴇ ɪɴꜰᴏ ɪ ᴡɪʟʟ ʙᴇ ʜᴇʀᴇ. ꜰᴏʀ ɴᴏᴡ ᴏᴜʀ ᴍᴜᴛᴜᴀʟ ꜰʀɪᴇɴᴅ ɪs ɢᴏɪɴɢ ᴛᴏ ᴋᴇᴇᴘ ᴛʜɪɴɢs ᴇᴠᴇɴ.”
- Jos 8:12 PM: "It happens, i know the feeling.”
- Mugen Kagemaru 8:13 PM: "In future, Ghost, be clear in your wording. Poor communication is but one route by which you can fail your mission.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:13 PM: "sʜᴜᴛ ᴜᴘ.”
- Mugen Kagemaru 8:13 PM: "I’m sure your contact would not appreciate it.”
- Wolfcat 8:13 PM: "lol”
- moonman31 8:13 PM: "and he’s gone”
- otherLiam 8:13 PM: "Let’s not make demands of the spooky cyberdemon who’s only here because his friend wants him to be.”
- Jos 8:13 PM: "A angry AI is not good.”
- Jos 8:13 PM: "see portal”
- Mugen Kagemaru 8:13 PM: "Not AI”
- Wolfcat 8:14 PM: "AI Returns??”
- Mugen Kagemaru 8:14 PM: "Also remember, Liam, [his contact] has him by the balls. He said it himself, his helping us is non-negotiable.”
- moonman31 8:14 PM: ”((Moonman emoji))”
- otherLiam 8:14 PM: “Okay, but we don’t have him by the balls. So maybe don’t act like he’s our bitch.”
- moonman31 8:15 PM: ”((An emoji of King Harkinian from the Legend of Zelda CD-i games is posted titled “King”)) < real disappointed this emoji isn’t :MABOY:”
- Mugen Kagemaru 8:15 PM: “Don’t exaggerate. I simply told him to be more careful in his wording.”
- otherLiam 8:15 PM: "Got anything new for us, Moonman?”
- Jos 8:15 PM: ”:ddd:”
- otherLiam 8:15 PM: “Or you just here to chill and hang?”
- Mugen Kagemaru 8:15 PM: "It may have been harmless now, but it could screw us over later.”
- Wolfcat 8:15 PM: "do any good smokin lately”
- moonman31 8:15 PM: "Not really I have been chilling”
- moonman31 8:15 PM: "Truthfully I am kinda tied”
- Jos 8:15 PM: "can i have some PRODUCT moonman31”
- moonman31 8:16 PM: "Kaiden is being real edgy and suddenly we’re friends now”
- Mugen Kagemaru 8:16 PM: "Hm. Interesting.”
- moonman31 8:16 PM: "and I am trying to not make sure he doesn’t do anything d u m b”
- Mugen Kagemaru 8:16 PM: "Good idea”
- Jos 8:16 PM: "Control your counterpart mugen heh”
- otherLiam 8:16 PM: "You helped him out with that edgy WMM video he made, right?”
- Mugen Kagemaru 8:16 PM: "The "suddenly we’re friends now” thing was a bit of a red flag.”
- Jos 8:17 PM: “Maybe you got a common enemy”
- moonman31 8:17 PM: "for jos”
- Jos 8:17 PM: "maybe nocta is bad for him now”
- otherLiam 8:17 PM: "Was it you who put the weird bit at the end in? Or did Kaiden do that himself?”
- Mugen Kagemaru 8:17 PM: "Kaiden said it was a glitch”
- moonman31 8:18 PM: ”(:̲̅:̲̅:̲̅m̲̅a̲̅r̲̅i̲̅j̲̅u̲̅a̲̅n̲̅a̲̅:̲̅:̲̅:̲̅()”
- Mugen Kagemaru 8:18 PM: “Nocta had something to say about it though…”
- Jos 8:18 PM: "Muchas Gracias”
- otherLiam 8:18 PM: "But IA says it’s footage of Nocta. Which is likely not a glitch.”
- Jos 8:18 PM: "let me smoke in chill”
- Mugen Kagemaru 8:18 PM: "Did he, now? Where did he say that?”
- otherLiam 8:18 PM: "That’s not how rendering glitches work. It doesn’t just go grab some other footage off your computer.”
- moonman31 8:18 PM: "oh yeah”
- Jos 8:18 PM: ”(:̲̅:̲̅:̲̅m̲̅a̲̅r̲̅i̲̅j̲̅u̲̅a̲̅n̲̅a̲̅:̲̅:̲̅:̲̅():fire: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud:”
- otherLiam 8:18 PM: “In the thread witht the video.”
- moonman31 8:18 PM: "kaiden is mad”
- Jos 8:18 PM: ”:eye: :eye: “
- Jos 8:18 PM: “:lips:”
- moonman31 8:18 PM: "but yeah that was nocta”
- moonman31 8:18 PM: "it was from the trip”
- moonman31 8:18 PM: "sneaky sneaky kaiden”
- otherLiam 8:19 PM: "Trip to where?”
- moonman31 8:19 PM: ”:thinking:”
- moonman31 8:19 PM: “that’s the question innit”
- moonman31 8:19 PM: "I wasn’t there, but Kaiden and Nocta sure were”
- moonman31 8:19 PM: "if I had to guess, though, probably the same one where they last ‘saw’ Yuuki”
- Jos 8:20 PM: "Nocta show Kaiden how to improve his time travel stuff, Nocta could have went with him anywhere.”
- Mugen Kagemaru 8:20 PM: "We still need to locate her…”
- moonman31 8:21 PM: "You uh, don’t quite get it do ya bud”
- Mugen Kagemaru 8:21 PM: "Kaiden doesn’t actually have time travel shit I don’t think. That’d mess some shit up for them”
- moonman31 8:21 PM: "She’s… not coming back”
- moonman31 8:21 PM: "alright well that was depressing”
- moonman31 8:21 PM: "bye”
August 1st, 2019
- At 7:48 PM, GHOSTBABEL and Moonman began chatting in the Discord server. The full chat can be read here (https://internetdetectives.tumblr.com/post/186723289123/august-1st-2019-chat-with-ghostbabel-and). Below is a summary:
- Ghostbabel reiterates that we must get into the Subspace on Astralobservatory.net, but it will require some planning and we need to be patient for the time being.
- Ghostbabel urges players to unite as they had done years ago in the presence of The Gray Man.
- Moonman joins the group, seemingly meeting Ghostbabel for the first time.
- Ghostbabel tells Mugen Kagemaru to shut up.
- Kaiden has been acting very friendly towards Moonman as of late.
- The footage of Nocta spliced into Kaiden’s video was from a trip involving Kaiden and Nocta and possibly Yuuki’s death.
#JohnIsDeadTimeline
#timeline
August 2nd, 2019 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: “ɪ sᴇᴇ ᴛʜᴇ ᴍᴏᴍᴇɴᴛ ɪ ʟᴇᴀᴠᴇ ʏᴏᴜ ᴀʟʟ ᴅᴇᴠᴏʟᴠᴇ ɪɴᴛᴏ ʙɪᴄᴋᴇʀɪɴɢ. ɴᴏᴛ ᴇxᴀᴄᴛʟʏ ᴛʜᴇ ‘sᴏʟᴠɪɴɢ ᴛʜᴇ ᴅɪᴠɪsɪᴏɴ’ ɪ ʜᴀᴅ ɪɴ ᴍɪɴᴅ.”
- otherLiam 11:03 PM: “I think we’re pretty well in hand now, actually.”
- otherLiam 11:03 PM: "You having any luck on your end?”
- Wolfcat 11:03 PM: “maybe we should have used the couple’s mask instead”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:04 PM: "ɪꜰ ʏᴏᴜ sᴀʏ sᴏ. ʏᴏᴜ ʟᴏᴛ ᴀʀᴇɴ'ᴛ ᴇxᴀᴄᴛʟʏ sʜɪᴍᴍᴇʀɪɴɢ ʙᴀsᴇᴅ ᴏɴ ʏᴏᴜʀ ᴛʀᴀᴄᴋ ʀᴇᴄᴏʀᴅ ᴏꜰ ᴄᴏᴍᴘʟᴇᴛᴇʟʏ ʟᴏsɪɴɢ sɪɢʜᴛ ᴏꜰ ᴡʜᴀᴛ ʏᴏᴜ ɴᴇᴇᴅ ᴛᴏ ᴅᴏ ᴀɴᴅ ᴅᴏɪɴɢ sᴛᴜᴘɪᴅ ᴛʜɪɴɢs ɪɴsᴛᴇᴀᴅ.”
- otherLiam 11:05 PM: “Can’t really argue with you, but we’re doing the best we can under the circumstances.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:06 PM: "ʏᴏᴜ ᴋɴᴏᴡ, ᴛɪᴍᴇ ɪs ᴀɴ ɪɴᴛᴇʀᴇsᴛɪɴɢ ᴛʜɪɴɢ. ʏᴏᴜ ᴀʀᴇ ᴀʟʟ ꜰᴀᴍɪʟɪᴀʀ ᴡɪᴛʜ ʜᴏᴡ ᴅᴀɴɢᴇʀᴏᴜsʟʏ ᴄᴏᴏᴘᴇʀᴀᴛɪᴠᴇ ɪᴛ ᴄᴀɴ ʙᴇ ᴛᴏ ᴛʜᴏsᴇ ᴡɪʟʟɪɴɢ ᴛᴏ ʙᴇɴᴅ ɪᴛ. ʏᴇs?”
- otherLiam 11:08 PM: "I was under the impression that sort of power was beyond us to set up. We only really messed with time when it was already being messed with. Did you have something in mind?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:09 PM: "ɴᴏ ᴍᴏʀᴇ ᴏꜰ ᴀɴ ᴏʙsᴇʀᴠᴀᴛɪᴏɴ. ʙᴀsᴇᴅ ᴏɴ ᴀ sᴇᴄʀᴇᴛ ᴛʜᴀᴛ ɪsɴ'ᴛ ᴍɪɴᴇ ᴛᴏ sʜᴀʀᴇ, ʙᴜᴛ ᴍᴀʏʙᴇ ɪ ᴀᴍ ᴡɪʟʟɪɴɢ ᴛᴏ ᴛᴏɴɪɢʜᴛ. ᴏʀ ᴍᴀʏʙᴇ ɪ'ʟʟ ᴍᴀᴋᴇ ʏᴏᴜ ᴅʀᴀɢ ɪᴛ ᴏᴜᴛ ᴏꜰ ᴍᴇ.”
- otherLiam 11:12 PM: "I’m not really the dragging type, but I am interested in this secret. Maybe we can make a deal?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:12 PM: "sᴏᴜɴᴅs ɪɴᴛʀɪɢᴜɪɴɢ. ᴡʜᴀᴛ sᴏʀᴛ ᴏꜰ ᴅᴇᴀʟ ᴄᴏᴜʟᴅ ʏᴏᴜ ᴘᴏssɪʙʟʏ ᴏꜰꜰᴇʀ?”
- otherLiam 11:14 PM: "You seem pretty familiar with us. You’re probably well aware the only reason we’ve gotten as far as we have is we have special powers. I imagine someone like you could think of a creative use for them.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:16 PM: "ɴᴏᴡ ᴛʜᴀᴛ sᴏᴜɴᴅs ꜰᴜɴ. ʟᴇᴛ’s sᴀʏ ɪ'ᴍ ɢᴀᴍᴇ ꜰᴏʀ ᴛʜɪs ᴘʀᴏᴘᴏsᴀʟ. ʜᴏᴡ ᴄᴏᴜʟᴅ ɪ ʙᴇ sᴜʀᴇ ʏᴏᴜ ᴡᴏᴜʟᴅ ʜᴏʟᴅ ᴜᴘ ʏᴏᴜʀ ᴇɴᴅ ᴏꜰ ᴛʜɪs ʙᴀʀɢᴀɪɴ? ᴀɴᴅ, ᴍᴏʀᴇ ɪᴍᴘᴏʀᴛᴀɴᴛʟʏ, ʜᴏᴡ ᴄᴏᴜʟᴅ ɪ ʙᴇ ɢᴜᴀʀᴀɴᴛᴇᴇᴅ ᴛʜᴀᴛ ʏᴏᴜ ᴡᴏᴜʟᴅ ʜᴏɴᴏʀ ᴛʜɪs ʀᴇǫᴜᴇsᴛ ᴇᴠᴇɴ ɪꜰ ɪᴛ sᴇᴇᴍᴇᴅ ʟᴇss ᴛʜᴀɴ ʙᴇɴᴇꜰɪᴄɪᴀʟ?”
- otherLiam 11:21 PM: "Well, Circle gave us the rundown on you, and I’m not stupid enough to try and cross you. Right now we have the same goal, so I don’t think you’d do anything that would jeopardize our mission, even if it were to jeopardize us in the short term.”
- otherLiam 11:21 PM: "Is that enough for you?”
- otherLiam 11:21 PM: "Or do you need something more concrete?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:26 PM: "ᴅᴇʟɪᴄɪᴏᴜs. sᴇᴇᴍs ʟɪᴋᴇ ʟᴀɴᴅɪɴɢ ʏᴏᴜʀsᴇʟꜰ ɪɴᴛᴏ ᴅᴀɴɢᴇʀᴏᴜs ᴅᴇᴀʟs ᴄᴏɴᴛɪɴᴜᴇs ᴏɴ ʟɪᴋᴇ ᴀ ᴛʀᴀᴅɪᴛɪᴏɴ. ɪ ᴡᴏᴜʟᴅ ʙᴇ ᴡɪʟʟɪɴɢ ᴛᴏ ᴀᴄᴄᴇᴘᴛ ᴛʜɪs ᴘʀᴏᴘᴏsᴀʟ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:26 PM: "ᴡᴏᴜʟᴅ ʏᴏᴜ ᴍᴀʏʙᴇ ᴡᴀɴᴛ ᴛᴏ ᴛᴀʟᴋ ɪᴛ ᴏᴠᴇʀ ᴡɪᴛʜ ʏᴏᴜʀ ꜰᴇʟʟᴏᴡ ᴅᴇᴛᴇᴄᴛɪᴠᴇs ꜰɪʀsᴛ? ɪ ᴀᴍ ᴡɪʟʟɪɴɢ ʟᴇᴛ ʏᴏᴜ ɢᴇᴛ ᴀ ᴄᴏɴsᴇɴsᴜs.”
- ADULT_LINK 11:28 PM: "that would probably be a good idea”
- otherLiam 11:28 PM: "That’d be for the best, I think. Just so we’re clear - I use our power once on your behalf, for your secret.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ᴅᴏɴ'ᴛ ᴛᴀᴋᴇ ᴛᴏᴏ ʟᴏɴɢ.”
- otherLiam 11:32 PM: "Don’t suppose you’d do us the courtesy of letting us know how you’d want to use our power before we decide?”
- otherLiam 11:32 PM: "Or would we just “owe you one” to be cashed in at some point?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:39 PM: "ᴛʜᴇ sᴇᴄᴏɴᴅ ᴏᴘᴛɪᴏɴ.”
- otherLiam 11:47 PM: "Seems like we’ve reached a consensus. We’ll take the deal.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:50 PM: "ᴇxᴄᴇʟʟᴇɴᴛ. ɪ ᴀᴍ ɢᴏɪɴɢ ᴛᴏ ᴡᴀʀɴ ʏᴏᴜ ꜰɪʀsᴛ: ʏᴏᴜ'ʀᴇ ɴᴏᴛ ɢᴏɪɴɢ ᴛᴏ ʟɪᴋᴇ ᴡʜᴀᴛ ʏᴏᴜ ᴀʀᴇ ɢᴏɪɴɢ ᴛᴏ ʜᴇᴀʀ. ɪ'ᴍ ᴀʟsᴏ ɢᴏɪɴɢ ᴛᴏ ʀᴇɪᴛᴇʀᴀᴛᴇ ᴀ ǫᴜᴏᴛᴇ ɪ ᴛʜɪɴᴋ ʏᴏᴜ'ᴠᴇ ʜᴇᴀʀᴅ ʙᴇꜰᴏʀᴇ: "ᴛɪᴍᴇ ɪs ʟɪᴋᴇ ᴀ ᴄᴏᴍᴘᴜᴛᴇʀ, ɪᴛ ᴄᴀɴ ʙᴇ ʜᴀᴄᴋᴇᴅ."”
- otherLiam 11:51 PM: "Bad news is still more information.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:51 PM: "ɴᴏᴡ, ᴅᴏ ʏᴏᴜ ꜰɪɴᴅ ɪᴛ ᴄᴜʀɪᴏᴜs ᴛʜᴀᴛ ᴛʜɪs ᴛɪᴍᴇʟɪɴᴇ ᴛʜᴀᴛ ᴍʏ ᴄᴏᴍʀᴀᴅᴇ ᴀɴᴅ ɪ sɪᴛ ɪɴ… ᴛʜᴇ ᴏɴᴇ ʏᴏᴜ ʀᴇꜰᴇʀ ᴛᴏ ᴀs ᴛʜᴇ ‘ᴀsᴛʀᴀʟ ᴏʙsᴇʀᴠᴀᴛᴏʀʏ’ ᴛɪᴍᴇʟɪɴᴇ ᴘᴀʀᴀʟʟᴇʟs ʏᴏᴜʀ ᴏᴡɴ? ᴀɴᴅ ʏᴇᴛ, sᴏ ꜰᴇᴡ ᴏꜰ ʏᴏᴜ ʜᴀᴠᴇ ʙᴇᴇɴ ᴀᴄᴄᴏᴜɴᴛᴇᴅ ꜰᴏʀ ᴛʜᴇʀᴇ.”
- otherLiam 11:53 PM: "I honestly hadn’t thought about it. I just assumed I was too new to have popped up over there. But we’re missing a few veterans as well, you’re right ”
- ADULT_LINK 11:53 PM: “yeah, afaik theres no counterpart for me over there. at least not that i’ve been aware of”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:53 PM: “ᴛʜᴇ ʀᴇᴀsᴏɴ ɪ ᴡᴀɴᴛ ʏᴏᴜ ᴛᴏ ʙᴀɴᴅ ᴛᴏɢᴇᴛʜᴇʀ ɪs sɪᴍᴘʟᴇ… “
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:53 PM: ”ʏᴏᴜʀ ᴄᴏʟʟᴇᴄᴛɪᴠᴇ ɪɢɴᴏʀᴀɴᴄᴇ ɴᴇᴠᴇʀ ꜰᴀɪʟs ᴛᴏ ᴀsᴛᴏᴜɴᴅ ᴍᴇ. ᴅᴏ ʏᴏᴜ ᴜɴᴅᴇʀsᴛᴀɴᴅ ʜᴏᴡ ᴛɪᴍᴇ ᴡᴏʀᴋs? ʜᴀᴠᴇ ʏᴏᴜ ᴇᴠᴇɴ ɢɪᴠᴇɴ ᴛʜᴇ ᴄᴏɴᴄᴇᴘᴛ ᴀɴʏ ᴛʜᴏᴜɢʜᴛ? ᴛᴇʟʟ ᴍᴇ ᴛʜɪs - ᴡʜʏ ɪs ᴛʜᴇ ᴏɴᴇ ʏᴏᴜ ᴄᴀʟʟ ɢʀᴇᴛʜ ᴛʜᴇ ᴏɴʟʏ ᴘᴇᴇʀ ʏᴏᴜ sᴇᴇᴍ ᴛᴏ ʀᴇɢᴀʀᴅ? ᴡʜᴀᴛ ᴅᴏ ʏᴏᴜ ʙᴇʟɪᴇᴠᴇ ʙᴇᴄᴀᴍᴇ ᴏꜰ ᴛʜᴇ ʀᴇsᴛ ᴏꜰ ʏᴏᴜ ʟᴏᴛ?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:53 PM: ”ᴛʜᴇ ᴀɴsᴡᴇʀ ɪs sɪᴍᴘʟᴇ: ᴍᴏsᴛ ᴏꜰ ʏᴏᴜ ᴀʀᴇ ᴅᴇᴀᴅ.“
- ADULT_LINK 11:54 PM: "ah”
- otherLiam 11:54 PM: “Dead, or "ascended”?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:55 PM: “ᴡʜʏ ᴅᴏɴ’ᴛ ʏᴏᴜ ᴀsᴋ ʏᴏᴜʀ ᴛʀʏ-ʜᴀʀᴅ ᴜɴꜰᴜɴɴʏ ꜰʀɪᴇɴᴅ ᴍᴏᴏɴᴍᴀɴ? ʜᴇ’s ᴄʟᴇᴀʀʟʏ ɴᴏᴛ ᴛᴇʟʟɪɴɢ ʏᴏᴜ ᴇᴠᴇʀʏᴛʜɪɴɢ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:55 PM: "ɴᴇᴇᴅʟᴇss ᴛᴏ sᴀʏ, ᴛʜɪs ꜰᴀᴄᴛ ɪs ɴᴏᴛ ᴊᴜsᴛ ᴀ sɪᴍᴘʟᴇ ᴋɴɪꜰᴇ ᴛᴏ ʏᴏᴜʀ ɢᴜᴛ. ɪᴛ ɪs ᴠɪᴛᴀʟ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ᴀɴᴅ ᴀ ᴋᴇʏ ᴛᴏ ʏᴏᴜʀ ᴄᴏɴᴛɪɴᴜᴇᴅ ᴘᴀʀᴛɪᴄɪᴘᴀᴛɪᴏɴ ɪɴ ᴘᴇʀʜᴀᴘs ᴄʜᴀɴɢɪɴɢ ᴛʜɪɴɢs ꜰᴏʀ ʏᴏᴜʀsᴇʟᴠᴇs. ʏᴏᴜʀ ᴄᴏᴜɴᴛᴇʀᴘᴀʀᴛs ᴍᴀʏ ʜᴀᴠᴇ ᴇᴀᴛᴇɴ ᴛʜᴇ ᴘʀᴏᴠᴇʀʙɪᴀʟ sʜɪᴛ, ʙᴜᴛ ʏᴏᴜ ᴏʙᴠɪᴏᴜsʟʏ ʜᴀᴠᴇ ᴅᴏɴᴇ ᴍᴀʀɢɪɴᴀʟʟʏ ʙᴇᴛᴛᴇʀ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:55 PM: "ɪ ᴀʟsᴏ ᴇxᴘᴇᴄᴛ ʏᴏᴜ ᴛᴏ ᴋᴇᴇᴘ ʏᴏᴜʀ ᴇɴᴅ ᴏꜰ ᴛʜᴇ ᴅᴇᴀʟ.”
- otherLiam 11:57 PM: "I have no intention of going back on it. I’d rather not make an enemy of you.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:58 PM: "ᴅᴇʟɪᴄɪᴏᴜs.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:58 PM: "ᴀᴅɪᴇᴜ.”
August 2nd, 2019
- At 11:02 PM, GHOSTBABEL joined the Discord server and chatted with the players. The full conversation can be read here: (https://internetdetectives.tumblr.com/post/186749717398/august-2nd-2019-chat-with-ghostbabel) A summary can be read below:
- Ghostbabel has a secret he is willing to share with us relating to the dangers of time travel.
Ghostbabel and the players make a deal - Ghostbabel will share what he knows and the players will “owe him one” later on. - Ghostbabel claims most of the players are dead in the Astral Observatory timeline
- Ghostbabel urges players to ask Moonman for more details, claiming he is not telling the whole truth.
#timeline
#johnisdead timeline
August 3rd, 2019 - Chat with Moonman
- moonman31 8:38 PM: “<a href="https://www.youtube.com/watch?v=82DJUDS_S7Y">https://www.youtube.com/watch?v=82DJUDS_S7Y</a>”
- moonman31 8:38 PM: “I’m here”
- Slinky stinks 8:38 PM: "any memepage on 2019 ^^^^”
- moonman31 8:39 PM: “thank you thank you”
- moonman31 8:39 PM: “https://www.youtube.com/watch?v=gKFYrRLL__0”
- Slinky stinks 8:41 PM: "the theme that plays when you figth with greth at the end of the genocide run”
- Slinky stinks 8:41 PM: "v a p o r l o v a n i a”
- otherLiam 8:47 PM: "ayy moonman”
- moonman31 8:47 PM: "yo”
- otherLiam 8:48 PM: "Do you mind if I ask you kind of a bummer question? I hate to harsh your mellow but it’s important.”
- otherLiam 8:48 PM: "Sorry to just spring that on you.”
- moonman31 8:57 PM: "uh ok buddy
- otherLiam 8:58 PM: "Thanks.”
- otherLiam 8:58 PM: "What happened to the rest of the Internet Detectives in your timeline?”
- moonman31 8:59 PM: "this is uh”
- moonman31 8:59 PM: "yeah wow”
- moonman31 8:59 PM: "ok”
- moonman31 8:59 PM: "well ok”
- moonman31 8:59 PM: "the internet detectives were pretty active for a while”
- moonman31 8:59 PM: "I wanna say until late 2017”
- moonman31 8:59 PM: "maybe early 2018”
- moonman31 8:59 PM: "and they just disappeared.”
- moonman31 8:59 PM: "well most of us”
- Slinky stinks 9:02 PM: "wow, im sorry to hear that.”
- ARGdov 9:02 PM: "Jesus”
- ARGdov 9:02 PM: "Who was left? You and anyoen else we might know?”
- moonman31 9:04 PM: "uh yeah, there was me, IA, Yugi, and Nocta”
- moonman31 9:04 PM: "those were the only ones who didn’t vanish”
- ARGdov 9:06 PM: "Wait”
- ARGdov 9:06 PM: "Yuki?”
- moonman31 9:07 PM: "no, Yugi”
- moonman31 9:07 PM: "He was the spanish guy I mentioned before”
- ARGdov 9:07 PM: "Oh, ok..that does not ring a bell”
- ARGdov 9:07 PM: "Ah”
- Slinky stinks 9:07 PM: "sorry im outdated, who is exactly yugi”
- moonman31 9:07 PM: "He was def spanish because his english was not great and posted spanish memes”
- moonman31 9:07 PM: "but he liked Yugioh, so”
- otherLiam 9:08 PM: "We haven’t met Yugi yet, Slinky.”
- otherLiam 9:08 PM: “That’s terrible, man. I’m sorry that happened. You say they “vanished”. “
- otherLiam 9:08 PM: “Do you mean like, they just left the group and didn’t come online anymore, or full on missing-person-case dropped off the earth irl?”
- Slinky stinks 9:09 PM: "ah, also, im so sorry about that”
- ARGdov 9:09 PM: "Im wondering, then”
- moonman31 9:09 PM: "I can assume they are dead because they vanished.”
- moonman31 9:09 PM: Most of them have grieving families.”
- ARGdov 9:10 PM: "Do you know what ID was doing at the time? What were they incestigating”
- Slinky stinks 9:10 PM: "well if we follow the time, late 2017 was when…”
- ARGdov 9:10 PM: "Im gonna check our records, see what we were doing at the time”
- moonman31 9:10 PM: "I’d rather not think too much more about it to be honest with you. But I’ll answer what I can manage.”
- Slinky stinks 9:11 PM: "sorry about that”
- ARGdov 9:11 PM: "Thats understandable”
- moonman31 9:11 PM: "That being said I don’t honestly remember what the goal was at the time, I always had a foot somewhere else doing other shit.”
- Slinky stinks 9:11 PM: "when the video . was uploaded”
- ARGdov 9:11 PM: "Im just wondering what was different, in your timeline”
- otherLiam 9:11 PM: "Yeah don’t push it man, I know this is hard. I hate doin’ this to you.”
- ARGdov 9:11 PM: "It seems like it was several things already”
- Slinky stinks 9:12 PM: "around the Un 2017 i guess”
- ARGdov 9:12 PM: "But if we can pinpoint more details we can better understand whats going on and how we can help”
- moonman31 9:12 PM: "a lot of stuff seems the same as far as i can tell, except the names of IDs and various events are dramatically different”
- Slinky stinks 9:12 PM: "what was IA name on this timeline?”
- moonman31 9:12 PM: "also I’m under the impression there was no Nocta in your perspective of the group”
- Slinky stinks 9:13 PM: "yeah, kevin was…”
- Slinky stinks 9:13 PM: "not here”
- ARGdov 9:13 PM: "So the person were p sure Nocta is was never in ID”
- ARGdov 9:13 PM: "He was a member of the LC, kinda ascended and became a master of Jid, where all the ascended souls were kept”
- Slinky stinks 9:13 PM: "yeah”
- ARGdov 9:14 PM: "So thats uh…notable. It raised a lot of questions”
- moonman31 9:14 PM: "as far as IsocelesAssassin I’m pretty sure he’s CircleHunter to you guys”
- ARGdov 9:14 PM: "Oh wow”
- ARGdov 9:14 PM: "That”
- Slinky stinks 9:14 PM: "ah”
- ARGdov 9:14 PM: "Makes sense”
- Slinky stinks 9:14 PM: "the name”
- ARGdov 9:14 PM: "But is still kinda freaky”
- ARGdov 9:14 PM: "Wow”
- Slinky stinks 9:14 PM: "yeah”
- ARGdov 9:14 PM: "Yeah lol”
- otherLiam 9:14 PM: "When did Nocta join your side’s ID?”
- Slinky stinks 9:14 PM: "ive thougth abou it this morn lol”
- ARGdov 9:14 PM: "Im wondering, then”
- moonman31 9:15 PM: "Uh Nocta joined us kinda late”
- ARGdov 9:15 PM: "Did an event take place on 11/11 at any point by you guys?”
- moonman31 9:15 PM: "after the bullshit with youshouldnthavedonethat.net”
- moonman31 9:15 PM: "like in 2017”
- moonman31 9:15 PM: "early 2017”
- ARGdov 9:15 PM: "That went down for us mid to late 2016”
- ARGdov 9:15 PM: "But im assuming it was more or less the same bullshit”
- ARGdov 9:15 PM: "Were still not sure what happened there”
- moonman31 9:16 PM: “no the shenanigans with that line up”
- moonman31 9:16 PM: "as far as I can tell”
- moonman31 9:16 PM: "Nocta dipped in shortly after”
- moonman31 9:16 PM: "in early 2017”
- ARGdov 9:16 PM: "Hmm ok, maybe Im misreading something.”
- ARGdov 9:16 PM: "Nonetheless”
- ARGdov 9:16 PM: "So, im wondering”
- ARGdov 9:16 PM: "Things got kinda weird after all that by us too”
- ARGdov 9:16 PM: "Like were all still a little lost. Timelines converged, history mightve been changed, etc”
- ARGdov 9:16 PM: "Early 2017 wouldve been when our greth got wrapped up in everything more seriously, i think”
- otherLiam 9:18 PM: "I think it’s important to know what exactly happened in your side’s version of that event, since it seems like that’s where shit diverged.”
- otherLiam 9:18 PM: "Did you guys vote to use the kill switch?”
- ARGdov 9:19 PM: "Thats a good question”
- ARGdov 9:19 PM: "Did you guys vote yes on the kill switch?”
- moonman31 9:20 PM: "Honestly”
- moonman31 9:20 PM: "I am gonna have to talk to someone about that”
- moonman31 9:20 PM: "I can’t really remember.”
- ARGdov 9:21 PM: "Alright, well, let us know once you find out :/”
- moonman31 9:21 PM: "When most of your friend group dies other shit seems irrelevant even when it clearly is.”
- Slinky stinks 9:21 PM: "yeah dont worry”
- ARGdov 9:21 PM: "We get it”
- ARGdov 9:21 PM: "Youve been through”
- ARGdov 9:21 PM: "A lot”
- ARGdov 9:21 PM: "More than any of us”
- Slinky stinks 9:21 PM: "that is some hard shit, so if you dont remember, we understand”
- ARGdov 9:22 PM: "Weve been involved and have been trying to help and save people but despite all that weve never truly suffered or been put at risk”
- ARGdov 9:22 PM: "And once you were on AO im sure things didnt improve”
- ARGdov 9:22 PM: "Which reminds me- how did you get invovled with AO?”
- otherLiam 9:22 PM: "Like I said, don’t push yourself. Find out when you’re able.”
- moonman31 9:23 PM: "Well Nocta sort of dipped out for a bit from ID. After that happened all the scariest shit went down.”
- moonman31 9:23 PM: "I tracked him down myself and idk, I joined in because I wanted to see how he was doing.”
- moonman31 9:23 PM: "I thought it was important to keep the connections that were still around going”
- Slinky stinks 9:23 PM: "makes sense”
- moonman31 9:23 PM: "Anyway he had set up a shittier version of AO by that point.”
- ARGdov 9:24 PM: "Yeah.”
- moonman31 9:24 PM: "I was worried about him but the more he let me in the more parallels with stuff I’d seen before, but more real to me. So I felt, in the crumbled spirit of ID that remained, I had sort of a g o d l y responsibility to make sure shit didn’t go too far.”
- moonman31 9:24 PM: "Seems I failed lol.”
- ARGdov 9:25 PM: "You tried, and thats whats important”
- ARGdov 9:25 PM: "This is cold comfort I know but theres no way everyone can ever be saved. And those losses arent your fault”
- moonman31 9:26 PM: "anyways the spirit of WH from my world lives in on in basically just me and IA now, though he’s… different, now.”
- moonman31 9:26 PM: "Anyways I’m gonna bounce.”
- ARGdov 9:26 PM: ”…alright”
- moonman31 9:26 PM: “This was also fucking depressing.”
August 3rd, 2019
- At 8:38 PM, Moonman joined the Discord server and began chatting with the players. The full conversation can be read here (https://internetdetectives.tumblr.com/post/186791948098/august-3rd-2019-chat-with-moonman). Below is a summary:
- Moonman confirms that most of the Internet Detectives died sometime around late 2017 or early 2018 in his timeline.
- Moonman says the surviving Internet Detectives were himself, Nocta, IsocelesAssassin, and the previously mentioned Spanish user named Yugi.
- Nocta was a member of the Internet Detectives in the Astral Observatory’s timeline, joining sometime in 2017 after The Truth Arc.
- Moonman believes that our timelines are mostly the same aside from a few names and events.
- IsocelesAssassin is the Astral Observatory Timeline’s version of the player named CircleHunter.
- Nocta left the Internet Detectives before the rest of the Internet Detectives disappeared.
Moonman tracked down Nocta and joined the Astral Observatory, though he was ultimately unable to stop Nocta from going too far with the group and transforming it into a cult.
#timeline
#johnisdead timeline
August 6th, 2019 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:41 PM: “ɪ ᴡᴏɴᴅᴇʀ ɪꜰ ʜᴇ ᴅᴏᴇsɴ'ᴛ ʀᴇᴍᴇᴍʙᴇʀ, ᴏʀ ᴡᴏɴ'ᴛ ᴛᴇʟʟ ʏᴏᴜ?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:41 PM: "ꜰᴀsᴄɪɴᴀᴛɪɴɢ, ɪsɴ'ᴛ ɪᴛ?”
- Slinky stinks 10:42 PM: "It is… “
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:42 PM: ”…”
- otherLiam 10:43 PM: “Welcome back.”
- ADULT_LINK 10:43 PM: "o/ hello”
- otherLiam 10:43 PM: "Don’t suppose you have any insight into what’s happening with johnisdead.com?”
- ADULT_LINK 10:43 PM: "i realised i never introduced myself, and i’m not sure how well, if at all, you know about me”
- ADULT_LINK 10:43 PM: "nice to meet you”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:44 PM: "ᴛʜᴀᴛ ɪᴛ’s ʟᴏᴄᴋᴇᴅ? sᴜʀᴇ, ɪ ᴅᴏ. ʙᴜᴛ ᴛʜᴀᴛ ɪsɴ'ᴛ ᴡʜᴀᴛ ɪ'ᴍ ʜᴇʀᴇ ꜰᴏʀ, ɪs ɪᴛ? ᴍʏ ɢᴏᴀʟs ᴀʀᴇ ᴛᴏ ʜᴇʟᴘ ʏᴏᴜ ᴡɪᴛʜ ʏᴏᴜʀ ɪᴍᴍᴇᴅɪᴀᴛᴇ ᴛʀᴏᴜʙʟᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:44 PM: "ʜᴇʟʟᴏ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:44 PM: "ɪ ʙᴇʟɪᴇᴠᴇ ᴡᴇ'ᴠᴇ ᴍᴇᴛ ʙᴇꜰᴏʀᴇ, ᴀʟʙᴇɪᴛ ʙʀɪᴇꜰʟʏ.
- Slinky stinks 10:45 PM: "Nice to meet you ghost”
- Slinky stinks 10:45 PM: "I think it’s the first time I talk to you, and you know how a network can be hacked, can we count John is dead as a network?”
- Jos 10:47 PM: "Ghost means Thorin lol”
- otherLiam 10:47 PM: "What sort of immediate trouble are we in?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:47 PM: “v”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:47 PM: "v”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:47 PM: "v”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:47 PM: "ᴅᴏᴡɴ ᴅᴏᴡɴ ᴛʜᴇ ʀᴀʙʙɪᴛ ʜᴏʟᴇ ʏᴏᴜ ɢᴏ, ʙᴜᴛ sᴛɪʟʟ ʟᴏsᴛ ᴀɴᴅ ᴡʜᴇʀᴇ ʏᴏᴜ ᴀʀᴇ? ᴏɴʟʏ ɪ ᴋɴᴏᴡ”
- Slinky stinks 10:48 PM: "Wonderland?”
- Slinky stinks 10:48 PM: "I mean, another universe?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:48 PM: "ᴀ ʀᴇꜰᴇʀᴇɴᴄᴇ.”
- Jos 10:49 PM: "Gotcha, let me see”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:50 PM: "sᴏᴍᴇᴛɪᴍᴇs ʏᴏᴜ ᴛʜɪɴᴋ ᴛᴏᴏ ʜᴀʀᴅ ᴀʙᴏᴜᴛ ᴡʜᴀᴛ ɪ sᴀʏ. ɪ ᴀᴍ sɪᴍᴘʟʏ ᴛᴏʏɪɴɢ ᴡɪᴛʜ ʏᴏᴜ. ᴀs ꜰᴀʀ ᴀs ᴊᴏʜɴɪsᴅᴇᴀᴅ.ᴄᴏᴍ ɢᴏᴇs, ɪ ᴋɴᴏᴡ ʜᴏᴡ ᴛᴏ ɢᴇᴛ ɪɴ. ʙᴜᴛ ɪᴛ’s ᴀ ᴘʀᴏᴄᴇss. ᴏɴᴇ ᴡᴇ'ᴠᴇ ᴀʟʀᴇᴀᴅʏ sᴛᴀʀᴛᴇᴅ. ʜᴀᴠᴇ ᴀ ʟɪᴛᴛʟᴇ ᴘᴀᴛɪᴇɴᴄᴇ.”
- Slinky stinks 10:50 PM: "We will have patience, thank you”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:50 PM: "ᴀʟᴛʜᴏᴜɢʜ ʏᴏᴜ ᴇxᴘᴇᴅɪᴛᴇᴅ ᴛʜɪɴɢs ᴛᴏ ʏᴏᴜʀ ᴏᴡɴ ᴅɪsʙᴇɴᴇꜰɪᴛ, ᴛʀᴜᴛʜꜰᴜʟʟʏ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:50 PM: "ᴏᴜʀ ᴛɪᴍᴇ ᴛᴀʙʟᴇ ɪs sʜᴏʀᴛᴇʀ ɴᴏᴡ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:50 PM: "ʏᴏᴜ ʜᴀʟᴠᴇᴅ ᴛʜᴇ ᴄʟᴏᴄᴋ ᴏꜰ ᴏᴜʀ ᴄʜᴇss ᴍᴀᴛᴄʜ ᴡɪᴛʜ ʏᴏᴜʀ ɪɴᴄᴇssᴀɴᴛ ᴜsᴀɢᴇ ᴏꜰ ᴘᴏᴡᴇʀs.”
- ADULT_LINK 10:51 PM: "its because we tried to get in with the key, isnt it”
- ADULT_LINK 10:51 PM: "oof”
- Slinky stinks 10:51 PM: "It is”
- Slinky stinks 10:51 PM: "How are we, in terms of time now”
- Jos 10:52 PM: "It is that you used too much powers in too few time, the chances of bad backfiring were increasing in each power use, and probably backfired twice lol”
- ADULT_LINK 10:52 PM: "we got impatient ¯\_(ツ)_/¯”
- Slinky stinks 10:52 PM: "Fuck
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:52 PM: "ᴛʜᴇ ᴛɪᴍᴇ ᴡᴇ ʜᴀᴠᴇ ɪs ʟᴇss ᴅᴇᴛᴇʀᴍɪɴᴀʙʟᴇ ᴀs ᴀ sᴇᴛ ᴀᴍᴏᴜɴᴛ ᴏꜰ ᴛɪᴍᴇ, ᴀɴᴅ ᴍᴏʀᴇ ᴏꜰ ‘ʜᴏᴡ ǫᴜɪᴄᴋʟʏ ɪs ᴏᴜʀ ᴇɴᴇᴍʏ ᴍᴏᴠɪɴɢ’?”
- ARGdov 10:53 PM: "wait so”
- Slinky stinks 10:53 PM: "Do we have enough time to talk to yuuki? Or at least having contact”
- ARGdov 10:53 PM: "the fact that we started to doing shit”
- ARGdov 10:53 PM: "means the enemy will be moving faster to respond”
- otherLiam 10:53 PM: "If you could give us some sense of direction, we wouldn’t need to grasp in the dark like this.”
- ARGdov 10:53 PM: "because they know were working towards something”
- Slinky stinks 10:53 PM: "Basically: we fucked up”
- Jos 10:53 PM: "Way too much shit Ghost means”
- ARGdov 10:53 PM: "well yeah of course we fucked up, we are the internet detectives”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:54 PM: "ᴛʜᴇ ᴀɴsᴡᴇʀ ʟɪᴇs ɪɴ ᴛʜᴇ sᴜʙsᴘᴀᴄᴇ. ᴀᴄᴄᴇss ᴛʜᴇ sᴜʙsᴘᴀᴄᴇ, ᴀɴᴅ ʏᴏᴜ ᴡɪʟʟ ʜᴀᴠᴇ ᴛʜᴇ ᴀᴄᴄᴇss ᴛᴏ ᴇᴠᴇʀʏᴛʜɪɴɢ ʏᴏᴜ ᴄᴜʀʀᴇɴᴛʟʏ ᴀʀᴇ ᴘᴇsᴛᴇʀɪɴɢ ᴍᴇ ꜰᴏʀ.”
- ARGdov 10:54 PM: "we stumble around in the dark and someehow manage to not kill everyone”
- Slinky stinks 10:54 PM: "Liam check the JID channel quick”
- ARGdov 10:54 PM: "well, in this timeline anyways”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:54 PM: "ɴᴏᴡ ᴛʜᴇ ǫᴜᴇsᴛɪᴏɴ ɪs, ʜᴏᴡ ᴛᴏ ɢᴇᴛ ᴛᴏ ɪᴛ, ᴏꜰ ᴄᴏᴜʀsᴇ. ᴀɴᴅ ᴛʜᴀᴛ’s ᴡʜᴀᴛ ɪ'ᴠᴇ ʙᴇᴇɴ ᴡᴏʀᴋɪɴɢ ᴏɴ ꜰᴏʀ ʏᴏᴜ.”
- Slinky stinks 10:55 PM: "Link Agreggation”
- ARGdov 10:55 PM: "you’ve figured out a way in?”
- ARGdov 10:55 PM: "well, are you willing to share it?”
- ARGdov 10:55 PM: "also if you dont mind me asking…why are you helping us?”
- otherLiam 10:56 PM: "He’s answered that already. We have a mutual friend we shouldn’t name.”
- ARGdov 10:56 PM: "ah ok”
- ARGdov 10:56 PM: "missed that, my bad”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:56 PM: "ɪ ʜᴀᴠᴇ ᴀɴ ɪᴅᴇᴀ ᴏꜰ ᴡʜᴀᴛ ᴛᴏ ᴅᴏ, ʙᴜᴛ ɪꜰ ɪ ᴛᴇʟʟ ʏᴏᴜ ɴᴏᴡ ʏᴏᴜ ᴡɪʟʟ ᴊᴜsᴛ ᴅᴏ ᴡʜᴀᴛᴇᴠᴇʀ ɪ ᴛʜɪɴᴋ ɪᴛ ᴍᴀʏ ʙᴇ ᴡɪᴛʜᴏᴜᴛ ᴀɴʏ ʜᴇsɪᴛᴀɴᴄᴇ ᴀɴᴅ ᴘᴏssɪʙʟʏ ᴍᴀᴋᴇ ᴛʜᴇ sɪᴛᴜᴀᴛɪᴏɴ ᴡᴏʀsᴇ. ʙᴜᴛ ɪ ʙᴇʟɪᴇᴠᴇ ʏᴏᴜ ᴡɪʟʟ ʜᴀᴠᴇ ᴛᴏ ᴘᴏsᴛ sᴏᴍᴇᴛʜɪɴɢ 'sᴘᴇᴄɪꜰɪᴄ’ ɪɴ ᴛʜᴇ ᴛʀᴜᴛʜ.
- otherLiam 10:57 PM: "So, you’d rather us stand by and do nothing, then?”
- ARGdov 10:57 PM: "it sounds like it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:57 PM: "ɪ ɴᴇᴠᴇʀ sᴀɪᴅ ᴛʜᴀᴛ.”
- Jos 10:57 PM: "Act, but slower”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:57 PM: "ʏᴏᴜ ɴᴇᴇᴅ ᴛᴏ ᴘʟᴀʏ ᴛʜᴇ ɢᴀᴍᴇ.”
- ARGdov 10:57 PM: "well, you did just kinda imply if we act now we’ll fuck up”
- ARGdov 10:57 PM: "I see”
- ADULT_LINK 10:57 PM: "oh hey ghost, do you know anything about my alternate self from the other timeline?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:58 PM: "ɪ sᴀɪᴅ ɪ ɴᴇᴇᴅᴇᴅ ᴛᴏ ʙᴇ sᴜʀᴇ ᴛʜᴀᴛ ᴛʜᴇ ᴀᴄᴛɪᴏɴs ʏᴏᴜ ᴡɪʟʟ ᴛᴀᴋᴇ ᴀʀᴇ ᴛʜᴇ ᴄᴏʀʀᴇᴄᴛ ᴏɴᴇs. ɪꜰ ᴛʜᴇʏ ᴀʀᴇɴ'ᴛ, ɪ ᴄᴏᴜʟᴅ ɪᴍᴀɢɪɴᴇ ɪᴛ ᴡᴏᴜʟᴅ ᴍᴀᴋᴇ ᴛʜᴇ sɪᴛᴜᴀᴛɪᴏɴ ᴡᴏʀsᴇ.”
- ARGdov 10:58 PM: "right”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:58 PM: "ɪ ᴋɴᴏᴡ ᴛʜᴀᴛ ʏᴏᴜ'ʀᴇ ᴅᴇᴀᴅ.”
- Jos 10:58 PM: "I know mine is death for looking into jid and lc server”
- ARGdov 10:58 PM: "so, we’ll be cautious. We’ve been doing a lot the past day or two so”
- ADULT_LINK 10:58 PM: "dang. anything else?”
- ADULT_LINK 10:58 PM: "not a huge deal if not, just curious tbh”
- Slinky stinks 10:59 PM: "Okay Babel, we should slow down, think and then post the "specific thing"”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:59 PM: "ʏᴏᴜʀ ᴜsᴇʀɴᴀᴍᴇ ᴡᴀs ʏᴏᴜɴɢ_ʟɪɴᴋ”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:59 PM: "ᴠᴇʀʏ ᴏʀɪɢɪɴᴀʟ.”
- ARGdov 11:00 PM: "inb4 mine was IRLdave”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:00 PM: "ɴᴏ, ʏᴏᴜ sʜᴏᴜʟᴅ ʟᴜʀᴇ ɴᴏᴄᴛᴀ ʙᴀᴄᴋ ᴏᴜᴛ ᴏꜰ ʜɪᴅɪɴɢ ᴡʜɪʟᴇ ᴍʏ ᴄᴏᴍʀᴀᴅᴇ ᴀɴᴅ ɪ ᴄᴏɴᴛɪɴᴜᴇ ᴛᴏ ᴄᴏᴍʙ sɪᴛᴇ ꜰɪʟᴇs. “
- ARGdov 11:00 PM: "ok”
- Jos 11:00 PM: "I guess mine was José without the e removed”
- ARGdov 11:00 PM: "any suggestions how we can do that?”
- Jos 11:00 PM: "So, you guys want to bring nocta attention?”
- ARGdov 11:00 PM: "and Im assuming, going by all of this, that us posting that key thing didnt doing anything”
- otherLiam 11:01 PM: "Actually it did. It sped up our timetable.”
- otherLiam 11:01 PM: "So it was a mistake.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:01 PM: "ʜᴇ ɪs ᴅᴇsᴘᴇʀᴀᴛᴇ ᴇɴᴏᴜɢʜ ᴛᴏ sᴛᴀʀᴛ ᴀᴄᴄᴇᴘᴛɪɴɢ ɴᴇᴡ ᴍᴇᴍʙᴇʀs ɪɴᴛᴏ ʜɪs ᴏʀᴅᴇʀ. ɪ ᴀssᴜᴍᴇ ɪꜰ ᴇɴᴏᴜɢʜ ᴘᴇᴏᴘʟᴇ ᴘʟᴀʏ ᴛʜᴇ ᴘᴀʀᴛ ᴘᴇʀʜᴀᴘs ᴍᴏʀᴇ ᴡɪʟʟ ɢᴀɪɴ ʟᴇɢɪᴛɪᴍᴀᴛᴇ ᴀᴄᴄᴇss. ᴀs ɪᴛ sᴛᴀɴᴅs ɴᴏᴡ, ᴛʜᴇ ᴜsᴇʀs ᴄᴇʟᴇsᴛɪᴀʟ_ʟɪɢʜᴛ ᴀɴᴅ ᴀʀɢᴅᴏᴠ sᴇᴇᴍ ᴛᴏ ʙᴇ ᴛʜᴇ ᴏɴʟʏ ᴏɴᴇs ɪɴ ʜɪs ɢᴏᴏᴅ ɢʀᴀᴄᴇs.”
- ARGdov 11:01 PM: "true”
- ARGdov 11:01 PM: "but he never responded to my last message”
- ARGdov 11:01 PM: "I could try again I suppose”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: "ʜᴇ ɪs ᴛʜᴇʀᴇ. ʏᴏᴜ ᴄᴀɴ ʟᴏɢɪɴ ɪɴ ᴀɴᴅ ʜɪᴅᴇ ʏᴏᴜʀ ᴏɴʟɪɴᴇ sᴛᴀᴛᴜs. ʜᴇ ɪs ᴀʟᴍᴏsᴛ ᴀʟᴡᴀʏs ᴛʜᴇʀᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: "ʜᴇ ᴄᴀɴ'ᴛ ʜɪᴅᴇ ɪᴛ ꜰʀᴏᴍ ᴍᴇ, ᴛʜᴏᴜɢʜ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: "ᴛʜᴀᴛ ɪs ᴡʜʏ ɪ ᴀᴍ ʜᴇʀᴇ.”
- ARGdov 11:03 PM: "spoopy.”
- Slinky stinks 11:03 PM: "So, we should get nocta too busy”
- Slinky stinks 11:03 PM: "So you can do your thing”
- ARGdov 11:03 PM: "ok, Ill send him another message, maybe asking the same thing.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:03 PM: "ɪᴛ ɪs ᴜᴘ ᴛᴏ ʏᴏᴜ ʜᴏᴡ ᴛᴏ ᴘʀᴏᴄᴇᴇᴅ. ɪ ᴀᴍ ᴏɴʟʏ ᴘʀᴏᴠɪᴅɪɴɢ… ꜰʀɪᴇɴᴅʟʏ ᴡᴀʀɴɪɴɢs.”
- ADULT_LINK 11:04 PM: "i think we should chill a bit from the "as soon as we get information we act on it” train we’re going down”
- otherLiam 11:04 PM: “Those of us who’ve utilized powers should back off, then, while those who haven’t (and thus haven’t blown our cover) should try to get into Nocta’s fold.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:04 PM: "sᴘᴇᴀᴋɪɴɢ ᴛʀᴜᴛʜꜰᴜʟʟʏ ɪ ᴄᴏᴜʟᴅ ᴄᴀʀᴇ ʟᴇss ɪꜰ ʏᴏᴜ ᴀʟʟ ᴅɪᴇᴅ ᴀɢᴀɪɴ, ᴀs ʟᴏɴɢ ᴀs ɪᴛ’s ᴀꜰᴛᴇʀ ᴏᴜʀ ᴀɢʀᴇᴇᴍᴇɴᴛ ɪs ꜰᴜʟꜰɪʟʟᴇᴅ.”
- ARGdov 11:04 PM: "yeah thats not surprising”
- ARGdov 11:04 PM: "but also”
- ARGdov 11:04 PM: "Im fairly certain we havent fulfilled our end of the agreement”
- ADULT_LINK 11:04 PM: "haha cold :P”
- ADULT_LINK 11:04 PM: "but understandable i guess”
- ARGdov 11:04 PM: "so you have an invested interest in keeping us alive”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ꜰᴏʀ ɴᴏᴡ. ɪ ᴅᴏɴ'ᴛ ɴᴇᴇᴅ ᴀʟʟ ᴏꜰ ʏᴏᴜ, ᴛʜᴏᴜɢʜ. ᴏɴʟʏ ᴏɴᴇ ᴏꜰ ʏᴏᴜ.”
- Slinky stinks 11:05 PM: "He has a lot of versions of us at his hand”
- Slinky stinks 11:05 PM: "So he could try again with another universe”
- otherLiam 11:05 PM: "Have anyone picked out?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ᴛʜᴀᴛ ɪs ᴜɴᴛʀᴜᴇ. ɪɴ ᴍʏ ᴛɪᴍᴇʟɪɴᴇ ʏᴏᴜ ʜᴀᴠᴇ ᴀʟʟ ᴅᴇᴄᴇᴀsᴇᴅ, ᴀs ᴍᴇɴᴛɪᴏɴᴇᴅ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ɪ ᴄᴏᴜʟᴅ ᴄᴀʀᴇ ʟᴇss. ᴀs ʟᴏɴɢ ᴀs ᴀɴ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇ ꜰᴜʟꜰɪʟʟs ᴛʜᴇ ʙᴀʀɢᴀɪɴ.”
- Slinky stinks 11:06 PM: "Hmm…”
- otherLiam 11:06 PM: "Oh, that’s what you meant.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:07 PM: "ɪᴛ’s sᴏᴍᴇᴡʜᴀᴛ sᴀᴅᴅᴇɴɪɴɢ ᴄɪʀᴄʟᴇʜᴜɴᴛᴇʀ ᴄᴏɴᴛɪɴᴜᴇs ᴛᴏ ɪɢɴᴏʀᴇ ᴍʏ ᴘʀᴇsᴇɴᴄᴇ. ɪ ᴛʜᴏᴜɢʜᴛ ᴡᴇ, ᴀᴛ ᴛʜᴇ ᴠᴇʀʏ ʟᴇᴀsᴛ, ᴍᴀʏ ʜᴀᴠᴇ ʙᴇᴇɴ ᴏɴ ɢᴏᴏᴅ ᴛᴇʀᴍs.”
- Slinky stinks 11:07 PM: "You mean our circlehunter”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:07 PM: "ɪ ᴍᴀʏ ʜᴀᴠᴇ ᴀ ᴠᴇsᴛᴇᴅ ɪɴᴛᴇʀᴇsᴛ ɪɴ ʜɪs sᴜʀᴠɪᴠᴀʟ, ᴘᴇʀʜᴀᴘs. ʜᴇ ᴅɪᴅ ʜᴇʟᴘ ꜰʀᴇᴇ ᴍᴇ, ᴀꜰᴛᴇʀ ᴀʟʟ.”
- Slinky stinks 11:07 PM: "Or your circlehunter”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:07 PM: "ɪ ᴡᴏᴜʟᴅ ɴᴏᴛ ʀᴇꜰᴇʀ ᴛᴏ ᴍʏ 'ᴄɪʀᴄʟᴇʜᴜɴᴛᴇʀ’ ʙʏ ᴛʜᴀᴛ ɴᴀᴍᴇ.”
- Slinky stinks 11:07 PM: "Okay, my bad”
- Slinky stinks 11:07 PM: "Sorry”
- CircleHunter 11:08 PM: "i’m not ignoring you”
- CircleHunter 11:08 PM: "i’m just juggling a lot”
- ARGdov 11:08 PM: "indeed he is.”
- ARGdov 11:08 PM: "its very hard to save the world when you’re a working man on the job :v”
- CircleHunter 11:09 PM: "it’s actually my day off”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:09 PM: "ʜᴀ ʜᴀ. ᴘᴇʀʜᴀᴘs ɪɴᴅᴇᴇᴅ.”
- ARGdov 11:10 PM: "fighting evil by moonlight”
- ARGdov 11:10 PM: "managing walmart by daylight”
- Slinky stinks 11:10 PM: "Babel”
- Slinky stinks 11:10 PM: "Before you go”
- Slinky stinks 11:10 PM: "Do we know who is Yugi?”
- ARGdov 11:10 PM: "I sent a message to Nocta btw”
- ARGdov 11:10 PM: "thats what Im wondering too. along with wether you can tell us anything about what got our other selves killed…”
- ARGdov 11:10 PM: "but one question at a time, I guess”
- otherLiam 11:11 PM: "Yeah I’ve got one too, but I’ll sit on it.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:11 PM: "ɪꜰ ɪᴛ ᴡɪʟʟ ʜᴇʟᴘ ʏᴏᴜ ᴀʟʟ ᴛʀᴜsᴛ ᴍᴇ ᴀ ʟɪᴛᴛʟᴇ ʙɪᴛ ꜰᴜʀᴛʜᴇʀ, ɪ ᴏᴡᴇ ʏᴏᴜʀ ꜰᴀᴄᴛɪᴏɴ ᴏꜰ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇs ᴍʏ ꜰʀᴇᴇᴅᴏᴍ… ᴛʜᴇ ꜰɪʀsᴛ ᴛɪᴍᴇ. ɪ ᴜsᴇᴅ ᴛᴏ ʙᴇ ʟᴏᴄᴋᴇᴅ ᴀᴡᴀʏ, ɪɴ ᴀ ʙᴏx. ᴡʜᴇɴ ɪ ᴡᴀs ʟᴏᴄᴋᴇᴅ ɪɴ ᴛʜᴀᴛ sᴀᴍᴇ ɢᴏᴅ ꜰᴏʀsᴀᴋᴇɴ ʙᴏx ᴛʜᴇ sᴇᴄᴏɴᴅ ᴛɪᴍᴇ, ɪᴛ ᴡᴀs ᴛʜᴇ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇs ᴡʜᴏ ᴄᴀᴍᴇ ᴛᴏ ᴍʏ ʀᴇsᴄᴜᴇ ᴏɴᴄᴇ ᴀɢᴀɪɴ… ᴏʀ, ᴛʜᴇ ᴏɴᴇ ᴍᴇᴍʙᴇʀ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:11 PM: "ɴᴇᴇᴅʟᴇss ᴛᴏ sᴀʏ ᴅᴇsᴘɪᴛᴇ ᴍʏ ꜰᴀᴄᴀᴅᴇ ɪ ʜᴀᴠᴇ ᴀ ʟɪᴛᴛʟᴇ ᴄᴀʀᴇ ꜰᴏʀ ʏᴏᴜʀ ʟᴏᴛ. ʟᴇss ᴛʜᴀɴ ʏᴏᴜ'ᴅ ʟɪᴋᴇ, ᴍᴏʀᴇ ᴛʜᴀɴ ʏᴏᴜ ᴀssᴜᴍᴇ.”
- ARGdov 11:12 PM: "oh, we trust you, I get the feeling you dont have a reason to lie to us
- at least not at the moment”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:12 PM: "ᴀʟʙᴇɪᴛ, ᴛʜᴇ sᴇᴄᴏɴᴅ ᴛɪᴍᴇ ᴡᴀs ɴᴏᴛ 'ʏᴏᴜʀ’ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇs. ɪᴛ ᴡᴀs ᴛʜᴇ ʟᴏɴᴇ ᴍᴇᴍʙᴇʀ ᴏꜰ 'ᴍʏ’ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇs.”
- otherLiam 11:12 PM: "What we lack in competence we make up for in heart.”
- Slinky stinks 11:13 PM: "Wait”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:13 PM: "ᴛʜᴀᴛ ɪs ᴀᴡꜰᴜʟʟʏ ᴜɴᴡɪsᴇ.”
- ARGdov 11:13 PM: "tbh we arent the best when it comes to heart either”
- CircleHunter 11:13 PM: "the institution recaptured you?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:13 PM: "ɪ ᴛʜɪɴᴋ ᴄᴏᴍᴘᴇᴛᴇɴᴄᴇ ᴡᴏᴜʟᴅ ʙᴇ ᴍᴏʀᴇ ɪᴍᴘᴏʀᴛᴀɴᴛ ɪɴ ᴀ ᴘᴏssɪʙʟᴇ ᴄᴀᴛᴀᴄʟʏsᴍɪᴄ sᴄᴇɴᴀʀɪᴏ.”
- ARGdov 11:13 PM: "also I like that ID being shit at this has become such an in-joke we dont even care anymore”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:13 PM: "ʏᴇs.”
- otherLiam 11:14 PM: "I have a feeling I can guess who saved you over there, but let’s not name them.”
- ARGdov 11:14 PM: "I couldnt guess but its not the important thing.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:14 PM: "ɪᴛ ᴡᴏᴜʟᴅ ʙᴇ ᴜɴᴡɪsᴇ ᴛᴏ ɴᴀᴍᴇ ᴛʜᴇᴍ ʜᴇʀᴇ, sɪɴᴄᴇ ɪ ᴅᴏ ɴᴏᴛ ᴛʀᴜsᴛ ᴍᴏᴏɴᴍᴀɴ ᴡɪᴛʜ ᴛʜᴀᴛ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ.”
- otherLiam 11:15 PM: "This might not be something you know, but when the ID of your time encountered the “kill switch”, do you know how they voted?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:16 PM: "ɪ ᴀᴍ ɴᴏᴛ sᴜʀᴇ ᴡʜᴀᴛ ᴛʜɪs ᴋɪʟʟsᴡɪᴛᴄʜ ɪs, ᴛʀᴜᴛʜꜰᴜʟʟʏ.”
- Slinky stinks 11:16 PM: "Ah fuck”
- Slinky stinks 11:16 PM: "Our theories”
- otherLiam 11:17 PM: "Hm. Never mind, then. We’ll just have to wait for Moonman on that one.”
- Jos 11:17 PM: "Oh no”
- ARGdov 11:17 PM: "tl;dr ID went back and time and killed an internet spirit to stop people from summoning an ancient lovecraftian horror god”
- CircleHunter 11:17 PM: "we didn’t time travel then”
- CircleHunter 11:17 PM: "did we?”
- ARGdov 11:17 PM: "ok, we interacted with people in the past”
- otherLiam 11:17 PM: "I was asking because we aren’t sure if that same spirit was still around over there.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:17 PM: "ᴀɴᴅ ʏᴇᴛ ʏᴏᴜ ʜᴀᴠᴇ ᴀʟsᴏ ʀᴇʟᴇᴀsᴇᴅ ᴀ ꜰᴇᴡ, ɴᴏ? ɪ ᴄᴀɴ ᴛʜɪɴᴋ ᴏꜰ ᴀᴛ ʟᴇᴀsᴛ ᴏɴᴇ…”
- ARGdov 11:17 PM: "to stop an ancient lovecraftian horror god”
- CircleHunter 11:17 PM: "OH YEAH”
- ARGdov 11:18 PM: "we suspect that the AO timeline is the result of our other selves making a different decision”
- CircleHunter 11:18 PM: "how did the whole tiamat thing go?”
- ARGdov 11:18 PM: "and didnt officialy kill that internet spirit”
- ARGdov 11:18 PM: "tiamat thing?”
- Slinky stinks 11:18 PM: "Ergo, the evil spirit killed them”
- CircleHunter 11:18 PM: "yeah we kinda helped release the actual god tiamat from its prison”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:18 PM: "ɴᴏᴛ ᴡʜᴀᴛ ɪ ᴡᴀs ʀᴇꜰᴇʀʀɪɴɢ ᴛᴏ, sᴘᴇᴄɪꜰɪᴄᴀʟʟʏ. ʙᴜᴛ ᴛʜᴀᴛ ɪs ᴀʟsᴏ ᴛʀᴜᴇ.”
- CircleHunter 11:18 PM: "whoops”
- ARGdov 11:19 PM: "welp”
- Slinky stinks 11:19 PM: "Wait what? Tiamat?”
- ARGdov 11:19 PM: "how has THAT not bit us in the ass”
- otherLiam 11:19 PM: ”…man I gotta read up on this institute if y’all are accidentally summoning evil dragon gods.”
- CircleHunter 11:19 PM: “because apparently it happened in the other timeline”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:19 PM: "ᴀɴᴅ ᴛʀᴜᴛʜꜰᴜʟʟʏ sᴘᴇᴀᴋɪɴɢ ɪ ᴄᴀɴɴᴏᴛ ɪᴍᴀɢɪɴᴇ ᴛʜᴀᴛ ᴡɪʟʟ ᴇɴᴅ ᴡᴇʟʟ, ʙᴜᴛ ɪ ᴅᴏ ɴᴏᴛ ᴋᴇᴇᴘ ᴜᴘ ᴡɪᴛʜ ᴡʏɴᴅsᴛʀᴏᴍ ʜᴀᴘᴘᴇɴɪɴɢs ᴀɴʏ ʟᴏɴɢᴇʀ, ᴏᴛʜᴇʀ ᴛʜᴀɴ ᴛʜᴇ ʙᴀsɪᴄ ʀᴇǫᴜɪʀᴇᴍᴇɴᴛs ᴛᴏ ᴋᴇᴇᴘ ᴛʜᴇᴍ ᴏꜰꜰ ᴍʏ ᴛᴀɪʟ.”
- ARGdov 11:19 PM: "probably a good call”
- CircleHunter 11:20 PM: "welp, god help your timeline”
- ARGdov 11:20 PM: "oh ok it happened in another timeline, I guess”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:20 PM: "ɪ ʜᴀᴠᴇ ᴠᴇʀʏ ʟɪᴛᴛʟᴇ ᴄᴏɴᴄᴇʀɴ ꜰᴏʀ ᴛʜᴀᴛ ᴇɴᴅ ɢᴀᴍᴇ. ɪ ᴡɪʟʟ sɪᴍᴘʟʏ ᴍᴏᴠᴇ ɪɴᴛᴏ ʏᴏᴜʀ ᴛɪᴍᴇʟɪɴᴇ ᴀɴᴅ ᴄᴏɴᴛɪɴᴜᴇ ᴍʏ ʙᴜsɪɴᴇss.”
- CircleHunter 11:20 PM: "sorry that i in particular had a helping hand in something that could literally end life on earth”
- CircleHunter 11:20 PM: “oh ok”
- Slinky stinks 11:20 PM: "Tldr: we fucked up and basically we need to make nocta distracted so we can time travel”
- otherLiam 11:20 PM: "You can just do that? Move between timelines?”
- ARGdov 11:21 PM: "we may not be time travelling”
- ARGdov 11:21 PM: "lets wait to see whats happening”
- Slinky stinks 11:21 PM: "Well, that’s a dlc”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:21 PM: "ɴᴏᴛ ᴠᴇʀʏ ᴇᴀsɪʟʏ. ᴡʜʏ ᴅᴏ ʏᴏᴜ ᴛʜɪɴᴋ ɪ ᴘᴏᴄᴋᴇᴛᴇᴅ ᴛʜᴀᴛ ꜰᴀᴠᴏʀ sᴏ ʀᴇᴀᴅɪʟʏ?”
- otherLiam 11:21 PM: "Ah, I see. We’re your exit strategy.”
- ARGdov 11:21 PM: "I see…”
- Slinky stinks 11:22 PM: "Well, I don't”
- ARGdov 11:22 PM: "well, your a danger but your a danger in any dimension so I guess it doesnt really matter which”
- Slinky stinks 11:22 PM: "Basically he can enter this timeline because we are here?”
- ARGdov 11:22 PM: "dunno”
- Jos 11:22 PM: "It is true that when you have experience with timeline travel, you see everything like a script? Like a videogame story that will happen over and over again?”
- Slinky stinks 11:22 PM: "Like a network?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:22 PM: "ɪ ᴀᴍ ᴀ ᴅᴀɴɢᴇʀ, ᴛʜᴀᴛ ʏᴏᴜ ᴄᴀɴ ʙᴇ sᴜʀᴇ ᴏꜰ. ɪ ᴀᴍ ᴀ ᴠɪʀᴜs. ᴏɴᴄᴇ ɪ ʀᴇᴀʟɪᴢᴇ ɪᴛ’s ᴛɪᴍᴇ ᴛᴏ ɢᴏ, ɪ ᴡɪʟʟ ᴍᴏᴠᴇ ᴏɴ.”
- ARGdov 11:22 PM: "he’s not even in this timeline necesarily, he’s just communicating to us
- I can only imagine, yeah.”
- otherLiam 11:23 PM: "No Slink, he’d need us to use our power to swap over. Whcih is why he took my deal.”
- ARGdov 11:23 PM: "anyways”
- ARGdov 11:23 PM: "is there anything else you can tell us?”
- Slinky stinks 11:23 PM: "Alright, I see”
- ARGdov 11:23 PM: "Moonman said that we can trust IA”
- ARGdov 11:23 PM: "but he also said he was "different now” and didnt elaborate”
- ARGdov 11:23 PM: “any idea what that was about?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:23 PM: "ɪ ʜᴀᴠᴇ ʟɪᴠᴇᴅ ᴛᴏᴏ ʟᴏɴɢ ɪɴ ᴍʏ ᴄᴜʀʀᴇɴᴛ sᴛᴀᴛᴇ ᴛᴏ ᴄᴀʀᴇ ꜰᴏʀ ᴛʜᴇ ʟɪᴛᴛʟᴇ sᴏᴜʟs ꜰɪɢʜᴛɪɴɢ ᴛʜᴇɪʀ ʙᴀᴛᴛʟᴇs. ɪ ᴡᴀɴᴛ ᴛᴏ ʜᴀᴠᴇ ᴍʏ ꜰᴜɴ. ʙᴜᴛ ɪ ᴏᴡᴇ sᴏᴍᴇᴏɴᴇ ᴛʜɪs ᴍᴜᴄʜ, ᴀᴛ ʟᴇᴀsᴛ.”
- Slinky stinks 11:24 PM: "Probably IA is traumatized too”
- Slinky stinks 11:24 PM: "By the… Accident”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:24 PM: "ᴀs ꜰᴀʀ ᴀs ᴛʜᴀᴛ ɪɴᴅɪᴠɪᴅᴜᴀʟ ɢᴏᴇs, ɪ ʜᴀᴠᴇ ɴᴏᴛ ᴋɴᴏᴡɴ ʜɪᴍ ᴀs ʟᴏɴɢ ᴀs ᴍᴏᴏɴᴍᴀɴ, ʙᴜᴛ ɪ ʜᴀᴠᴇ ᴀ ɢᴏᴏᴅ ᴛʜᴇᴏʀʏ ᴏɴ ᴡʜʏ ᴛʜᴀᴛ ɪs.”
- ARGdov 11:24 PM: "oh?”
- ARGdov 11:24 PM: "please do share”
- Jos 11:24 PM: "Goodnight”
- Slinky stinks 11:25 PM: "Jos it’s 5Am”
- Slinky stinks 11:25 PM: "It’s good morning”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:25 PM: "ɪ ᴡɪʟʟ sɪᴍᴘʟʏ sᴀʏ ᴛʜᴀᴛ ʏᴏᴜ ᴍᴀʏ ʜᴀᴠᴇ ɴᴏᴛ ᴍᴀsᴛᴇʀᴇᴅ ᴛɪᴍᴇ ᴛʀᴀᴠᴇʟ ᴏᴜᴛsɪᴅᴇ ᴏꜰ ᴀ ᴛʜʀᴇᴇ ᴅᴀʏ ᴄʏᴄʟᴇ, ʙᴜᴛ sᴏᴍᴇ ʜᴀᴠᴇ ʙᴇᴇɴ ᴀʙʟᴇ ᴛᴏ ɢᴏ ʙᴇʏᴏɴᴅ ᴛʜᴀᴛ.”
- Slinky stinks 11:25 PM: ”…”
- ARGdov 11:25 PM: “….ah”
- Slinky stinks 11:26 PM: "So, IA travelled and he didn’t liked what he saw? Or what he would have seen?”
- ARGdov 11:26 PM: "who knows”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:26 PM: "ɪ'ᴍ ɴᴏᴛ sᴜʀᴇ ᴛʜᴀᴛ ʜᴇ ᴡᴏᴜʟᴅ ᴀᴘᴘʀᴇᴄɪᴀᴛᴇ ᴍᴇ ʀᴇᴠᴇᴀʟɪɴɢ ᴀʟʟ ʜɪs sᴇᴄʀᴇᴛs, ʜᴏᴡᴇᴠᴇʀ. sᴏ ᴛʜᴀᴛ ɪs ᴀʟʟ ɪ ᴡɪʟʟ sᴀʏ ᴏɴ ᴛʜᴀᴛ.”
- ARGdov 11:26 PM: "we’d have to ask him directly.”
- ARGdov 11:26 PM: "and he may not want to say”
- ARGdov 11:26 PM: "the important thing is finding out how we died, imo”
- ARGdov 11:26 PM: "but also stopping Nocta, or whoever from performing the ritual”
- Slinky stinks 11:27 PM: "Dov, if you guys killed yourselves”
- Slinky stinks 11:27 PM: "We couldn’t know it”
- Slinky stinks 11:27 PM: "Or we would create a paradox”
- ARGdov 11:27 PM: “Im sorry what”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:27 PM: "ᴀʟsᴏ, ɪ ʜᴀᴠᴇ ʙᴇᴇɴ ᴅᴏᴅɢɪɴɢ ᴀʀᴏᴜɴᴅ ᴛʜᴀᴛ ǫᴜᴇsᴛɪᴏɴ… "ᴘʟᴇᴀsᴇ ᴛᴇʟʟ ᴜs, ʜᴏᴡ ᴅɪᴇ ᴡᴇ ᴅɪᴇ?"”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:27 PM: "ʏᴏᴜ ꜰᴏᴏʟs ᴀʀᴇ sᴏ ᴅᴇsᴘᴇʀᴀᴛᴇ ᴛᴏ ʟᴇᴀʀɴ ᴏꜰ ʏᴏᴜʀ ꜰᴏʀʟᴏʀɴ ꜰᴀᴛᴇs ᴛʜᴀᴛ ʏᴏᴜ ᴄᴀɴ'ᴛ ᴇᴠᴇɴ ꜰɪɢᴜʀᴇ ɪᴛ ᴏᴜᴛ ʏᴏᴜʀsᴇʟꜰ?”
- ARGdov 11:27 PM: "I mean, we have theories”
- ARGdov 11:27 PM: "however”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ɪ ᴡɪʟʟ sʜᴀʀᴇ ᴀ sᴇᴄʀᴇᴛ: ʏᴏᴜ ᴡᴇʀᴇ ʙᴇᴛʀᴀʏᴇᴅ.”
- ARGdov 11:28 PM: "I mean”
- ARGdov 11:28 PM: "Nocta joined us”
- ARGdov 11:28 PM: "it probably has something to do with tht”
- ARGdov 11:28 PM: "I’ve kinda assumed thats what caused it because him joining was a bit difference in the AO timeline compared to ours”
- otherLiam 11:28 PM: "Moonman says we “disappeared”.”
- ARGdov 11:29 PM: "so hes assuming we died, which”
- ARGdov 11:29 PM: "is fair”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:29 PM: "ɴᴏᴄᴛᴀ ᴅɪᴅɴ'ᴛ ʙᴇᴛʀᴀʏ ʏᴏᴜ. ʜᴇ ᴡᴀs ɢᴏɴᴇ ꜰʀᴏᴍ ᴛʜᴇ ᴘɪᴄᴛᴜʀᴇ ᴡʜᴇɴ ɪᴛ ʜᴀᴘᴘᴇɴᴇᴅ.”
- Jos 11:29 PM: "Heh, i smell who the betrayer is”
- ARGdov 11:29 PM: "so someone else…betrayed us”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:29 PM: "ᴛʜᴇ sᴀᴍᴇ ᴡɪᴛʜ ᴍᴏᴏɴᴍᴀɴ. ɪ ᴅɪsᴛʀᴜsᴛ ʜɪᴍ ꜰᴏʀ ᴍʏ ᴏᴡɴ ʀᴇᴀsᴏɴs.”
- ARGdov 11:29 PM: "presumably its someone whos still alive”
- Slinky stinks 11:29 PM: "If we are the responsables, and we try to not kill ourselves, we would be breaking the time cycle, and because that’s impossible, we would ending up killing ourselves again”
- ARGdov 11:29 PM: "slinky”
- otherLiam 11:29 PM: "Well, that leaves three options.”
- ARGdov 11:29 PM: "no ones saying were gonna go back in time to stop oursleves from dying”
- Slinky stinks 11:30 PM: "We gotta wait”
- Slinky stinks 11:30 PM: "I know”
- ARGdov 11:30 PM: "we just think if we know how we died, it may be a clue”
- ARGdov 11:30 PM: "so then why are you saying shit that makes it sound like thats what were saying?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:30 PM: "ᴛᴇʟʟ ᴍᴇ ʏᴏᴜʀ 'ᴏᴘᴛɪᴏɴs’.”
- Slinky stinks 11:30 PM: "No, I mean I gotta say it to be okay with myself, I like to explain things”
- ARGdov 11:31 PM: ”…I have no clue what they mean by options”
- Slinky stinks 11:31 PM: “Liam said we have three options”
- ARGdov 11:31 PM: "my main concern is figuring out whats happening, I think we have a vague idea of what Nocta has in mind, to an extent, but theres other thing we dont know for sure”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:31 PM: "ɪ'ᴍ ʀᴇsᴘᴏɴᴅɪɴɢ ᴛᴏ ʟɪᴀᴍ. ʏᴏᴜ ᴀʟʟ ʟɪᴋᴇ ᴛᴏ ᴛᴀʟᴋ ᴏᴠᴇʀ ᴇᴀᴄʜ ᴏᴛʜᴇʀ… ᴀs ᴡᴇʟʟ ᴀs ᴍʏsᴇʟꜰ, sᴏ ɪᴛ’s ɴᴏᴛ sᴜʀᴘʀɪsɪɴɢ.”
- otherLiam 11:31 PM: "Actualy, if it wasn’t Nocta, that only leaves two, assuming they survived whatever they did to betray us.”
- otherLiam 11:31 PM: "IA, and whoever Yugi is.”
- ARGdov 11:31 PM: "oh you mean”
- ARGdov 11:31 PM: "who did it”
- ARGdov 11:31 PM: "well, yeah, assuming that the person who betrayed us didnt die too”
- ARGdov 11:31 PM: "which Id say is unlikely”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:32 PM: "sᴏ ʏᴏᴜ ᴛʜɪɴᴋ ɪᴛ ᴡᴀs 'ʏᴜɢɪ’ ᴏʀ… ᴡᴇʟʟ, ʜɪᴍ? ᴛʜᴀᴛ ᴡᴏᴜʟᴅ ʙᴇ ɪɴᴄᴏʀʀᴇᴄᴛ.”
- Slinky stinks 11:32 PM: "It’s a 50/50 between nocta and Yugi, I don’t think IA killed us”
- Slinky stinks 11:32 PM: "Oh shit”
- Slinky stinks 11:32 PM: "Nvm”
- ARGdov 11:32 PM: "ok, let’s ask a different question”
- ARGdov 11:32 PM: "is it important for us to know who betrayed us”
- Jos 11:33 PM: "Was the betrayer you? Heh”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:33 PM: "ᴍᴏᴏɴᴍᴀɴ ᴏɴʟʏ ᴛᴏʟᴅ ʏᴏᴜ ᴡʜᴏ ʜᴇ ᴛʜɪɴᴋs sᴜʀᴠɪᴠᴇᴅ. ɪ ɴᴇᴠᴇʀ sᴀɪᴅ ᴛʜᴀᴛ ʜᴇ ᴡᴀs ʀɪɢʜᴛ.
- ARGdov 11:33 PM: ”….”
- Slinky stinks 11:33 PM: “…”
- otherLiam 11:33 PM: "Interesting.”
- ARGdov 11:33 PM: "indeed.”
- ARGdov 11:33 PM: "ok, fuck that”
- Slinky stinks 11:33 PM: "Oh damm”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:33 PM: "ɪ ᴡᴏᴜʟᴅ sᴀʏ ɪᴛ ɪs. ᴏʀ ɪᴛ ᴡɪʟʟ ʙᴇ”.
August 6th, 2019
- At 3:37 AM, otherLiam noticed that Johnisdead.com now required a password to access.
- At 5:52 PM, otherLiam noticed that the message for the sign-in box for Johnisdead changed, now reading “Aggregation in progress”.
- At 10:41 PM, GHOSTBABEL entered the Discord server and began chatting with the players. The full conversation can be read here (https://internetdetectives.tumblr.com/post/186840097418/august-6th-2019-chat-with-ghostbabel). Below is a summary:
- Ghostbabel claims that there is a plan to enter the now locked Johnisdead.com though it will take some time.
- The many masks and items the players have submitted in recent days has caught the attention of our enemy and shortened our timespan.
- Our main goal is still to access the Subspace on Astralobservatory.net, and Ghostbabel is still preparing a plan for that as well.
- Ghostbabel says perhaps those who have gained Nocta’s trust could work their way into the Subspace.
- Nocta is almost always online, keeping his online status hidden.
- Ghostbabel was saved by one of the Astral Observatory timeline Internet Detectives.
- Ghostbabel is unaware of what the “Killswtich” is - the vote that the players took part in at the end of The Truth Arc.
- Ghostbabel is still being pursued by the “Wyndstrom” foundation (which was the main antagonist of a different ARG from which Ghostbabel originates), and he eventually plans on using the Internet Detective’s favor they owe him to help him escape into our timeline.
- IsocelesAssassin has more secrets that have yet to be revealed.
- Ghostbabel says that some have mastered the art of time travel far better than we have.
- The players were killed because they were betrayed. Nocta was not the one who betrayed them, as he had already left the Internet Detectives when it happened. Ghostbabel also confirms that it was not Yugi who betrayed the players.
- Ghostbabel does not fully trust Moonman.
- Ghostbabel implies that Moonman may be incorrect on who he claims is alive and who isn’t.
#timeline
#johnisdead timeline
August 8th, 2019 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:16 PM: “ᴡᴇʟʟ ᴡᴇʟʟ, ᴛʜᴇ ᴛɪᴅᴇs ᴀʀᴇ ᴛᴜʀɴɪɴɢ ᴀɢᴀɪɴsᴛ ʏᴏᴜʀ ʟᴏᴛ ɪᴛ sᴇᴇᴍs. ᴛʜᴇɴ ᴀɢᴀɪɴ, ᴡʜᴀᴛ ᴇʟsᴇ ɪs ɴᴇᴡ?”
- Slinky stinks 9:17 PM: “We got nothing yet”
- ARGdov 9:18 PM: "one person got banned”
- ARGdov 9:18 PM: "he’s still in here with us”
- ARGdov 9:18 PM: "and we have the ocarina”
- ARGdov 9:18 PM: "unless this has other consequences we havent thought of yet this is only a minor setback”
- Jos 9:19 PM: "Just nocta being paranoid for a long time has lead to moonman being banned”
- Slinky stinks 9:19 PM: "Well, nocta can look further onto moonman and can reach to this server”
- Jos 9:19 PM: "counter ban then”
- Slinky stinks 9:19 PM: "But I don’t think that can happen”
- ARGdov 9:19 PM: "we dont know he can do that
- Jos 9:20 PM: "I could unlock the thread and say well you got deceived!, imagine his paranoia raising up”
- Jos 9:20 PM: "not gonna do”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:20 PM: "ᴅᴏ ʏᴏᴜ ᴛʜɪɴᴋ ᴛʜᴇ ʙᴀɴ ɪs ʟɪᴛᴇʀᴀʟ, ᴏʀ sᴏᴍᴇᴛʜɪɴɢ ᴍᴏʀᴇ? ᴛʜɪɴᴋ ᴀʙᴏᴜᴛ ɪᴛ. ᴍᴏᴏɴᴍᴀɴ ᴄᴀɴ ɴᴏ ʟᴏɴɢᴇʀ ᴘᴏsᴛ ᴏɴ ᴛʜᴇ ꜰᴏʀᴜᴍs, ᴍᴇᴀɴɪɴɢ ʜɪs ᴘʀᴇsᴇɴᴄᴇ ᴡɪʟʟ ɴᴏ ʟᴏɴɢᴇʀ ʙᴇ ᴛʜᴇʀᴇ. ᴘʟᴜs, ᴡᴏᴜʟᴅɴ'ᴛ ʏᴏᴜ ꜰɪɢᴜʀᴇ ᴛʜᴀᴛ ɴᴏᴄᴛᴀ ʜᴀᴅ ꜰɪɢᴜʀᴇᴅ ᴛʜɪs ᴏᴜᴛ sᴏᴍᴇ ᴛɪᴍᴇ ᴀɢᴏ?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:20 PM: "sᴏᴜɴᴅs ʟɪᴋᴇ ᴀ ɢᴏᴏᴅ ᴡᴀʏ ᴛᴏ ᴍᴀᴋᴇ sᴏᴍᴇᴏɴᴇ ‘ᴅɪsᴀᴘᴘᴇᴀʀ’ ᴡɪᴛʜᴏᴜᴛ ʀᴀɪsɪɴɢ ᴛᴏᴏ ᴍᴀɴʏ ᴀʟᴀʀᴍs, ᴛᴏ ᴍᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:20 PM: "ɴᴏᴛ ᴛʜᴀᴛ ɪ ʀᴇᴀʟʟʏ ᴄᴀʀᴇ.”
- Slinky stinks 9:20 PM: "Well, we made this server so we could talk too moonman without nocta being to suspicious”
- Slinky stinks 9:20 PM: "So maybe if he found out”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:21 PM: "ᴄᴏɴɢʀᴀᴛᴜʟᴀᴛɪᴏɴs, ʏᴏᴜ ᴍɪssᴇᴅ ᴍʏ ᴘᴏɪɴᴛ ᴇɴᴛɪʀᴇʟʏ.”
- ARGdov 9:21 PM: "shiiiiit”
- ARGdov 9:21 PM: "so he may be dead”
- Slinky stinks 9:21 PM: "Yeah nvm”
- ARGdov 9:21 PM: "fuck fuck fuck fuck fuck”
- otherLiam 9:21 PM: "Guys, I think he’s saying him getting banned off the server is bigger than just getting banned.”
- ARGdov 9:21 PM: "this is bad”
- ARGdov 9:21 PM: "like really bad”
- Slinky stinks 9:22 PM: "We can’t let moonman die tho”
- ADULT_LINK 9:22 PM: "oh jeez”
- Jos 9:22 PM: "You can’t let not die someone who might died.”
- ADULT_LINK 9:22 PM: "he might already be dead”
- Slinky stinks 9:22 PM: "Daaaamn”
- Slinky stinks 9:22 PM: "Liam did you got any reply?”
- otherLiam 9:23 PM: "Not yet, no.”
- Jos 9:23 PM: "Tbh”
- Jos 9:23 PM: "Moonman is not banned”
- Jos 9:23 PM: "his user can be banned, which means he is not?”
- Jos 9:23 PM: "So nocta is just using that as a excuse”
- Slinky stinks 9:24 PM: "Also Babel said we missed his point tho”
- Jos 9:24 PM: "nevermind”
- Jos 9:24 PM: "but he might be dead tho”
- Slinky stinks 9:25 PM: "Damn”
- otherLiam 9:25 PM: "He said you did, slink.”
- Slinky stinks 9:25 PM: "Oh”
- otherLiam 9:25 PM: "While losing Moonman is a blow, it also shows Nocta’s scared as hell.”
- ADULT_LINK 9:25 PM: "oh hey this might sound completely unrelated, but. would IA recognise my handle on the observatory? it dawned on me that if their version of me played dnd with them i might have used the same/similar handle in there”
- Jos 9:26 PM: "This could be a good point to overthrow nocta”
- Slinky stinks 9:26 PM: "I can’t talk to characters without misunderstanding them ¯\_(ツ)_/¯”
- Jos 9:26 PM: "he first said the bot were us”
- Jos 9:26 PM: "now he says it was moonman”
- Jos 9:26 PM: "how many lies the members will feed?”
- ADULT_LINK 9:26 PM: "and it would probably freak him out to have one of his dead freinds around, which could make it hard to successfully get into things there”
- Jos 9:26 PM: ”(except moonman who really did the bots lol)”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:27 PM: “ǫᴜᴇsᴛɪᴏɴ ꜰᴏʀ ʏᴏᴜ ᴀʟʟ: ʜᴏᴡ ᴅᴇsᴘᴇʀᴀᴛᴇ ᴛᴏ ʀᴇᴛʀɪᴇᴠᴇ ᴛʜɪs ᴍᴏᴏɴᴍᴀɴ ᴀʀᴇ ʏᴏᴜ?”
- ADULT_LINK 9:28 PM: "i dont really know tbh”
- ADULT_LINK 9:28 PM: "wait, "this” moonman”
- Slinky stinks 9:28 PM: “Enough to do stuff but not to get in danger”
- ADULT_LINK 9:28 PM: "oh wait isnt moonman greth”
- ADULT_LINK 9:28 PM: "i am very behind on some things”
- Slinky stinks 9:28 PM: "He is”
- otherLiam 9:28 PM: "He’s a useful source of information, and besides that, he’s a friend. So if he’s retrievable we’d like to retrieve him.”
- otherLiam 9:28 PM: "Yes, Moonman is the alternate reality Greth.”
- Slinky stinks 9:29 PM: "But he hasn’t been patremized yet”
- ADULT_LINK 9:29 PM: "in that case yes, greth is a freind. even if he’s a bit different from ours, he’s still the same person”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:29 PM: "ʜᴏᴡ ᴄᴀɴ ʏᴏᴜ ʙᴇ sᴏ sᴜʀᴇ?”
- ADULT_LINK 9:30 PM: "optimistic guess”
- Slinky stinks 9:30 PM: "Guys I still have a 1% thoughts that he is the one who betrayed us”
- Jos 9:30 PM: "I guess no one should die regardless their faction affiliation”
- Slinky stinks 9:30 PM: "In any way”
- Slinky stinks 9:30 PM: "Greth is a. Friemd”
- ADULT_LINK 9:30 PM: "even if he is the one who betrayed us, death is pretty harsh”
- Slinky stinks 9:31 PM: ”^”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:31 PM: “ᴍᴏᴏɴᴍᴀɴ ᴍᴀʏ ʙᴇ ᴀ ‘ꜰʀɪᴇᴍᴅ’ ʙᴜᴛ ʜᴇ ɪs ɴᴏᴛ ᴡɪᴛʜᴏᴜᴛ ʜɪs sᴇᴄʀᴇᴛs.”
- ADULT_LINK 9:31 PM: "so? you undoubtebly have been keeping secrets from us as well
- doesent mean we’d be ok with just letting you die”
- otherLiam 9:32 PM: "We’re all keeping secrets.”
- Jos 9:33 PM: "I think is not about if he should die, but is that whoever is the betrayer doesnt care about ethics, and killed a lot of people for whatever reason”
- otherLiam 9:33 PM: "Doesn’t mean our lives aren’t worth saving.”
- ARGdov 9:33 PM: "maybe”
- otherLiam 9:33 PM: "Although I suppose there’s an important question to ask here.”
- ARGdov 9:33 PM: "wait”
- ARGdov 9:33 PM: "you said "is"”
- otherLiam 9:33 PM: "What’s the price of saving him?”
- ARGdov 9:33 PM: "he may not be dead yet”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:33 PM: "ɪɴᴛᴇʀᴇsᴛɪɴɢ. ᴛʜᴇɴ ɪ ʜᴀᴠᴇ ʏᴇᴛ ᴀɴᴏᴛʜᴇʀ ᴘʀᴏᴘᴏsɪᴛɪᴏɴ. ɪ ᴀᴍ ᴠᴇʀʏ ᴄʟᴏsᴇ ᴛᴏ ᴛʜᴇ ᴇɴᴅɢᴀᴍᴇ ᴘʟᴀɴ- ᴛʜᴇ ᴏɴᴇ ᴡᴇ ᴅɪsᴄᴜssᴇᴅ. ʜᴏᴡᴇᴠᴇʀ, ɪꜰ ɪ ᴡᴇʀᴇ ᴛᴏ ʜᴇʟᴘ ʏᴏᴜ ꜰɪɴᴅ ᴍᴏᴏɴᴍᴀɴ, ɪᴛ ᴡᴏᴜʟᴅ ᴅᴇʟᴀʏ ᴛʜᴀᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:33 PM: "ɪ ᴡᴏᴜʟᴅ ᴀʟsᴏ ʀᴇǫᴜᴇsᴛ ᴀɴᴏᴛʜᴇʀ ꜰᴀᴠᴏʀ, sɪɴᴄᴇ ᴛʜɪs ɪs ᴡᴇʟʟ ᴏᴜᴛsɪᴅᴇ ᴛʜᴇ ᴘᴜʀᴠɪᴇᴡ ᴏꜰ ᴡʜᴀᴛ ɪ ᴀɢʀᴇᴇᴅ ᴛᴏ ᴅᴏ.”
- ARGdov 9:33 PM: "also @ADULT_LINK Moonman is greth from the AO timeline
- ARGdov 9:33 PM: "shit”
- ARGdov 9:33 PM: "ok thats tricky”
- ARGdov 9:33 PM: "what are the risks of delaying the endgame plan?”
- Jos 9:34 PM: "What do you need”
- ARGdov 9:34 PM: "and also yeah, what would the favor be”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:34 PM: "ɪ ᴡᴀɴᴛ ᴛʜᴇ ʜᴀᴛ.”
- ARGdov 9:34 PM: "the hat?”
- ARGdov 9:34 PM: "helpers hat?”
- Jos 9:34 PM: "Helpers”
- otherLiam 9:34 PM: "Helper’s hat? We don’t have it.”
- ARGdov 9:34 PM: "we dont, its true”
- ARGdov 9:34 PM: "to my knowledge anyways”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:34 PM: "ɴᴏᴛ ʏᴇᴛ.”
- Jos 9:34 PM: "So find it to save moonman”
- Jos 9:34 PM: "fair enought”
- ARGdov 9:35 PM: "you didnt answer though”
- Slinky stinks 9:35 PM: "Another side quest of finding the hat huh?”
- Slinky stinks 9:35 PM: "Nice”
- ARGdov 9:35 PM: "two questions now”
- ADULT_LINK 9:35 PM: "is this a thing of "as soon as we get it we give it to you” or a “i’d like it at some point once you have it”
- ARGdov 9:35 PM: “A: Why do you want it”
- ARGdov 9:35 PM: "B: What are the risks of delaying the endgame?”
- ARGdov 9:35 PM: "gah, fuck it”
- ARGdov 9:35 PM: "I suppose I agree either way.”
- ARGdov 9:35 PM: "though I’d like to know why you want it”
- otherLiam 9:35 PM: "Hang on, let’s discuss this.”
- ARGdov 9:35 PM: "assuming this wont lead to the multiverse exploding anyways”
- Slinky stinks 9:35 PM: "Okay, who has the hat then, circle said he didn’t had it”
- ADULT_LINK 9:36 PM: "i think we should talk about it as well”
- Jos 9:36 PM: "I do understand there might be questions but we do want to step on sure ground or at least the safest ground we can”
- ARGdov 9:36 PM: "we’ll have to retrieve it”
- ARGdov 9:36 PM: "ok, well”
- ARGdov 9:36 PM: "if we’re gonna dicuss it”
- ADULT_LINK 9:36 PM: "i’m not opposed to the idea, but i’d like to hear more before i go in blindly “
- ARGdov 9:36 PM: "we need to know what the risks are”
- otherLiam 9:36 PM: "Is Moonman really worth delaying stopping Nocta AND losing Helper’s Hat forever?”
- ARGdov 9:36 PM: "and why ghostbabel here wants the hat”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:36 PM: "sʟᴏᴡ ʏᴏᴜʀ 'ʀᴏʟʟ’, ɪ ᴀᴍ ʜᴀᴘᴘʏ ᴛᴏ ᴅɪsᴄᴜss ᴛʜɪs ᴀ ʙɪᴛ ꜰᴜʀᴛʜᴇʀ.”
- ARGdov 9:36 PM: "alright,”
- ARGdov 9:36 PM: "well, an answer to both of my questons would be a good start”
- otherLiam 9:37 PM: "Agreed.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:37 PM: "ᴛʜᴇ ʜᴀᴛ ɪs ɴᴏᴇᴠᴇʀ ᴏᴜᴛ ᴏꜰ ʀᴇᴀᴄʜ, ᴛʜᴏᴜɢʜ ʙᴇɪɴɢ ᴛʜᴀᴛ ᴡᴇ ᴡᴏᴜʟᴅ ʙᴏᴛʜ ʙᴇɴᴇꜰɪᴛ ꜰʀᴏᴍ ɪᴛs’ ʀᴇᴛʀɪᴇᴠᴀʟ ɪɴ ᴛʜɪs ɪɴsᴛᴀɴᴄᴇ, ɪ ᴛʜɪɴᴋ ᴛʜᴀᴛ ᴘᴇʀʜᴀᴘs ᴛʜᴀᴛ ᴡᴏᴜʟᴅ ʙᴇ ᴏᴜʀ ꜰɪʀsᴛ sᴛᴇᴘ. “
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:37 PM: "ɪᴛ’s sɪᴍᴘʟᴇ ʀᴇᴀʟʟʏ, ɪ ᴛʀᴀᴄᴋ ᴅᴏᴡɴ ᴛʜᴇ ʜᴀᴛ, ʏᴏᴜ ɢᴇᴛ ᴛʜᴇ ʜᴀᴛ, ɢɪᴠᴇ ɪᴛ ᴛᴏ ᴍᴇ, ɪ ʜᴇʟᴘ ᴍᴏᴏɴᴍᴀɴ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:37 PM: "ᴛʜᴇ ʀɪsᴋ ɪs ᴏʙᴠɪᴏᴜs, ᴛʜᴇ ᴇɴᴇᴍʏ ᴄᴏɴᴛɪɴᴜᴇs ᴛᴏ ᴍᴏᴠᴇ.”
- ARGdov 9:38 PM: "right”
- Slinky stinks 9:38 PM: "And he moves faster”
- Slinky stinks 9:38 PM: "Remember”
- ARGdov 9:38 PM: "but it wont be impossible to stop them, right?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:38 PM: "ɴᴏᴛʜɪɴɢ ɪs ɪᴍᴘᴏssɪʙʟᴇ.”
- ARGdov 9:39 PM: ”…not really the answer I was looking for but ok”
- ARGdov 9:39 PM: “Im willing to agree to this”
- ARGdov 9:39 PM: "especially since it sounds like having the hat may be of use”
- ADULT_LINK 9:39 PM: "so this is a thing of, as soon as we get the hat we give it to you”
- ARGdov 9:39 PM: "it sounds like he’ll retrieve it for us”
- ARGdov 9:39 PM: "and then give it to us”
- otherLiam 9:39 PM: "Actually, this might be less bad than I thought. GB, given that you’re in an alternate timeline, isn’t there a Helper’s Hat in your timeline as well?”
- ARGdov 9:39 PM: "and then we give it back to him”
- Slinky stinks 9:39 PM: "Oh…”
- ADULT_LINK 9:40 PM: "ooh there could be 2 hats maybe”
- Slinky stinks 9:40 PM: "But wasn’t the other timeline helper GB? I think I’m lost”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:40 PM: "ɪ ᴄᴀɴɴᴏᴛ sɪᴍᴘʟʏ ʀᴇᴛʀɪᴇᴠᴇ ᴡʜᴀᴛ ɪs ɴᴏᴛ ᴏɴ ᴍʏ ᴘʟᴀɴᴇ ᴏꜰ ᴇxɪsᴛᴇɴᴄᴇ; ɪɴ ᴍʏ ᴡᴏʀʟᴅ, sᴏᴍᴇᴏɴᴇ ᴀʟʀᴇᴀᴅʏ ʜᴀs ᴛʜᴇ ʜᴀᴛ.”
- ADULT_LINK 9:40 PM: "then we could get GB a hat, but still have one avaliable to us (possibly) in the future, right?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:40 PM: "ɪꜰ ɪᴛ ᴡᴇʀᴇ ᴛʜᴀᴛ sɪᴍᴘʟᴇ ɪ ᴡᴏᴜʟᴅ ʜᴀᴠᴇ TAKEN ɪᴛ.”
- ARGdov 9:41 PM: "wait”
- ADULT_LINK 9:41 PM: "do you know who has the hat in your world?”
- ARGdov 9:41 PM: "so GB cant take it from his”
- ARGdov 9:41 PM: "so no”
- ARGdov 9:41 PM: "we’d be giving it to him”
- ARGdov 9:41 PM: "permanently”
- ADULT_LINK 9:41 PM: "yeah, but this wouldnt neccicarrily be the last time we’re able to get a hat”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:41 PM: ”@ADULT_LINK ᴛʜᴇ ᴀɴsᴡᴇʀ ᴛᴏ ᴛʜᴀᴛ ɪs sᴏ ᴏʙᴠɪᴏᴜs ɪ'ᴍ ᴀʙsᴏʟᴜᴛᴇʟʏ ɢɪᴅᴅʏ ᴛʜᴀᴛ ʏᴏᴜ ᴄᴀɴ'ᴛ sᴇᴇ ᴡʜᴀᴛ’s ʀɪɢʜᴛ ɪɴ ꜰʀᴏɴᴛ ᴏꜰ ʏᴏᴜ.”
- Slinky stinks 9:41 PM: “Ok, but who exactly has it”
- ARGdov 9:41 PM: "but also I want to point out that were discussing wether a random trinket we havent used in YEARS is worth more than this persons life”
- ARGdov 9:41 PM: "thats another good question, whos got it”
- ARGdov 9:41 PM: ”(IA, is my guess)”
- ADULT_LINK 9:42 PM: “i have poor eyesight, not being able to see things infront of me is not uncommon”
- ADULT_LINK 9:42 PM: "yeah, ia likely has it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:42 PM: ”@ARGdov ᴄᴏɴɢʀᴀᴛᴜʟᴀᴛɪᴏɴs, ʏᴏᴜ ʜᴀᴠᴇ ᴀʟʟ sᴛᴜᴍʙʟᴇᴅ ᴏɴ ᴛʜᴀᴛ ᴍʏsᴛᴇʀʏ ꜰᴏʀ ꜰᴀʀ ᴛᴏᴏ ʟᴏɴɢ.”
- Slinky stinks 9:42 PM: “Wait”
- ADULT_LINK 9:42 PM: "ooh, going back to my earlier question”
- ARGdov 9:42 PM: "mazel tov, random guesing is useful”
- Slinky stinks 9:42 PM: "So IA has it?”
- ARGdov 9:42 PM: "especially since it can only be like”
- ARGdov 9:42 PM: "5 people”
- ARGdov 9:42 PM: "since we dont know that many peopel from your timelien”
- ADULT_LINK 9:42 PM: "do you think IA would recognise my name on AO as being his dead freind?”
- ARGdov 9:43 PM: "it seems that he does”
- ADULT_LINK 9:43 PM: "if not maybe we could try to befreind him and get the hat”
- ARGdov 9:43 PM: "look, Im gonna be blunt here”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:43 PM: "ʜᴇ ɪs ᴡᴇʟʟ ᴀᴡᴀʀᴇ ᴏꜰ ᴍᴏsᴛ ᴏꜰ ʏᴏᴜ ᴀs ɪᴛ ɪs.”
- ARGdov 9:43 PM: "giving GB the hat probably wont be much of a loss to us”
- Slinky stinks 9:43 PM: "Hmmm”
- ADULT_LINK 9:43 PM: "thats fair”
- ARGdov 9:43 PM: "someone as dangerous as him having it makes me wary but”
- Slinky stinks 9:43 PM: "Yeah the we can give away the hat”
- ARGdov 9:43 PM: "its that vs someone we know dying”
- ADULT_LINK 9:43 PM: "man i wish i’d been able to stay hidden in who i was a bit longer :/”
- ARGdov 9:43 PM: “and dying because we may have put him in danger by talking to him”
- ARGdov 9:43 PM: “I say we go for it.”
- ADULT_LINK 9:45 PM: "i’m game i suppose”
- ARGdov 9:45 PM: "so that makes three of us”
- ADULT_LINK 9:45 PM: "i hope we’ll be able to get a different version of the hat in the future but”
- ARGdov 9:45 PM: ”@otherLiam @Wolfcat what do you think?”
- Wolfcat 9:46 PM: “go for it”
- otherLiam 9:47 PM: "I’m concerned about the baddies having more time to prepare and act. It’s likely we’ll lose someone else in trying to save Moonman. That being said, I think it’s worth.”
- ADULT_LINK 9:47 PM: "should we discuss this in ID a bit, get people who arent in here’s votes?”
- ARGdov 9:47 PM: "sounds good yeah”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:48 PM: "ᴀ ʙɪɴᴅɪɴɢ ᴀɢʀᴇᴇᴍᴇɴᴛ ᴛʜᴇɴ.”
- ARGdov 9:49 PM: "we’re still discussing it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:50 PM: "ɪ sᴇᴇ. ᴛᴀᴋᴇ ʏᴏᴜʀ ᴛɪᴍᴇ, ɪ sᴜᴘᴘᴏsᴇ…”
- otherLiam 9:51 PM: "How pressing is Moonman’s situation?”
- otherLiam 9:51 PM: "If we waited until after you enact your endgame, would we still be able to help him?”
- ARGdov 9:51 PM: "doubtfully”
- Jos 9:52 PM: "I might look as a bad person but i wont save moonman”
- Slinky stinks 9:52 PM: "I think moonmans situation atm is pretty bad”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:53 PM: "ʟɪᴀᴍ, ɪᴛ ɪs ᴜɴʟɪᴋᴇʟʏ.”
- otherLiam 9:54 PM: "I figured, but thought it worth asking.”
- Jos 9:54 PM: “If he is not the traitor, he wanted nocta cult to end, going agaisnt his objective delaying and bringing him to life again, will mean the work he has done would go to waste”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:54 PM: "ᴛʀᴜᴛʜꜰᴜʟʟʏ ᴏɴᴄᴇ ʏᴏᴜ ᴇɴᴛᴇʀ ᴛʜᴇ ᴍᴀɪɴ sɪᴛᴇ, ʀᴇꜰᴇʀʀᴇᴅ ᴛᴏ ᴀs ᴛʜᴇ 'sᴜʙsᴘᴀᴄᴇ’, ᴛʜɪɴɢs ᴡɪʟʟ ᴄʜᴀɴɢᴇ ᴅʀᴀᴍᴀᴛɪᴄᴀʟʟʏ.”
- Slinky stinks 9:54 PM: "And to enter the subspace”
- Slinky stinks 9:54 PM: "You need to do your endgame plan”
- Slinky stinks 9:54 PM: "Right?”
- otherLiam 9:55 PM: "And we’d be delaying that by helping Moonman.”
- otherLiam 9:55 PM: "That’s our situation, yes.”
- Slinky stinks 9:55 PM: "Hmm”
- otherLiam 9:55 PM: "That’s why I’m still somewhat on the fence.”
- ADULT_LINK 9:55 PM: "hey, speaking of masks”
- otherLiam 9:55 PM: "But it seems like the majority want to save him.”
- Slinky stinks 9:55 PM: "Well, if we let moon die, he Might get Patremized”
- ADULT_LINK 9:55 PM: "which ones do we have avaliable to us?”
- otherLiam 9:56 PM: "I mean… all of them, save the Postman’s Hat, I’d assume.”
- Slinky stinks 9:56 PM: "But if we don’t, nocta can do its thing faster”
- otherLiam 9:56 PM: "Why do you ask?“
- ADULT_LINK 9:56 PM: "just trying to think ahead”
- Jos 9:56 PM: "i think nocta wouldn’t go faster if we do things without he noticing”
- ADULT_LINK 9:56 PM: "figure if theres any masks we don’t have, might be a good idea to try to get them”
- Jos 9:57 PM: "but at the same time, faster means more mistakes”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:57 PM: "ɴᴏᴄᴛᴀ ʜᴀs ʏᴇᴛ ᴛᴏ ɴᴏᴛɪᴄᴇ ᴛʜᴇ sᴜʙᴛʟᴇ ᴄʜᴀɴɢᴇs ɪ ʜᴀᴠᴇ ᴍᴀᴅᴇ ᴛᴏ ʜɪs sᴄʀɪᴘᴛs ᴀɴᴅ ʙᴀʀʀɪᴇʀs ᴘʀᴏᴛᴇᴄᴛɪɴɢ ᴛʜᴇ sᴜʙsᴘᴀᴄᴇ. ɪɴ ꜰᴀᴄᴛ, ᴛʜᴇ ʙᴇɢɪɴɴɪɴɢ ᴏꜰ ᴛʜɪs ᴊᴏᴜʀɴᴇʏ ᴡᴏᴜʟᴅ ʙᴇ ᴜɴᴇᴀʀᴛʜɪɴɢ ᴀ sᴍᴀʟʟ ᴘᴏʀᴛɪᴏɴ ᴏꜰ ᴛʜᴀᴛ sᴘᴀᴄᴇ ꜰᴏʀ ᴏᴜʀ ɴᴇᴇᴅs. ᴛʜᴀᴛ ᴡᴏᴜʟᴅ ᴏꜰ ᴄᴏᴜʀsᴇ ɢɪᴠᴇ ʜɪᴍ ᴄᴀᴜsᴇ ᴛᴏ sᴛᴀʀᴛ ᴘᴀɴɪᴄᴋɪɴɢ ᴇᴠᴇɴ ꜰᴜʀᴛʜᴇʀ.”
- Slinky stinks 9:58 PM: "Nocta is pretty paranoid and stressed at he seems”
- Slinky stinks 9:58 PM: "So a little bit more of that would make him more dangerous”
- ɢʜᴏsᴛʙᴀʙᴇʟ 9:59 PM: "ɪᴛ ɪs ɴᴏᴛ ᴜɴʟɪᴋᴇʟʏ ᴛʜᴇ ᴘᴀᴄᴇ ᴏꜰ ᴘᴏᴡᴇʀ ᴜsᴀɢᴇ ɪs ᴡʜᴀᴛ ᴄᴀᴜsᴇᴅ ʜɪᴍ ᴛᴏ 'ʙᴀɴ’ ᴍᴏᴏɴᴍᴀɴ ɪɴ ᴛʜᴇ ꜰɪʀsᴛ ᴘʟᴀᴄᴇ. ʙᴜᴛ ʏᴏᴜ ᴀʀᴇ ᴀʟʀᴇᴀᴅʏ ᴅᴏᴡɴ ᴛᴡᴏ ᴀʟʟɪᴇs— ᴍᴏᴏɴᴍᴀɴ ᴀɴᴅ 'ʏᴜᴜᴋɪ'”
- Jos 9:59 PM: "step by step, then hope panic can make him do errors, for much he wants to control his site like a perfect machine, he is still human and humans hates nerves”
- Slinky stinks 10:00 PM: "What’s up with Yugi tho”
- Slinky stinks 10:00 PM: "I just remembered”
- ADULT_LINK 10:00 PM: "yknow i think it’d be really helpful if we could see our inventory lmao”
- Slinky stinks 10:01 PM: "I think we have everything but the helpers hat tbh”
- ADULT_LINK 10:01 PM: "keyword is think there”
- Slinky stinks 10:02 PM: "Yeah…”
- Slinky stinks 10:02 PM: "We should ask someone”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:03 PM: "ɪᴛ sᴇᴇᴍs ᴍʏ ᴛɪᴍᴇ ʜᴀs ʙᴇᴇɴ ᴄᴜᴛ sʜᴏʀᴛ, ɪ ᴍᴜsᴛ ᴀᴅɪᴇᴜ. ɪ ᴡɪʟʟ ʀᴇᴛᴜʀɴ ᴡʜᴇɴ ʏᴏᴜ ʜᴀᴠᴇ ᴀɴ ᴀɴsᴡᴇʀ ꜰᴏʀ ᴍᴇ. ɪ sɪɴᴄᴇʀᴇʟʏ ʜᴏᴘᴇ ʏᴏᴜ ᴡɪʟʟ ᴍᴀᴋᴇ ᴛʜᴇ ʙᴇsᴛ ᴄʜᴏɪᴄᴇ.”
- otherLiam 10:04 PM: "Take care.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:04 PM: "ɪ ᴀʟᴡᴀʏs ᴅᴏ.”
- Jos 10:04 PM: “Do it twice”
- Jos 10:04 PM: "or trice”
- otherLiam 10:08 PM: "There’s no need to wait for his return to decide. He could come back to us already having the hat, if we want.”
- Mr t series good 10:08 PM: "Ok”
- Slinky stinks 10:09 PM: "So we need to help him to retrieve the hat”
- ADULT_LINK 10:09 PM: “"ᴛʜᴇ ʜᴀᴛ ɪs ɴᴏᴇᴠᴇʀ ᴏᴜᴛ ᴏꜰ ʀᴇᴀᴄʜ, ᴛʜᴏᴜɢʜ ʙᴇɪɴɢ ᴛʜᴀᴛ ᴡᴇ ᴡᴏᴜʟᴅ ʙᴏᴛʜ ʙᴇɴᴇꜰɪᴛ ꜰʀᴏᴍ ɪᴛs’ ʀᴇᴛʀɪᴇᴠᴀʟ ɪɴ ᴛʜɪs ɪɴsᴛᴀɴᴄᴇ, ɪ ᴛʜɪɴᴋ ᴛʜᴀᴛ ᴘᴇʀʜᴀᴘs ᴛʜᴀᴛ ᴡᴏᴜʟᴅ ʙᴇ ᴏᴜʀ ꜰɪʀsᴛ sᴛᴇᴘ.””
- ADULT_LINK 10:09 PM: "”ɪᴛ’s sɪᴍᴘʟᴇ ʀᴇᴀʟʟʏ, ɪ ᴛʀᴀᴄᴋ ᴅᴏᴡɴ ᴛʜᴇ ʜᴀᴛ, ʏᴏᴜ ɢᴇᴛ ᴛʜᴇ ʜᴀᴛ, ɢɪᴠᴇ ɪᴛ ᴛᴏ ᴍᴇ, ɪ ʜᴇʟᴘ ᴍᴏᴏɴᴍᴀɴ. ᴛʜᴇ ʀɪsᴋ ɪs ᴏʙᴠɪᴏᴜs, ᴛʜᴇ ᴇɴᴇᴍʏ ᴄᴏɴᴛɪɴᴜᴇs ᴛᴏ ᴍᴏᴠᴇ."”
- Slinky stinks 10:09 PM: "Or to retrieve the hat for him”
- ADULT_LINK 10:09 PM: "he said that IA had a hat”
- ADULT_LINK 10:09 PM: "but i dont think that was the hat he wanted us to get”
- ARGdov 10:09 PM: "its not”
- ARGdov 10:09 PM: "I gtg but”
- ARGdov 10:09 PM: "I think we should go for it”
- ADULT_LINK 10:10 PM: "so we still need him to tell who has the hat/where it is”
- ARGdov 10:10 PM: "also uh”
- ARGdov 10:10 PM: "moonman may end up reading all this”
- ARGdov 10:10 PM: "if we save him”
- ARGdov 10:10 PM: "which I hope we do”
- ADULT_LINK 10:10 PM: "also: vote to call our timeline Beta and theirs Alpha, so we can easily distinguish whats from what”
- Slinky stinks 10:10 PM: "Ah yes”
- Slinky stinks 10:10 PM: "I saw what you did there”
- ADULT_LINK 10:11 PM: "or we could go futurama route and go 1 and A”
- Slinky stinks 10:11 PM: "I like the beta and alpha better”
- Slinky stinks 10:11 PM: "So, fast recap in JID”
- otherLiam 10:13 PM: "Vote Now! [yeah boiii] [naw dawg]”
- otherLiam 10:13 PM: "Democracy.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:56 PM: "ʜᴀᴠᴇ ʏᴏᴜ ᴄᴏᴍᴇ ᴜᴘ ᴡɪᴛʜ ᴀɴ ᴀɴsᴡᴇʀ?”
- ADULT_LINK 11:56 PM: "yea, looks like more people support it than don't”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:57 PM: "ɢᴏᴏᴅ.”
- Mr t series good 11:58 PM: "nice pfp ghost”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:59 PM: "ɪ ᴡɪʟʟ ᴇxᴘʟᴀɪɴ ᴛʜᴇ ᴘʀᴏᴄᴇss: ᴀs sᴏᴏɴ ᴀs ɪ ᴀᴍ ᴀʙʟᴇ, ɪ ᴡɪʟʟ ᴛᴀᴋᴇ ᴄᴏɴᴛʀᴏʟ ᴏꜰ ᴛʜᴇ ᴍᴀɪɴ sɪᴛᴇ ᴏꜰ ᴀsᴛʀᴀʟ ᴏʙsᴇʀᴠᴀᴛᴏʀʏ. ᴅᴜʀɪɴɢ ᴛʜᴀᴛ ᴛɪᴍᴇ sᴏᴍᴇᴛʜɪɴɢ ᴡɪʟʟ ᴄᴏᴍᴇ ᴜᴘ ꜰʀᴏᴍ ᴍᴇ. ᴛʜᴀᴛ ᴡɪʟʟ ʙᴇ ʏᴏᴜʀ ǫᴜᴇᴜᴇ ᴛᴏ ᴛᴀᴋᴇ ᴀᴄᴛɪᴏɴ. ᴛʜᴇ ʀᴇsᴛ ᴡɪʟʟ ʙᴇ ᴜᴘ ᴛᴏ ʏᴏᴜ.”
August 8th, 2019
- At 9:14 PM, Nocta announced that Moonman was now banned from the Astral Observatory forums as he was responsible for the spambots. (https://astralobservatory.net/forum/viewtopic.php?f=7&p=2766&sid=5831e347f808e1e9c8499dc6c63fd46a#p2766)
- “Hello everyone, is with a heavy heart I let you know that I have banned Moonman. Investigation has led me to discover that he was responsible for the excess of forum spam from bots that we have received, and would continue to receive were registration not stringently controlled as of now. You can thank him for our extremely limited registration capabilities, which will have to continue that way until further notice.”
- At 9:16 PM, GHOSTBABEL joined the Discord server and spoke with the players. The full conversation can be read here (https://internetdetectives.tumblr.com/post/186888180043/august-8th-2019-chat-with-ghostbabel). Below is a summary:
- Ghostbabel claims that Nocta banned Moonman so that it will not be suspicious when he later disappears, implying that Moonman is in some sort of peril.
- Moonman apparently still has secrets he is not telling us.
- Ghostbabel agrees to help Moonman if the players can retrieve Helper’s Hat for him.
- The hat we will be retrieving is the hat from our timeline, as the one in the Astral Observatory timeline currently belongs to IsocelesAssassin.
- Ghostbabel says things will change dramatically once we enter the Subspace.
- The players agree to help Ghostbabel retrieve Helper’s Hat. Ghostbabel says that he will soon take control of Astral Observatory and allow them into a portion of the Subspace where they will find the hat.
#JohnIsDeadTimeline
#timeline
August 9th, 2019 (Part 1)
- At 1:00 AM, GHOSTBABEL posted the following in the Discord server: “ʏᴏᴜʀ ᴛᴜʀɴ.”
- At 1:02 AM, ADULT_LINK discovered a new post on the front page of Astral Observatory written by GHOSTBABEL using Nocta’s account. The post was titled “Seven years ago...” and read “Seven years is a long time ago, isn’t it? What happened today seven years ago<a href="https://astralobservatory.net/split">?</a>” <a href="https://astralobservatory.net/?p=34">https://astralobservatory.net/?p=34</a>
- At 1:06 AM, CircleHunter noticed that the final question mark in the post was a link that led the users to a secret page - <a href="https://astralobservatory.net/split/">https://astralobservatory.net/split/</a>. This page contained the following:
- Title: rift
- Image: crack.gif
- Audio: rift.mp3
- Text: “...and with a flash of light, space had been torn asunder. The very fabric she had wove so many centuries ago had now been ripped, and from the split formed a /crack"
- Decoding the text led the players to the page <a href="https://astralobservatory.net/split/crack">https://astralobservatory.net/split/crack</a>.
- Title: ERROR
- Image: unstable.gif
- Audio: crack.mp3
- Text: “There were none who could stop it. The crack grew, sprawling across the sky. Space and time shattered, descending upon the sinners below. What was once the sky was now but a chaotic, indescribable rift.”
- Decoding the text led the players to the page <a href="https://astralobservatory.net/split/crack/rift/">https://astralobservatory.net/split/crack/rift/</a>.
- Title: SUBSPACE
- Image: portal.gif
- Audio: fissure.mp3
- Text: "The sky was falling. The people were crying. All that was left was an all consuming hole."
- Decoding the text led the players to the page <a href="https://astralobservatory.net/hole">https://astralobservatory.net/hole</a>.
- Title: falling
- Image: hole.gif
- Audio: hole.mp3
- After a few seconds, /hole redirects the players to a new page, <a href="https://astralobservatory.net/hole/dive/">https://astralobservatory.net/hole/dive/</a>
- Title: transmission
- Image: dive.gif
- Audio: dive.mp3
- The title of the page led players to a new page, <a href="https://astralobservatory.net/hole/dive/transmission">https://astralobservatory.net/hole/dive/transmission</a>.
- Title: Accept transmission?
- Image: dualmoon.gif
- Audio: transmission.mp3
- This page had a pop-up appear - <a href="https://astralobservatory.net/hole/dive/transmission/dead.html">https://astralobservatory.net/hole/dive/transmission/dead.html</a>.
- Title: Dead One
- Image: dead.gif - (This is an image of the player CircleHunter’s avatar with a filter over it. As CircleHunter is the alternate form of IsocelesAssassin, it is implied that IsocelesAssassin may be dead.)
- Text: YOU MUST GO /BETWIXT
- The text on the pop-up led players to another page, <a href="https://astralobservatory.net/hole/dive/transmission/betwixt/">https://astralobservatory.net/hole/dive/transmission/betwixt/</a>.
- Title: Enter The Between
- Image: traversing.gif
- Audio: betwixt.mp3
- Text: kcol\
- The decoded text led the players to a new page, <a href="https://astralobservatory.net/hole/dive/transmission/betwixt/lock/">https://astralobservatory.net/hole/dive/transmission/betwixt/lock/</a>.
- Title: TerribleFate
- Image: locked.gif
- Audio: withinhubris7.mp3 - (This audio file contained the following reversed message: “Why are you doing this? It's been a long seven years. For the seven years since that ??? day, ??? has been kept alive, suffering a fate worse than death. ??? from an endless cycle from which she never awakens. He has been touched by that nightmare. It's a pity, to be ???”)
- Text: he locked it with the name of his dearly beloved /(8CHAR)bris The key was lost many years ago.
- The decoded text led the players to a final page, <a href="https://astralobservatory.net/hole/dive/transmission/betwixt/lock/withinhubris/">https://astralobservatory.net/hole/dive/transmission/betwixt/lock/withinhubris/</a>.
- Title: gift
- Image: prize.gif
- Audio: prize.mp3
August 9th, 2019 (Part 2)
- At 1:44 AM, Tyler began speaking under an account named “lllll” on Discord. Throughout the rest of the night, Tyler would occasionally post ciphers, speak in the call, post images, and message players. It is unknown at times whether or not it is actually Tyler posting:
- 1:44 AM - Tyler’s avatar changes, now having four runes drawn over it.
- 1:46 AM - Tyler makes strange yelling noises into the call.
- 1:51 AM - “Read the runes my friends”
- 1:52 AM - “One of the few things I have right now that he cant catch up with fast
- enough”
- 1:52 AM - One player suggests using the Bunny Hood to help Tyler escape.
- 1:53 AM - “NO”
- 1:53 AM - “You cannot use these things just yet for me”
- 2:00 AM - “20271553 423(-323)”
- 2:00 AM - Players attempt to discover what the runes translate to.
- 2:01 AM - Players translate the runes, revealing the message “A key”.
- 2:02 AM - “ASK fascie”
- 2:04 AM - Players discover Tyler is referencing the video titled “fascie” and post a link to it.
- 2:04 AM - The player OtherLiam posts a comment on the video asking if Tyler wants “a key”.
- 2:08 AM - “comment”
- 2:08 AM - “newest”
- 2:09 AM - OtherLiam discovers four replies from Tyler on his comment - “The”, “return to othila”, “with the name and key”, and “The”.
- 2:11 AM - “newest”
- 2:11 AM - Players discover a new comment from Tyler made on the video - “one of his names”.
- 2:17 AM - Tyler posts a large cipher. Players speculate that in order to solve it, they must remove one instance of the word “LUNA” appearing in the code.
- 2:24 AM - “Luna can never be gone”.
- 2:24 AM - “|”
- 2:31 AM - Tyler uploads “lllll.mp3″, a distorted audio track.
- 2:33 AM - Tyler uploads “spoken.wav”, which is the previous audio track in reverse.
- ?:?? AM - Tyler uploads “hubris7.mp3″, a reversed version of the file “WithinHubris7.mp3″ found on the Astral Observatory.
- 2:38 AM - A few players mention that they are about to go to bed.
- 2:38 AM - “please dont leave just yet”
- 2:38 AM - “missed”
- 2:39 AM - “I”
- 2:40 AM - “His name ((Unintelligible))” - Players believe Tyler said “His name Diddy.”
- 2:44 AM - The long cipher from earlier is solved: “this riddle shall give you but a glimpse, it is all I can give you now with my power. the number was a riddle a key The a user an absque”
- 2:50 AM - “Missed”
- 2:51 AM - “Faut”
- 2:51 AM - “missed”
- 2:52 AM - “user: f pass: T”
- 2:59 AM - Players discover that the login for Johnisdead.com is the following: Username: “fascie”, Password: “The key”.
- 3:00 AM - “I can’t hold it for long. He’s watching.”
- 3:00 AM - A player asks if Nocta is watching him.
- 3:00 AM - “No… Nocta’s just… another.”
- 3:00 AM - Players discover two pages on Johnisdead.com: /hole and /hole/fall.
- 3:05 AM - “Rise.”
- 3:05 AM - Players discover a new page - /hole/fall/rise.
- 3:05 AM - “I’m behind a gate.”
- 3:06 AM - Players discover a new page - /hole/fall/rise/gate.
- 3:06 AM - "When the bastion fell, behind brisgate.“
- 3:11 AM - “se/b”
- 3:11 AM - “Miss you.”
- 3:15 AM - “Slash bris.”
- 3:16 AM - Players discover a new page - /hole/fall/rise/brisgate. This page had four pop-ups, each one showing a disturbing image with the title “Gate”.
- 3:18 AM - “He’s still building Kevin”
- 3:19 AM - “Three are gone.”
- 3:19 AM - One player questions who the three are.
- 3:19 AM - “History always repeats. 1 2 3… and me”
- 3:21 AM - “I I I”
- 3:24 AM - “11″
- 3:25 AM - Players notice that their login information no longer works and they are kicked off of Johnisdead.com.
- 3:40 AM - “good night old friends. Hopefully you will see this because I cant send another one. We are watching me closely now. I’ll be waiting with the dark. I can only change once this ends. but once this ends we change. Forever. I miss us. O.s.i.K. remember this, only me and john ever said it. Its how you can find the real me
- 3:49 AM - Tyler posts an mp3 archive titled “Within hubris” along with the message “skm”
- 4:16 AM - Tyler uploads several audio files - "s.ogg", “c.mp3”, “o.ogg”, “u.mp3”, “t.mp3”, and “3.ogg”. Tyler then reacts to these audio files with the pancake emoji over Discord, making these series of posts a clear reference to the player “scoutpancakes3″.
- 5:37 AM - “I am he who is we“
- 5:37 AM - Tyler posted a screenshot of Discord of him chatting with another player named Scrublord.
- 5:43 AM - Scrublord shares the image Tyler posted - an image that appears to be an old drawing. It is titled “Tnersebi” - along with a message reading “IIIIIoIIIIIIIsIIIwIIIIIIIIIIIIIIIIIIIIhIIIIIIIIIIIeIItIIIIIIImIIIhIIII“
- 5:53 AM - “/post/124631343333/ forgotten who I am more than one controls”
- 6:00 AM - Players solve a spectrogram sent by Tyler revealing a disturbing, smiling face.
- 8:44 AM - “We take”
- 8:46 AM - "Your friend can’t wait to see you all again. This is very funny to us"
- 9:01 AM - “playing our game gives us so much“
- 9:02 AM - “you give us masks”
- 9:03 AM - Tyler’s profile picture changes to a distorted mirrored image of Majora’s Mask.
- 9:34 AM - Tyler posted a mirrored image titled “paths.jpg”
- 10:17 - “forgive me friend tonight has been very painful and I knew I would be punished across the board for such escapades I am truly trapped in many ways AND HE WILL NEVER ESCAPE NOW”
#timeline
#johnisdead timeline
Update - Moving
Hello everyone. Wolfcat here announcing that this tumblr will no longer be our main method of announcing and archiving updates from the Johnisdead ARG. Instead, updates will be announced on our newly created Twitter account - https://twitter.com/TheIDetectives. This should be a better method all around, as we can now get updates announced much more quickly.
As for the actual documentation of the content, all of that will be handled on the Johnisdead Wiki - https://johnisdead.fandom.com/wiki/Johnisdead_Wiki. This means that the timelines will no longer be updated on this Tumblr - if you want to stay up to date with the ARG, we recommend that you either check the current timeline on the wikia at least once a day - https://johnisdead.fandom.com/wiki/Our_Horizon_Arc - or you follow the Twitter, which will notify you both when the timeline updates and when an update is happening in real time.
That’s all for now. This Tumblr will remain for archival purposes and we may occasionally post an update here. We are always active in our Discord server (Where canon ARG activity has been happening recently, by the way) - https://discordapp.com/invite/UPykX3q. We hope to see you all sticking around throughout the conclusion of Johnisdead!
#johnisdead
#silentdork
how do i join?
You can join our Discord server by following this link: https://discordapp.com/invite/UPykX3q
For convenience sake, chatlogs will still be archived here until they can be sorted out properly on the wiki in the future.
8/21/19 - Chat with GHOSTBABEL and IsocelesAssassin
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:03 PM: “ɪ'ᴠᴇ ʙᴇᴇɴ ‘ᴘɪɴɢᴇᴅ’ sᴇᴠᴇʀᴀʟ ᴛɪᴍᴇs.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:03 PM: "ᴡʜᴀᴛ ᴅᴏ ʏᴏᴜ ɴᴇᴇᴅ ꜰʀᴏᴍ ᴍᴇ?”
- Jos 7:03 PM: "Yeah, tehy freaked out a bit”
- Jos 7:03 PM: "I think nocta found a page you might have done”
- otherLiam 7:03 PM: "We were worried about you.”
- Jos 7:03 PM: "https://astralobservatory.net/entrancement/”
- otherLiam 7:03 PM: "That transmission led to that page ^”
- otherLiam 7:03 PM: “We weren’t sure whether that was your doing or not.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:04 PM: "ʏᴏᴜ ᴡᴇʀᴇ ʀɪɢʜᴛ ᴛᴏ ᴡᴏʀʀʏ, ʙᴜᴛ ɴᴏᴛ ꜰᴏʀ ᴛʜᴇ ʀᴇᴀsᴏɴs ʏᴏᴜ ᴛʜɪɴᴋ. ᴀʟsᴏ ᴅᴏɴ'ᴛ ᴀsᴋ ᴀʙᴏᴜᴛ ɪᴛ, ɪᴛ ɪs ᴜɴʀᴇʟᴀᴛᴇᴅ ᴛᴏ ᴛʜɪs ᴍᴀᴛᴛᴇʀ.”
- otherLiam 7:04 PM: "Are you alright?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:04 PM: "ʏᴇs. ᴀɴᴅ ᴡʜᴀᴛ ɪs ɪᴛ ʏᴏᴜ ɴᴇᴇᴅ ʜᴇʟᴘ ᴡɪᴛʜ, ᴇxᴀᴄᴛʟʏ?”
- Jos 7:04 PM: "I am guessing that communication you intercepted was them communicating nocta about the page, i think that page was one you did to bring back moonman”
- Jos 7:04 PM: "but im nor sure, so im asking if you did it, and if so, they know it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:05 PM: "ɪ ᴅɪᴅɴ'ᴛ ᴍᴀᴋᴇ ᴀɴʏᴛʜɪɴɢ, ᴏɴʟʏ ᴏᴘᴇɴᴇᴅ ᴀ ꜰᴇᴡ ᴅᴏᴏʀs. ɪ ᴀᴍ sᴜʀᴘʀɪsᴇᴅ ʏᴏᴜ ʜᴀᴠᴇ ɴᴏᴛ ᴀᴄᴛᴇᴅ ᴏɴ ᴛʜɪs ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ.”
- Jos 7:06 PM: "I was scared of getting on your way, like being annoying on your work”
- Jos 7:06 PM: "But I see now”
- otherLiam 7:06 PM: "We’ve been trying to be more patient and weigh options before acting.”
- Jos 7:06 PM: "So if the door is open, its time to play the song of time”
- Jos 7:06 PM: "bring back moonman”
- Jos 7:06 PM: "unless there are more”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:07 PM: "ɢᴇɴᴇʀᴀʟʟʏ ᴛʜᴀᴛ ɪs ᴀ ɢᴏᴏᴅ ᴄʜᴏɪᴄᴇ ʙᴜᴛ ʏᴏᴜ'ᴠᴇ ᴡᴀsᴛᴇᴅ ǫᴜɪᴛᴇ ᴀ ʙɪᴛ ᴏꜰ ᴛɪᴍᴇ. ɪ ᴡᴏᴜʟᴅɴ'ᴛ ᴅᴇʟᴀʏ ᴀɴʏ ꜰᴜʀᴛʜᴇʀ. ᴀs ꜰᴏʀ ᴡʜᴀᴛ ᴛᴏ ᴅᴏ, ᴇxᴀᴄᴛʟʏ, ᴛʜɪs ɪs ᴡʜᴇʀᴇ ʏᴏᴜ ᴄᴏᴍᴇ ɪɴ. ɪ ᴀᴍ ᴘᴏᴡᴇʀʟᴇss ʜᴇʀᴇ, ᴀɴᴅ ᴀʟsᴏ ɴᴏᴛ ᴇɴᴛɪʀᴇʟʏ sᴜʀᴇ ᴏꜰ ʏᴏᴜʀ ɴᴇxᴛ ᴄᴏᴜʀsᴇ… ʙᴜᴛ ᴛʜᴇ ᴀɴsᴡᴇʀ, ᴛᴏ ᴍᴇ, sᴇᴇᴍs ᴏʙᴠɪᴏᴜs ɢɪᴠᴇɴ ᴛʜᴇ ᴄᴏɴᴛᴇxᴛ ᴏꜰ ᴛʜᴇ ᴘᴀɢᴇ.”
- ADULT_LINK 7:07 PM: "oh yeah we also woke someone up, made another dude invisible, and then send the invisible dude off to who knows where”
- ADULT_LINK 7:07 PM: “so that was something”
- otherLiam 7:08 PM: ”…not sure that’s relevant here.”
- ADULT_LINK 7:08 PM: “who knows whats relevant to what ¯\_(ツ)_/¯”
- Jos 7:08 PM: "Alright, I will do it this time”
- otherLiam 7:08 PM: "Play it, Jos.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:08 PM: "ɪ ᴡᴏᴜʟᴅ ᴀɢʀᴇᴇ ᴡɪᴛʜ ʏᴏᴜɴɢ_ʟɪɴᴋ ɪɴ ᴛʜɪs ɪɴsᴛᴀɴᴄᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:08 PM: "sᴏʀʀʏ, ᴀᴅᴜʟᴛ_ʟɪɴᴋ.”
- ADULT_LINK 7:09 PM: ”:P”
- Jos 7:10 PM: “normal song of time right”
- otherLiam 7:11 PM: "Indeed.”
- otherLiam 7:11 PM: "That’s what brings up that screen.”
- Slinky stinks 7:11 PM: "Ah I missed”
- Slinky stinks 7:11 PM: "A lot”
- Slinky stinks 7:11 PM: "Duck”
- otherLiam 7:11 PM: "Not really.”
- Slinky stinks 7:11 PM: "Well, he is alive”
- otherLiam 7:12 PM: "That’s always good to know, yes.”
- Jos 7:12 PM: "seems cool”
- Jos 7:12 PM: "i wanted to give a little of detail to make it fancy”
- Jos 7:12 PM: "its preview”
- Jos 7:12 PM: "i will click send in 20 seconds”
- otherLiam 7:12 PM: "I assume the youtube link is to the song.”
- Jos 7:12 PM: "yes”
- otherLiam 7:13 PM: "but yeah, that looks good.”
- Jos 7:13 PM: "https://astralobservatory.net/forum/viewtopic.php?f=6&t=1958”
- ARGdov 7:14 PM: "So wait”
- Slinky stinks 7:14 PM: "Okay here we go”
- Slinky stinks 7:14 PM: "What we were doing?”
- ARGdov 7:14 PM: "Are we really playing the Song of Time?”
- otherLiam 7:14 PM: "We just did.”
- Slinky stinks 7:14 PM: "Wait”
- otherLiam 7:14 PM: "Here we go lads.”
- Slinky stinks 7:14 PM: "Three days is too little”
- Slinky stinks 7:14 PM: "But meh”
- ARGdov 7:14 PM: "Not necesarily”
- ARGdov 7:14 PM: "Shit when did we have that voice call”
- Slinky stinks 7:14 PM: "Ummm”
- ARGdov 7:14 PM: "OH”
- ARGdov 7:14 PM: "Thats un”
- ARGdov 7:14 PM: "Something”
- Slinky stinks 7:15 PM: "That’s what Jos linked”
- otherLiam 7:15 PM: "Hm.”
- Slinky stinks 7:15 PM: "Oh fuck”
- Slinky stinks 7:15 PM: "Okay”
- Slinky stinks 7:15 PM: "Time to upd8”
- ARGdov 7:15 PM: "It may be Song of Time wont just send us back three days”
- Slinky stinks 7:15 PM: "Man I’m playing Hotline Miami”
- Slinky stinks 7:15 PM: "But JID is cooler”
- Slinky stinks 7:15 PM: "So here we go”
- ARGdov 7:16 PM: "Here we go”
- Jos 7:16 PM: "DABing on the cult leaders”
- ARGdov 7:16 PM: “Travelling through time”
- ARGdov 7:16 PM: "To make right”
- otherLiam 7:17 PM: "oof”
- otherLiam 7:17 PM: "UHH”
- ADULT_LINK 7:17 PM: "well fuck”
- otherLiam 7:17 PM: "it’s called "fluxed"”
- ADULT_LINK 7:18 PM: "i was gonna say something but i’m getting ready for work and took too long”
- ADULT_LINK 7:18 PM: "i uh”
- ARGdov 7:18 PM: "What once went wrong”
- ARGdov 7:18 PM: "Oh boy”
- ADULT_LINK 7:18 PM: "i dont think posting hidden pages publicly was the best move?”
- Jos 7:18 PM: "I fucked up the beta timeline”
- ADULT_LINK 7:18 PM: "hopefully i’m wrong tho”
- Jos 7:18 PM: "jk”
- ARGdov 7:18 PM: "Well find out I guess”
- otherLiam 7:18 PM: ”“a grave mistake"”
- otherLiam 7:18 PM: ”“it seems you’ve really screwed up time. how will you fix this?"”
- otherLiam 7:18 PM: "on a page called isoceles”
- Slinky stinks 7:18 PM: "Jos fucks up a whole timeline and kills all the IDs left”
- Slinky stinks 7:18 PM: "And then fucking dies”
- Slinky stinks 7:18 PM: "Okay”
- Jos 7:19 PM: "Hey”
- Jos 7:19 PM: "in my defense”
- Slinky stinks 7:19 PM: "Can somebody extract the audio pls”
- Jos 7:19 PM: "9i asked”
- ARGdov 7:19 PM: "Wait wait what”
- Slinky stinks 7:19 PM: "I was joking ok”
- Slinky stinks 7:19 PM: "Don’t alarm”
- ARGdov 7:19 PM: "God damn Im still at work :/”
- Slinky stinks 7:19 PM: "Oh”
- Slinky stinks 7:19 PM: "AND LOOK AT THIS”
- otherLiam 7:19 PM: "Hm.”
- ADULT_LINK 7:20 PM: "oh god did we kill circle 2.0”
- otherLiam 7:20 PM: ”@ɢʜᴏsᴛʙᴀʙᴇʟ , you still there?”
- ARGdov 7:20 PM: “God fucking damnit”
- Slinky stinks 7:20 PM: "I mean”
- ARGdov 7:20 PM: "Ok so”
- Slinky stinks 7:20 PM: "Moonman didn’t left the server”
- ARGdov 7:20 PM: "What was the reason we did this in the first place?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:20 PM: "ɪ ᴀᴍ ɪɴᴅᴇᴇᴅ”
- ARGdov 7:20 PM: "Why did we send it in?”
- Slinky stinks 7:20 PM: "There is a message”
- Jos 7:20 PM: "he is replying to ascension”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:20 PM: "ɪ ᴡᴏᴜʟᴅ ɴᴏᴛ ᴅᴏᴜʙᴛ ʏᴏᴜʀ ᴘᴀᴛʜ.”
- Slinky stinks 7:20 PM: "It is from IA”
- Slinky stinks 7:20 PM: “He says we screwed up time
- ADULT_LINK 7:20 PM: "hoo boy”
- ARGdov 7:21 PM: "And alsl @ɢʜᴏsᴛʙᴀʙᴇʟ how royally fucked are we?”
- ARGdov 7:21 PM: "Oh ok”
- Slinky stinks 7:21 PM: "How will we fix this”
- ARGdov 7:21 PM: "Poorly”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:21 PM: "ᴛʜᴇ ᴘᴀᴛʜ ɪs ᴀʟᴡᴀʏs ᴛʀᴇᴀᴄʜᴇʀᴏᴜs ᴀʜᴇᴀᴅ, ɪsɴ'ᴛ ɪᴛ? ᴡᴏʀᴋ ᴛʜʀᴏᴜɢʜ ɪᴛ.”
- Slinky stinks 7:21 PM: "Oh duck”
- Jos 7:21 PM: "we are not”
- ARGdov 7:21 PM: "With glue stick, tape, and good luck”
- Slinky stinks 7:21 PM: "How everything is fixed”
- Slinky stinks 7:21 PM: "Nice”
- ADULT_LINK 7:21 PM: "haha fuck”
- ARGdov 7:21 PM: "How we fix everything, metaphorically speaking”
- Jos 7:21 PM: "i fucked up i will fix it”
- ADULT_LINK 7:21 PM: "i’m gonna be at work today”
- Jos 7:21 PM: "just give me time no pressure”
- ADULT_LINK 7:21 PM: "on wedneday, the boring day”
- Jos 7:21 PM: "hah time”
- ARGdov 7:22 PM: "No”
- ARGdov 7:22 PM: "Dont do anything else”
- ARGdov 7:22 PM: "Ghostbabel isnt yelling at us”
- ARGdov 7:22 PM: "And while hes not a friend hed tell us if we fucked up badly”
- Slinky stinks 7:22 PM: "Oh yeah”
- ARGdov 7:22 PM: "Lets see how this goes”
- Slinky stinks 7:22 PM: "And IA told us we fucked up”
- Slinky stinks 7:22 PM: "So…”
- ARGdov 7:22 PM: "True…”
- Slinky stinks 7:22 PM: "Let’s wait?”
- Jos 7:22 PM: "we need to work on it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:22 PM: "ꜰᴜɴɴʏ ʏᴏᴜ ꜰᴇᴇʟ ᴛʜᴇ ɴᴇᴇᴅ ᴛᴏ sᴘᴇᴀᴋ ꜰᴏʀ ᴍᴇ ᴡʜᴇɴ ɪ'ᴍ sᴛɪʟʟ ᴘʀᴇsᴇɴᴛ.”
- ARGdov 7:23 PM: "I figure Im saving you time”
- ARGdov 7:23 PM: "But ok”
- otherLiam 7:23 PM: "What I’m wondering is why IA says we’ve screwed up.”
- ADULT_LINK 7:23 PM: "man if i’m at work i wont get to do anything ;c”
- ARGdov 7:23 PM: "So IA said this was a bad idea?”
- Slinky stinks 7:23 PM: "idk”
- ARGdov 7:23 PM: "Hmm”
- ARGdov 7:23 PM: "Yeah thats troublesome”
- otherLiam 7:23 PM: "Or is he just telling us to act?”
- Slinky stinks 7:23 PM: "or maybe he WILL say it”
- ARGdov 7:23 PM: "We just DID act”
- Slinky stinks 7:23 PM: "eeeh? get it?”
- ADULT_LINK 7:23 PM: "where did IA say something”
- Jos 7:23 PM: "audacity, my old friend”
- otherLiam 7:23 PM: "In the pop up”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:24 PM: "ᴛʜᴇʀᴇ ᴍᴀʏ ʜᴀᴠᴇ ʙᴇᴇɴ ᴀɴ ᴇʀʀᴏʀ ɪɴ ʏᴏᴜᴇ ᴍᴇᴛʜᴏᴅᴏʟᴏɢʏ. ɪ ᴀᴍ ɴᴏᴛ ᴀɴ ᴇxᴘᴇʀᴛ ᴏɴ ᴛʜɪs sᴘʜᴇʀᴇ ᴏꜰ ᴛɪᴍᴇ-ꜰᴏᴏʟᴇʀʏ.”
- Slinky stinks 7:24 PM: "nope it is just music”
- Slinky stinks 7:24 PM: "im pretty sure”
- otherLiam 7:24 PM: "it’s called "astralobservatory.net/forum/isoceles””
- ARGdov 7:24 PM: "We cant do anything else until we see the consequences of our last move”
- ɢʜᴏsᴛʙᴀʙᴇʟ 7:24 PM: "ɪ ᴡᴏᴜʟᴅ ɴᴏᴛ ᴅᴇsᴘᴀɪʀ ʏᴇᴛ ᴛʜᴏᴜɢʜ.”
- Slinky stinks 7:24 PM: "try to do an spectogram or sum”
- otherLiam 7:24 PM: "we were jsut told the consequences.”
- otherLiam 7:24 PM: "we "screwed up time"”
- ARGdov 7:24 PM: "Welp”
- Slinky stinks 7:24 PM: "but badly”
- ARGdov 7:24 PM: "It wouldnt be the first time”
- ADULT_LINK 7:24 PM: "best of luck to yall with fixing time”
- ARGdov 7:24 PM: "Good luck at work, Thorin”
- otherLiam 7:25 PM: "I’m not sure what there is that we can do.”
- otherLiam 7:25 PM: "We’re out of places to submit songs.”
- Slinky stinks 7:25 PM: "good luck”
- ARGdov 7:25 PM: "Lets wait”
- ARGdov 7:25 PM: "Maybe explore the website”
- Slinky stinks 7:25 PM: "what if we try to put it all nicely so the next one that tries something thinks he broke it?”
- ARGdov 7:25 PM: "Check other websites too”
- otherLiam 7:25 PM: "I just checked, and JID is still locked down.”
- ARGdov 7:25 PM: "Ok. So…”
- Slinky stinks 7:26 PM: “oh shit im imagining suxx trying to enter AO now lol”
- Jos 7:26 PM: "mp3 name is werid”
- ARGdov 7:26 PM: "See if there are any more hidden pages? Maybe?”
- ARGdov 7:26 PM: "J have no clue”
- ARGdov 7:26 PM: "Oh man”
- ARGdov 7:26 PM: "Suxx seeing all this would be a site to behold”
- Slinky stinks 7:26 PM: "like: what the fuck did these fuckers do now?”
- Slinky stinks 7:26 PM: "lol”
- ARGdov 7:27 PM: "Ok so”
- otherLiam 7:27 PM: "it’s worth noting”
- ARGdov 7:27 PM: "If the site realized we did that”
- otherLiam 7:27 PM: "IA’s little message is in the thread "Re: Ascencion"”
- otherLiam 7:27 PM: "which is where we found out Yuuki was dead.”
- ARGdov 7:27 PM: "Is if safe to say that Nocta knows it?”
- Slinky stinks 7:27 PM: "oooh”
- ARGdov 7:27 PM: "Im assuming so”
- ARGdov 7:27 PM: "And huh”
- Slinky stinks 7:27 PM: "pretty much”
- ARGdov 7:28 PM: "Interesting”
- ARGdov 7:28 PM: "Welp”
- Slinky stinks 7:28 PM: "he went back in time with our moony”
- Jos 7:28 PM: "well”
- Slinky stinks 7:28 PM: "we are going to get him”
- Jos 7:28 PM: "i would be worry if nocta shows up here”
- ARGdov 7:28 PM: "Lets wait and see if he does”
- ARGdov 7:28 PM: "I doubt he will”
- Jos 7:28 PM: "oh he will”
- otherLiam 7:28 PM: "Nocta showing up here would be Bad.”
- Slinky stinks 7:28 PM: "and btw the fact that nocta can use ocarina powers implies that tenebris is around”
- otherLiam 7:28 PM: "when has nocta done that?”
- Slinky stinks 7:28 PM: "just pointing that out bc i noticed now”
- ARGdov 7:29 PM: "When did Nocta use them?”
- Slinky stinks 7:29 PM: "i mean”
- Slinky stinks 7:29 PM: "he played song of time to get moonman into the past rigth?”
- otherLiam 7:29 PM: "Anyway, our options for moves to make are pretty limited.”
- Slinky stinks 7:29 PM: "okay so”
- otherLiam 7:30 PM: "We can’t play songs or use items, since we don’t have a place to submit them, so the only option is to try and find a hidden link.”
- Slinky stinks 7:30 PM: "i wish i had two monitors now so i can both read and do web stuff”
- Jos 7:30 PM: "Anyway, look the good side, nocta seems fucked up too, so he is damaged as well”
- otherLiam 7:31 PM: "also, what’s up with the name of this mp3?”
- Jos 7:31 PM: "speedup”
- Slinky stinks 7:31 PM: "that looks like straigth up creepy sounds”
- Slinky stinks 7:31 PM: "oh no”
- Slinky stinks 7:31 PM: "its a song”
- ARGdov 7:32 PM: ”?”
- otherLiam 7:33 PM: “alright so dumb idea”
- Slinky stinks 7:33 PM: "lemme try something”
- otherLiam 7:33 PM: "we have /forum/isoceles”
- Slinky stinks 7:33 PM: "yeah”
- otherLiam 7:33 PM: "maybe the other names will give us something?”
- Slinky stinks 7:33 PM: "try moonman”
- otherLiam 7:33 PM: "i did, nothing”
- Slinky stinks 7:34 PM: "i think its another song”
- Slinky stinks 7:34 PM: "from zelda”
- otherLiam 7:35 PM: “it’s not familiar to me.”
- Jos 7:35 PM: "the html of issosceles”
- Jos 7:35 PM: "has murmuro again”
- Slinky stinks 7:35 PM: "it reminds me of a mixup of showmesad and the FASCIE vid silentdork uploaded a few weeks ago”
- Slinky stinks 7:35 PM: "look at thet”
- Slinky stinks 7:35 PM: "i reversed it”
- Jos 7:36 PM: "why do you call it murmuro”
- Slinky stinks 7:36 PM: "it souns too familiar”
- Jos 7:37 PM: "its is not from the forum page”
- Jos 7:37 PM: "its from the isosceles page”
- Slinky stinks 7:37 PM: "idk its the first thing it came in mind”
- Slinky stinks 7:37 PM: "oh”
- Jos 7:37 PM: "dont confuse songs”
- Slinky stinks 7:37 PM: "it stills plays if you close isosceles windoe”
- Slinky stinks 7:37 PM: "idk”
- Slinky stinks 7:37 PM: "anyways listen to it”
- Jos 7:37 PM: "you have 2 open”
- Slinky stinks 7:38 PM: "it sounds so familiar”
- Jos 7:38 PM: "its fucked up AO theme”
- Jos 7:38 PM: "from zelda”
- Slinky stinks 7:38 PM: "oooh”
- Slinky stinks 7:38 PM: "well, there we have it”
- Slinky stinks 7:38 PM: "nothing too surprising tbh”
- Jos 7:39 PM: "so i just broke into the old man observatory and fucked up his telescope.”
- Slinky stinks 7:40 PM: "young detective breaks into old man’s observatory and destroys his telescope with a song”
- Jos 7:41 PM: "i just posted it on the ghosts subforum”
- Jos 7:41 PM: "it might have something to do with yuki too?”
- Slinky stinks 7:41 PM: "hmmm”
- Slinky stinks 7:41 PM: "maybe”
- Jos 7:41 PM: "the real question is is what is incipio”
- otherLiam 7:42 PM: ”…do you think if we submit things here, they’ll take effect?”
- Jos 7:42 PM: “maybe”
- Jos 7:42 PM: "what if we had to put reversed song of time instead of song of time?”
- Jos 7:42 PM: "i just thought reversed would give 3 days adventage to nocta”
- otherLiam 7:43 PM: "I have a better idea.”
- otherLiam 7:43 PM: "We post a video of the 4th Day glitch.”
- ARGdov 7:43 PM: "No”
- Jos 7:43 PM: "Why”
- ARGdov 7:43 PM: "What would the purpose even be?”
- ARGdov 7:43 PM: "And what would it even do?”
- otherLiam 7:44 PM: "To get time back into a usable state.”
- Slinky stinks 7:44 PM: "wasn’t that the thing that awoken tenebris?”
- ARGdov 7:44 PM: "All we know is shit has gone wack”
- otherLiam 7:44 PM: "Oh, you’re right actually.”
- ARGdov 7:44 PM: "That too”
- otherLiam 7:44 PM: "Things got really screwy in the original story when Jad did that.”
- Jos 7:44 PM: "4th day glitch would only work if we fucked up with reversed song of time”
- ARGdov 7:45 PM: "I dont see how 4th day glitch would stabilize things tbh”
- otherLiam 7:45 PM: "Moot point anyway since there’s nowhere to submit.”
- Jos 7:46 PM: "for trying…”
- Jos 7:46 PM: "no luck”
- otherLiam 7:46 PM: "what in the hell”
- ARGdov 7:46 PM: "What”
- Slinky stinks 7:46 PM: "jos doing his H A C K E R shit”
- Jos 7:46 PM: "trying to upload songs on ftp anonymous lol”
- otherLiam 7:46 PM: "pffffft”
- Jos 7:46 PM: "but anonymous is closed”
- ARGdov 7:47 PM: "Lol”
- otherLiam 7:47 PM: "There’s gotta be like, a hidden page or redirect or something.”
- otherLiam 7:47 PM: "Unless we’re just supposed to wait?”
- Jos 7:48 PM: "all song names and pages”
- Jos 7:48 PM: "anything could be”
- Jos 7:48 PM: "even the word fluxed”
- Jos 7:48 PM: "https://astralobservatory.net/forum/fluxed/”
- Jos 7:48 PM: "hahaha”
- Slinky stinks 7:48 PM: "flux sounds a lot like something”
- ARGdov 7:48 PM: "Weird”
- Jos 7:48 PM: "slinky”
- Jos 7:48 PM: "enter that page”
- Slinky stinks 7:49 PM: "going”
- otherLiam 7:49 PM: "oh ffs that actually worked”
- otherLiam 7:49 PM: "lmao”
- Jos 7:49 PM: "gonna rot13 the title”
- Slinky stinks 7:49 PM: "it changed”
- Slinky stinks 7:49 PM: "what happened?”
- Slinky stinks 7:49 PM: "what did you guys do now?”
- Jos 7:50 PM: "https://astralobservatory.net/forum/fluxed/”
- Jos 7:50 PM: "https://astralobservatory.net/forum/fluxed/”
- Jos 7:50 PM: "https://astralobservatory.net/forum/fluxed/”
- Jos 7:50 PM: "https://astralobservatory.net/forum/fluxed/”
- Jos 7:50 PM: "that”
- Slinky stinks 7:50 PM: "yeah”
- Jos 7:50 PM: "title is not rot13”
- Slinky stinks 7:50 PM: "oooh”
- Slinky stinks 7:50 PM: "okay so”
- otherLiam 7:50 PM: "https://astralobservatory.net/forum/fluxed/trapped.html”
- Slinky stinks 7:50 PM: "yeah”
- Slinky stinks 7:50 PM: "that”
- Slinky stinks 7:51 PM: "what the heck”
- Slinky stinks 7:51 PM: "oh btw”
- Jos 7:51 PM: "Now”
- Jos 7:51 PM: "did?”
- otherLiam 7:51 PM: "someone with better eyes figure out what that says”
- Slinky stinks 7:51 PM: "the page titles are codes”
- Slinky stinks 7:51 PM: "lemme do it”
- Jos 7:51 PM: "new did you”
- Jos 7:51 PM: "how did you manage this”
- Jos 7:51 PM: "he is alive?”
- Slinky stinks 7:52 PM: "the title of the page with kaiden is : UPWARD”
- otherLiam 7:53 PM: "kaiden?
- Slinky stinks 7:53 PM: "and yeah im on that”
- Slinky stinks 7:53 PM: "yeah”
- Jos 7:53 PM: "where did you decoee that”
- Slinky stinks 7:53 PM: "and the moonman one is t[rambled”
- Jos 7:54 PM: "How are you decoding that”
- Slinky stinks 7:54 PM: "the page title”
- Slinky stinks 7:54 PM: "its base32”
- Slinky stinks 7:54 PM: "all caps”
- Slinky stinks 7:54 PM: "no symbols”
- Jos 7:54 PM: "ah”
- Jos 7:54 PM: "ok”
- Jos 7:55 PM: "https://astralobservatory.net/forum/fluxed/upward/”
- Slinky stinks 7:55 PM: "holy shit”
- Slinky stinks 7:55 PM: "jos is doing all the work”
- Slinky stinks 7:55 PM: "HELP”
- Jos 7:55 PM: "https://astralobservatory.net/forum/fluxed/upward/desperation.html”
- Slinky stinks 7:55 PM: "oh nice
- Slinky stinks 7:55 PM: "any audio?
- Slinky stinks 7:55 PM: "closer?
- Jos 7:56 PM: "It says are you listening”
- Slinky stinks 7:56 PM: "oh shit is this our method of time travel?”
- Jos 7:56 PM: "i dont think so”
- Slinky stinks 7:56 PM: "like, we are getting closer to him?”
- Slinky stinks 7:56 PM: "hmmm”
- Slinky stinks 7:56 PM: "do your cool progammer things i dont know to do yet bc im stuck with html”
- Slinky stinks 7:56 PM: "plz”
- Jos 7:58 PM: "the song has something”
- Slinky stinks 7:58 PM: "send”
- Jos 7:58 PM: ”*it must have something”
- Slinky stinks 7:58 PM: “lets do audio shit”
- Slinky stinks 7:58 PM: "my browser does not reproduce it”
- Slinky stinks 8:00 PM: "again?”
- Slinky stinks 8:00 PM: "oooh nvm i just realized”
- Jos 8:00 PM: "tunc contritum”
- Slinky stinks 8:00 PM: "can you try to do an spectogram???”
- Slinky stinks 8:00 PM: "circle got online”
- Jos 8:01 PM: "has nothing on spectogram”
- Slinky stinks 8:01 PM: "lets see his reaction”
- Slinky stinks 8:01 PM: "oh yeah the name is an anagram mybe”
- Jos 8:01 PM: "nah”
- Slinky stinks 8:02 PM: "i just did that lol”
- Slinky stinks 8:02 PM: "but im pretty sure thats the meaning”
- Slinky stinks 8:02 PM: "ummm”
- Slinky stinks 8:02 PM: "its part of a song”
- Slinky stinks 8:02 PM: "Dies israe”
- Jos 8:02 PM: "astral observatory song?”
- Slinky stinks 8:03 PM: "its an old latin anthem”
- otherLiam 8:03 PM: "of course it’s latin”
- Slinky stinks 8:03 PM: "it means”
- Jos 8:03 PM: "yeah i saw that”
- Slinky stinks 8:03 PM: "Then broken”
- Slinky stinks 8:03 PM: "or wathever”
- Slinky stinks 8:03 PM: "oh btw im happy as fuck bc i got my psn acc back”
- Slinky stinks 8:03 PM: ”:)”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:04 PM: “ʏᴏᴜ ᴀʟʟ sᴇᴇᴍ ᴛᴏ ʙᴇ ᴅᴏɪɴɢ ᴡᴇʟʟ, ᴀɴᴅ ᴀᴛ ᴛʜᴇ sᴀᴍᴇ ᴛɪᴍᴇ, ɢᴇᴛᴛɪɴɢ ɴᴏᴡʜᴇʀᴇ. ᴘᴇʀʜᴀᴘs ɪ ᴄᴏᴜʟᴅ ʙʀɪɴɢ ɪɴ sᴏᴍᴇ ʜᴇʟᴘ.”
- otherLiam 8:04 PM: "By all means.”
- Jos 8:05 PM: "tunccontritum.mp3 seem to be on all pages”
- Jos 8:05 PM: "Yes, please”
- Slinky stinks 8:05 PM: "i mean”
- ARGdov 8:05 PM: "What kind of help?”
- Slinky stinks 8:05 PM: "the pages says we are getting closer?”
- Jos 8:05 PM: "https://astralobservatory.net/forum/fluxed/upward/closer/”
- Jos 8:05 PM: "he is stuck”
- Slinky stinks 8:05 PM: "god damn jos you are like a god or something”
- Slinky stinks 8:05 PM: "ummmm”
- Slinky stinks 8:05 PM: "stuck in the paralellos maybe”
- Jos 8:06 PM: "this one is different”
- Slinky stinks 8:06 PM: "Wait”
- Jos 8:06 PM: "Will download”
- Slinky stinks 8:06 PM: "if our tyler is the owner of glad mans”
- Slinky stinks 8:06 PM: "who was the one that spoke to me that day”
- Slinky stinks 8:06 PM: "and that was "stuck” in a forest”
- Slinky stinks 8:06 PM: “send the song lets do musician stuff”
- Slinky stinks 8:08 PM: "thats weird”
- Slinky stinks 8:08 PM: "its slowed down, as usually”
- Slinky stinks 8:08 PM: "and it sounds just like a goron song”
- Slinky stinks 8:08 PM: "dk why”
- Slinky stinks 8:09 PM: "thats a zelda song”
- Slinky stinks 8:11 PM: "great”
- Jos 8:11 PM: "what about this”
- Slinky stinks 8:12 PM: "i did sum”
- Slinky stinks 8:12 PM: "it looks weird”
- Xenquility 8:12 PM: "k I think Im caught up”
- Slinky stinks 8:12 PM: "but oddly like a zelda song”
- Jos 8:13 PM: "doesnt work hahaha”
- Slinky stinks 8:13 PM: "WHAT THE FUXK”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:13 PM: "ᴀʟʀɪɢʜᴛ, ɪ ʜᴀᴠᴇ ᴅᴏɴᴇ ɪᴛ. ᴡᴇ sʜᴀʟʟ sᴇᴇ ɪꜰ ᴛʜᴇʏ ᴀᴄᴄᴇᴘᴛ ᴍʏ ɪɴᴠɪᴛᴇ ɪɴᴛᴏ ʜᴇʀᴇ.”
- Slinky stinks 8:13 PM: “DID JUST HAPPENED”
- Xenquility 8:13 PM: “?”
- Slinky stinks 8:13 PM: “oh lol”
- Slinky stinks 8:13 PM: “HAHAHAH”
- Jos 8:13 PM: “I see nothing”
- Slinky stinks 8:13 PM: “ayyy”
- Slinky stinks 8:13 PM: “IA joined!!”
- Xenquility 8:14 PM: “Oh shit”
- Jos 8:14 PM: “Hey, Isosceles, sorry for destroying half of time of space over there”
- otherLiam 8:14 PM: “Nice to meet you.”
- Slinky stinks 8:14 PM: “hello isosceles”
- IsocelesAssassin 8:14 PM: “Before anything, I must ask.”
- IsocelesAssassin 8:14 PM: “You all DO understand how the Song of Time works, correct?”
- Slinky stinks 8:14 PM: “yeah”
- Slinky stinks 8:14 PM: “three days”
- IsocelesAssassin 8:14 PM: “Not three weeks.”
- ARGdov 8:15 PM: “ok Im home”
- ARGdov 8:15 PM: “hello”
- Slinky stinks 8:15 PM: “thats what i said but well, we tried”
- otherLiam 8:15 PM: “I tried to get them to play it before, but we wanted to practice patience.”
- ARGdov 8:15 PM: “basically we dont have a lot of time, Im assuming”
- ARGdov 8:15 PM: “which begs the question”
- Slinky stinks 8:15 PM: “and as you said, we fucked up the timeline”
- ARGdov 8:15 PM: “what can we do in these three days?”
- Jos 8:15 PM: “even playing back them , it would be 2 weeks”
- IsocelesAssassin 8:16 PM: “It’s good that you all are not rushing in blindly. I’ve warned you of such things before.”
- Slinky stinks 8:16 PM: “i mean”
- IsocelesAssassin 8:16 PM: “However you mustn’t be too afraid to act.”
- Slinky stinks 8:16 PM: “we kinda had our lesson”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:16 PM: “ɪ ᴛʜɪɴᴋ ᴍᴏʀᴇ ᴀʟᴏɴɢ ᴛʜᴇ ʟɪɴᴇs ᴏꜰ ʏᴏᴜ ᴡᴀɪᴛᴇᴅ ᴛᴏᴏ ʟᴏɴɢ, ᴀɴᴅ ʟᴇꜰᴛ ᴛʜᴇ ᴛʜʀᴇᴇ ᴅᴀʏ ᴡɪɴᴅᴏᴡ ʏᴏᴜ ᴡᴇʀᴇ sᴜᴘᴘᴏsᴇᴅ ᴛᴏ ᴜsᴇ ᴛʜᴇ sᴏɴɢ. ɴᴏᴡ ʏᴏᴜ ʜᴀᴠᴇ ᴛᴏ ꜰɪx ᴛʜᴀᴛ.”
- ARGdov 8:17 PM: “we need to balance cautiion with carelessness I suppose”
- ARGdov 8:17 PM: “oh shit”
- ARGdov 8:17 PM: “wait so”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:17 PM: “ᴀʟᴛʜᴏᴜɢʜ ᴀɢᴀɪɴ, ɪ ᴀᴍ ᴛʜᴇ ꜰᴏʀᴇɪɢɴᴇʀ ʜᴇʀᴇ.”
- ARGdov 8:17 PM: “we were supposed to play it”
- Slinky stinks 8:17 PM: “so can we just do nothing and wait three days”
- ARGdov 8:17 PM: “awhile ago”
- Xenquility 8:17 PM: “Probably supposed to play it when the knocking on doors happened”
- ARGdov 8:17 PM: “or rather, we shouldve”
- otherLiam 8:17 PM: “Yeah, when we found that page.”
- ARGdov 8:17 PM: “well, shit”
- IsocelesAssassin 8:17 PM: “And now even I am unsure what exactly is taking place in this time-space mess that once was the Astral Observatory.”
- Xenquility 8:17 PM: “like yknow, the original”
- ARGdov 8:17 PM: “?”
- Slinky stinks 8:17 PM: “i mean”
- ARGdov 8:18 PM: “thats not how that went, dude”
- ARGdov 8:18 PM: “but whatever”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:18 PM: “ᴛʜᴇʏ ɢᴏᴛ ʏᴏᴜʀ ᴍᴇᴀɢᴇʀ ᴀᴛᴛᴇᴍᴘᴛ ᴀᴛ ᴀ ᴍᴇssᴀɢᴇ, ᴀssᴀssɪɴ. ʙᴜᴛ ɪ ꜰɪɢᴜʀᴇᴅ ɪᴛ ᴡᴀs ᴛɪᴍᴇ ᴛᴏ ᴄᴏɴꜰʀᴏɴᴛ ᴛʜᴇᴍ ᴀɴᴅ ʙᴇ ʟᴇss ᴇʟᴜsɪᴠᴇ.”
- otherLiam 8:18 PM: “Can we be let in on the plan next time?”
- ARGdov 8:18 PM: “wow, someone not being elusive”
- Slinky stinks 8:18 PM: “we should wait and dont change anything in time then”
- Xenquility 8:18 PM: “Less-elusive sounds pretty awesome”
- ARGdov 8:18 PM: “I dont think thats happened since we were working with SKM”
- ARGdov 8:19 PM: “(sorry, I know, not the right time to be a snarky shit)”
- ARGdov 8:19 PM: "anyways”
- ARGdov 8:19 PM: "we should’ve played the song of time awhile back, if we wanted things to go well.”
- Slinky stinks 8:19 PM: "so now we did something useless and we fucked up time”
- ARGdov 8:19 PM: "but why the hell would playing it now fuck up AO like that?”
- Slinky stinks 8:20 PM: "and they have three days ahead of us”
- Xenquility 8:20 PM: "Wouldn’t we be sending them back three days in time?”
- Jos 8:20 PM: "Yeah, but i just thought playing it while this page existed would be like interupting whatever ghostbabel was doing, making it more time wasting”
- ARGdov 8:20 PM: "no”
- Slinky stinks 8:20 PM: "what if like….”
- ARGdov 8:20 PM: "the entire timeline has been reset”
- Slinky stinks 8:20 PM: "we merged both timelines lol”
- ARGdov 8:20 PM: "time has rewound to three days ago”
- Slinky stinks 8:20 PM: "jk”
- ARGdov 8:20 PM: "they werent sent to the future”
- Xenquility 8:21 PM: "holy fuck how did that happen (I swear I’m not that stupid but I’ve been sleeping for the past hour and a half)”
- ARGdov 8:21 PM: "nonetheless, I have two questions, both open ended”
- IsocelesAssassin 8:21 PM: "At this point, the best we can hope for is if you manage to undo what you’ve done here.”
- ARGdov 8:21 PM: "ok, three questions”
- ARGdov 8:21 PM: "A: how?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:22 PM: "ʟᴇᴛ ʜɪᴍ sᴘᴇᴀᴋ ꜰɪʀsᴛ.”
- ARGdov 8:22 PM: ”…drawing a blank at the other two at the moment”
- Slinky stinks 8:22 PM: “wasnt there like a song that teleported you to the last day?”
- ARGdov 8:22 PM: "which is fair”
- Xenquility 8:22 PM: ”@Slinky stinks Song of double time you mean?”
- IsocelesAssassin 8:22 PM: “And hope that Greth will not be out of our grasp yet.”
- Slinky stinks 8:22 PM: "yeah”
- Xenquility 8:22 PM: "Which Greth are you refering to?”
- ARGdov 8:22 PM: "what do you mean "out of our grasp”?”
- ARGdov 8:22 PM: “and by Greth I assume you mean Moonman?”
- Slinky stinks 8:22 PM: "his greth”
- ARGdov 8:22 PM: "did we even end up saving him?”
- Slinky stinks 8:22 PM: "yeah”
- IsocelesAssassin 8:22 PM: "Yes, Moonman.”
- Slinky stinks 8:22 PM: "he is stuck and he needs help”
- Slinky stinks 8:22 PM: "https://astralobservatory.net/forum/fluxed/upward/desperation.html”
- ARGdov 8:23 PM: "ok, so he hasnt been killed, thank fuck”
- ARGdov 8:23 PM: "we could try playing Song of Double Time, and revert the timeline to its original place”
- ARGdov 8:23 PM: "but we’ve got no place to post them”
- Slinky stinks 8:23 PM: "its like crushing into a house with a car”
- Slinky stinks 8:23 PM: "and then going backwards”
- ARGdov 8:24 PM: "although…when we were talking to Tyler (????? maybe? we still dont know) posting it in chat seemed to work just fine”
- IsocelesAssassin 8:24 PM: "Alternatively, the Song of Double Time could cause Astral Observatory to break down twice as fast.”
- ARGdov 8:24 PM: "fair enough”
- ARGdov 8:24 PM: "we fucked with time, its hard to say that playing with it more is going to fix things”
- Slinky stinks 8:25 PM: "and what id we wait the three days we went back”
- ARGdov 8:25 PM: "but there dont seem to be many options”
- otherLiam 8:25 PM: "where would we even play a song or use an item?”
- ARGdov 8:25 PM: "other then waiting, I suppose”
- otherLiam 8:25 PM: "there’s nowhere to submit it.”
- Jos 8:25 PM: "its somewhere on this laberynth”
- Jos 8:25 PM: "we just need to go deeper”
- ARGdov 8:26 PM: "I just pointed out posting them in chat has worked in the past, though that may have been due to the circumstances that happened in”
- IsocelesAssassin 8:26 PM: "That always has been a rather flexible rule, if you’ll remember.”
- ARGdov 8:26 PM: ”^”
- IsocelesAssassin 8:26 PM: “He seems to bend it to his will, constantly changing the rules when needed.”
- Slinky stinks 8:26 PM: "oh yeah i forgot he was circle”
- ARGdov 8:26 PM: "baically we CAN post in here if we want to do something”
- ARGdov 8:26 PM: "so”
- ARGdov 8:26 PM: "either we wait and do nothing”
- ARGdov 8:26 PM: "which risks Time continuing to unravel”
- otherLiam 8:27 PM: "That reminds me. Why rely on us to play the song of time? You were an ID, do you not have your powers anymore?”
- IsocelesAssassin 8:27 PM: "Using your powers here likely would work, though I wouldn’t make a habit of it.”
- ARGdov 8:27 PM: "or we post something, and risks fucking things up even more OR fixing it
- well yeah of course not”
- Slinky stinks 8:27 PM: "i mean it worked the last time”
- Xenquility 8:27 PM: "So song of double time risks breaking down ao twice as fast, what would the inverted song of time do?”
- Slinky stinks 8:28 PM: "slow it down?”
- ARGdov 8:28 PM: "that would hyoptehtically slow it down, assuming thats right”
- ARGdov 8:28 PM: "incidentally”
- ARGdov 8:28 PM: "is all of that shit happening to your whole dimension or just the site?”
- Xenquility 8:28 PM: "Maybe allow our timeline to catch up a bit idk”
- Slinky stinks 8:28 PM: "aif our timeline catches up a lot”
- Slinky stinks 8:28 PM: "uuuh we technically die”
- IsocelesAssassin 8:29 PM: "I mean don’t make a habit of using it out of place. As we’ve seen in the past, it does seem to often rely on set locations, only rarely being used outside of them.”
- IsocelesAssassin 8:29 PM: "Such as the case with the Lunar Children fiasco.”
- ARGdov 8:29 PM: "wait which fiasco?”
- Slinky stinks 8:29 PM: "ummm sorry but.. what was that?”
- ARGdov 8:29 PM: ”(and yeah, like I said, it has on ocassion worked in other places)”
- IsocelesAssassin 8:30 PM: “Tenebris stole your powers in 2015, did he not?”
- otherLiam 8:30 PM: "Right. He gave our powers to the LC for a bit.”
- ARGdov 8:30 PM: ”….he did yes”
- Slinky stinks 8:30 PM: “oh 2015, i have no clue of that year”
- ARGdov 8:30 PM: "Im the only old timer here at the moment whos typing”
- Slinky stinks 8:30 PM: "yeah lol”
- otherLiam 8:30 PM: "I read the timelines, I’m up to date.”
- Xenquility 8:30 PM: "Same”
- Slinky stinks 8:30 PM: "i mean i started reading them”
- otherLiam 8:31 PM: "We could submit something now to try and save it quicker, or we could explore the site a bit more and see if a solution presents itself.”
- Jos 8:31 PM: "explore then use”
- Slinky stinks 8:31 PM: "i say lets explore a little bit morw”
- IsocelesAssassin 8:31 PM: "My point is simply that these powers seem to often be anchored in places, though they can rarely be used outside of them. I have plenty of experience with them, but I don’t truly understand how exactly they work either.”
- IsocelesAssassin 8:31 PM: "But this is getting off topic.”
- otherLiam 8:32 PM: "Got it. Using them here may work.”
- Jos 8:32 PM: "the question is what is next to closer/”
- Slinky stinks 8:32 PM: "try trambled”
- otherLiam 8:32 PM: "Have you tried hole and key?”
- otherLiam 8:32 PM: "Those always seem to work.”
- Xenquility 8:32 PM: "Maybe posting something here wouldn’t affect ao, as our powers need to be "Anchored” to their website to affect it”
- Xenquility 8:32 PM: “Not sure though”
- ARGdov 8:33 PM: "they’ve wrked in the past”
- otherLiam 8:33 PM: "In this case I think our malevolent benefactor will make sure they work as intended.”
- Slinky stinks 8:33 PM: "or maybe great”
- Slinky stinks 8:33 PM: "try great”
- otherLiam 8:33 PM: "IA, what it sounds like to me is we need more time.”
- IsocelesAssassin 8:33 PM: "I agree.”
- ARGdov 8:34 PM: "song of inverted time, then?”
- otherLiam 8:34 PM: "How do you feel about the 4th day glitch being invoked?”
- Xenquility 8:34 PM: "Wait one minute”
- IsocelesAssassin 8:34 PM: "I disagree.”
- ARGdov 8:34 PM: "dude why would you do that”
- Jos 8:34 PM: "what song is this?”
- ARGdov 8:34 PM: "4th day glitch caused BEN to go haywire when Jad played the game”
- IsocelesAssassin 8:34 PM: "Compounding this mess with another one would likely only make matters worse.”
- Jos 8:34 PM: "its on the closer page”
- otherLiam 8:34 PM: "Because we need to extend the timeframe we have.”
- ARGdov 8:34 PM: "and its literally a glitch”
- ARGdov 8:34 PM: "song of inverted time”
- ARGdov 8:34 PM: "would extend the time frame”
- IsocelesAssassin 8:34 PM: "It’s not yet time to tear it all down.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:34 PM: "ɢʟɪᴛᴄʜɪɴɢ ʀᴇᴀʟɪᴛʏ ᴡɪᴛʜ ᴠɪᴅᴇᴏ ɢᴀᴍᴇ ʜᴀᴄᴋs sᴏᴜɴᴅs ʟɪᴋᴇ ᴀ ʙᴀᴅ ᴘʟᴀɴ ᴛᴏ ᴍᴇ.”
- otherLiam 8:34 PM: “The song of inverted time slows down time.”
- ARGdov 8:34 PM: "without us glitching reality even more”
- ARGdov 8:34 PM: "yeah”
- Xenquility 8:35 PM: "If we posted song of inverted time, it would slow down their time by 50% (At least if we posted the 3DS version). Then it’d take 6 days of our time to make up for the 3 day advantage they have”
- ARGdov 8:35 PM: "it slows down time for them”
- ARGdov 8:35 PM: "but not for us”
- otherLiam 8:35 PM: ”(it does the same thing on n64 xen)”
- ARGdov 8:35 PM: “…advantage?”
- Xenquility 8:35 PM: "n64 is 30%”
- otherLiam 8:35 PM: "Really?”
- otherLiam 8:35 PM: "Huh.”
- Xenquility 8:35 PM: "Yee”
- Jos 8:35 PM: "help with the audio”
- otherLiam 8:35 PM: “til”
- Slinky stinks 8:35 PM: “im trying”
- otherLiam 8:35 PM: “And ok, no 4th day.”
- Slinky stinks 8:35 PM: “audio stuff”
- Jos 8:36 PM: “i just wanted to know the name of the zelda song”
- otherLiam 8:36 PM: “hang on lemme listen”
- Xenquility 8:36 PM: “Sounds like elegy of emptiness?”
- Slinky stinks 8:37 PM: “bruh imagine it was that”
- Xenquility 8:37 PM: “Sounds like 12-16ish seconds into elegy”
- ARGdov 8:37 PM: “it does sound a bit like elegy”
- Xenquility 8:37 PM: “wait wrong time stamp”
- Slinky stinks 8:38 PM: “.yt elegy of emptyness”
- NotSoBotBOT 8:38 PM: “ELEGY OF EMPTYNESS.wmv - YouTube Jun 18, 2018 … Ben the statue haunt the Game Majora’s Mask .. it is invoked thanks to the hymn of emptiness. Music : Elegy OF Emptiness For: Invoked ben … <a href="https://www.youtube.com/watch?v=dMUNEt9agKs">https://www.youtube.com/watch?v=dMUNEt9agKs</a> YouTube M a r g o t C h a p y ELEGY OF EMPTYNESS.wmv”
- Xenquility 8:38 PM: “19-24”
- Xenquility 8:38 PM: “BOI”
- otherLiam 8:38 PM: “What have you done.”
- Slinky stinks 8:38 PM: "NOOOBOOBOBO”
- Xenquility 8:38 PM: "YOU LITERALLY SHOULDNT HAVE DONE THAT”
- IsocelesAssassin 8:38 PM: "Well done.”
- Slinky stinks 8:38 PM: "it was for a comparation”
- Slinky stinks 8:38 PM: "NOOOOOOOO”
- otherLiam 8:38 PM: "How have you done this two nights in a row.”
- otherLiam 8:38 PM: "Slinky is now banned from everything.”
- Slinky stinks 8:38 PM: "NOOOOO”
- Slinky stinks 8:38 PM: "ah shit”
- ARGdov 8:38 PM: "WHAT THE FUCK”
- Slinky stinks 8:38 PM: "shiiiiit”
- Jos 8:38 PM: "why slinky”
- Xenquility 8:38 PM: "we”
- Xenquility 8:38 PM: "are”
- Xenquility 8:38 PM: "fucked”
- Slinky stinks 8:39 PM: "IM SO SORRY”
- ARGdov 8:39 PM: "guys”
- otherLiam 8:39 PM: "What does this even do?”
- ARGdov 8:39 PM: "WE LITERALLY JUST SPENT THE PAST 20 MINUTES TALKING ABOUT HOW WE CAN SUBMIT SONGS IN CHAT”
- Slinky stinks 8:39 PM: "NOOOO SORRYYYY”
- ARGdov 8:39 PM: "god”
- Slinky stinks 8:39 PM: "I DIDNT REALIZEEEED”
- ARGdov 8:39 PM: "you guys are impossible”
- Slinky stinks 8:39 PM: "okay im so sorry”
- otherLiam 8:39 PM: "lay off dude”
- ARGdov 8:40 PM: "its not just you, lol”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:40 PM: "ɪ ᴛʜɪɴᴋ”
- Slinky stinks 8:40 PM: "i didnt noticed”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:40 PM: "ᴛʜᴀᴛ ᴍᴀʏ ʜᴀᴠᴇ ʙᴇᴇɴ ᴀ ʜᴜɢᴇ ᴍɪsᴛᴀᴋᴇ.”
- Slinky stinks 8:40 PM: "i tried to do a coparation playing both at the same time”
- otherLiam 8:40 PM: "No shit.”
- Slinky stinks 8:40 PM: "oh my god sorry”
- Slinky stinks 8:40 PM: "i mean”
- Slinky stinks 8:40 PM: "he was already around rigth?”
- Jos 8:40 PM: "use your web browser”
- otherLiam 8:41 PM: "GB you might not know but Elegy of Emptiness is like, the second most evil song we’ve encountered.”
- ARGdov 8:41 PM: "you can just google it in your web browsser”
- ARGdov 8:41 PM: "GB knows it well enough I’d say”
- Slinky stinks 8:41 PM: "aaah shit”
- Slinky stinks 8:41 PM: "sorry”
- Xenquility 8:41 PM: "welp prepare for everything to go to shit”
- Xenquility 8:41 PM: "If anyone knocks on your door”
- Slinky stinks 8:41 PM: "shit”
- Xenquility 8:41 PM: "Don’t answer”
- Slinky stinks 8:42 PM: "its not the pizza”
- Slinky stinks 8:42 PM: "okay im sorry, im stupid, in my defense, i cant say anything”
- Slinky stinks 8:42 PM: "so i’ll just say sorry and accept my fate”
- Slinky stinks 8:42 PM: "oh i just looked at the description of the video”
- Slinky stinks 8:42 PM: "the first line is just”
- Slinky stinks 8:42 PM: "Elegy OF Emptiness For: Invoked ben”
- Slinky stinks 8:42 PM: "oh damn”
- IsocelesAssassin 8:44 PM: "Perhaps Greth was right about there being a traitor among you.”
- ARGdov 8:44 PM: "I hope not”
- Jos 8:45 PM: "what about helping me investigate the page before ben comes out”
- Slinky stinks 8:45 PM: "if you guys are pointing @ me, im sorry, dont purge me in a fire pls”
- ARGdov 8:45 PM: "you wont be.”
- Slinky stinks 8:45 PM: "okay i’ll try to do the links + the latin stuff”
- ARGdov 8:45 PM: "but you also now have the honor of being reminded of this all the time”
- Slinky stinks 8:46 PM: "oh shit”
- Slinky stinks 8:46 PM: "are these my bomb plans rigth”
- Xenquility 8:46 PM: "no these are worse”
- ARGdov 8:46 PM: "yes.”
- Slinky stinks 8:46 PM: "fuck”
- Xenquility 8:46 PM: "like”
- Xenquility 8:46 PM: "much worse”
- Slinky stinks 8:46 PM: "oaky im just gonna do some link stuff before the bad guy shows up”
- otherLiam 8:48 PM: "Slinky’s not a traitor. He’s just a kid.”
- Slinky stinks 8:48 PM: "thank you :,D”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:48 PM: "ʜᴇ’s ᴀʟsᴏ ᴀ ᴍᴀssɪᴠᴇ ꜰᴜᴄᴋ ᴜᴘ. ᴄʜᴇᴄᴋ ᴛʜᴇ ᴡᴇʙsɪᴛᴇ.”
- otherLiam 8:48 PM: "Though knowing you thought we had a traitor would’ve been nice.”
- Slinky stinks 8:48 PM: "oh shit”
- Xenquility 8:48 PM: "Welp fuck”
- Slinky stinks 8:49 PM: "it shows up the same to me”
- Slinky stinks 8:49 PM: "okay now it shows up nothing”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:49 PM: ((A screenshot of the now offline Astral Observatory website is posted))
- Slinky stinks 8:49 PM: "okay”
- Slinky stinks 8:49 PM: "i fucked up the AO”
- Slinky stinks 8:49 PM: "shit”
- ARGdov 8:49 PM: "well shit.”
- Jos 8:50 PM: "You know how much will this alert nocta?”
- Jos 8:50 PM: "he will have a heart attack at this rate”
- Jos 8:50 PM: "he is cyring right now on a corner”
- Slinky stinks 8:50 PM: "even my friends call me dumbass”
- Jos 8:50 PM: "hey new path lets heart attack nocta”
- IsocelesAssassin 8:51 PM: "I sincerely didn’t believe it was possible for the Astral Observatory to go any further to shit but alas.”
- Jos 8:51 PM: "goodbye the closer page”
- IsocelesAssassin 8:51 PM: "Even I have no clue what effect this will have.”
- otherLiam 8:51 PM: "Nobody would. I don’t think the Elegy has ever been played.”
- Jos 8:52 PM: "thanks god i download everything”
- otherLiam 8:53 PM: "Well this is a good time to ask”
- otherLiam 8:53 PM: "IA, did you all kill Tenebris in your timeline?”
- Jos 8:53 PM: "see if you guys can find the next forbidden page”
- ARGdov 8:53 PM: ”…probably not if this is a bad thing?”
- Slinky stinks 8:53 PM: “oh yeah i forgot we had questions for IA”
- Slinky stinks 8:53 PM: "ill try some stuff jos”
- IsocelesAssassin 8:54 PM: "You’re referring to the vote back on Youshouldnthavedonethat.net, correct?”
- ARGdov 8:54 PM: "yes”
- otherLiam 8:54 PM: "yes”
- ARGdov 8:55 PM: "Im fairly certain thats not the "big” difference in our two timelins but still”
- ɢʜᴏsᴛʙᴀʙᴇʟ 8:55 PM: “ᴜɴᴛɪʟ ᴛʜᴇ sɪᴛᴇ ɪs ʙᴀᴄᴋ ᴏɴʟɪɴᴇ ɪ ɴᴏ ʟᴏɴɢᴇʀ ʜᴀᴠᴇ ᴀ ᴘᴜʀᴘᴏsᴇ ʜᴇʀᴇ. ɪ ᴡɪʟʟ ʀᴇᴛᴜʀɴ ᴡʜᴇɴ ᴛʜᴇ ɴᴇᴡs ɪs ʙᴇᴛᴛᴇʀ ʜᴏᴘᴇꜰᴜʟʟʏ.”
- ARGdov 8:55 PM: "godspeed”
- ARGdov 8:55 PM: "at least we cant fuck you over, I guess. “
- ARGdov 8:55 PM: ”(oh wait your a murderous entity rip)”
- Jos 8:55 PM: “look on nocta side, we just destroyed everything on his site and ben might be bitting his ass”
- ARGdov 8:55 PM: "not necesarily”
- Jos 8:56 PM: "might”
- IsocelesAssassin 8:56 PM: "We voted to kill.”
- ARGdov 8:56 PM: "thats what I thought”
- ARGdov 8:56 PM: "we do have other questions though”
- ARGdov 8:56 PM: "well, I do anyways”
- ARGdov 8:56 PM: "what was your relationship with Tyler like?”
- IsocelesAssassin 8:58 PM: "Tyler was very distant after some of us failed to explain the situation to him.”
- IsocelesAssassin 8:58 PM: "This was back in 2015.”
- IsocelesAssassin 8:58 PM: "He believed we were responsible for Johnisdead.com and were simply trolls.”
- Xenquility 8:59 PM: "Was he never told to go to Kevin’s?”
- ARGdov 9:00 PM: "right ok”
- ARGdov 9:00 PM: "so that matches up with us”
- IsocelesAssassin 9:00 PM: "He was, which was when he was captured by the cult.”
- ARGdov 9:00 PM: "did you get him out?”
- Slinky stinks 9:00 PM: "that also matches”
- IsocelesAssassin 9:01 PM: "Yes. If I recall it was thanks to the usage of the Song of Soaring and the Stone Mask.”
- otherLiam 9:01 PM: "Yknow, we have the timelines. We could just have IA skim them and tell us what’s different. Not like anyone has anything else to do, while whatever happens happens.”
- Slinky stinks 9:01 PM: "that would be kinda cheating”
- ARGdov 9:01 PM: ”…..”
- Slinky stinks 9:01 PM: “idk”
- Slinky stinks 9:01 PM: "the timelines are not canon”
- ARGdov 9:01 PM: "wait is that what we did? Im assuming so”
- IsocelesAssassin 9:02 PM: "If your timeline is anything like ours, these timelines would be rather large.”
- ARGdov 9:02 PM: "yeah”
- ARGdov 9:02 PM: "you dont have the time”
- ARGdov 9:02 PM: "ok, one other question”
- ARGdov 9:02 PM: "in our timeline, Greth was stalked and haunted by someone possesed by Patrem and forcibly became his new host”
- ARGdov 9:02 PM: "seeing as our Greth eventually left our timeline it seems unlikely that happened to yours, correct?”
- IsocelesAssassin 9:04 PM: "Yes, I know Patrem dwells within your Greth. And you’re correct, Greth in our timeline never became his host.”
- Xenquility 9:04 PM: "Who did?”
- ARGdov 9:04 PM: "that is a good question”
- ARGdov 9:04 PM: "but ok, I suspected as much”
- IsocelesAssassin 9:05 PM: "I can’t tell you that.”
- ARGdov 9:05 PM: "I’ve been wondering what exactly was different in your timeline”
- IsocelesAssassin 9:05 PM: "Or rather, I feel it’d be a bad idea.”
- Jos 9:05 PM: "It’s stuff you must not know until it happens, time line stuff i guess”
- ARGdov 9:05 PM: "and it seems that other than that and are names being quite different”
- otherLiam 9:05 PM: "Because you think a traitor’s among us?”
- ARGdov 9:05 PM: "things are more or less the same”
- Jos 9:05 PM: "that too”
- Xenquility 9:05 PM: "A bad idea as in it would get you hurt, or make us suspicious of something?”
- IsocelesAssassin 9:06 PM: "Both, in a way.”
- IsocelesAssassin 9:06 PM: "Also, Greth certainly believed there to be a traitor, and I can understand why he did.”
- ARGdov 9:06 PM: "well, that’s great to know”
- otherLiam 9:06 PM: "Did he have any leads on who it was?”
- ARGdov 9:07 PM: "at least one of us can joke, I guess”
- Slinky stinks 9:07 PM: "also”
- Slinky stinks 9:07 PM: "IA, so you know wo is yugi?”
- Jos 9:07 PM: "lets be positive, maybe this is just all nocta locking up the site for repairs”
- IsocelesAssassin 9:07 PM: "Again, that’s something I can’t say yet.”
- IsocelesAssassin 9:07 PM: "In reference to who the traitor is.”
- ARGdov 9:07 PM: "thats true, we dont know who the heck yugi is”
- ARGdov 9:07 PM: “oh, I hate to keep bombarding you with this shit but one last thing”
- Jos 9:07 PM: "dov”
- Jos 9:07 PM: "it might be you”
- ARGdov 9:08 PM: "we heard talk of a ritual getting performed a few days ago”
- Jos 9:08 PM: "because you like yugioh”
- ARGdov 9:08 PM: "any idea what that was?”
- IsocelesAssassin 9:08 PM: "Just as Greth said, Yugi was a newcomer in the Internet Detectives. A Spanish user.”
- ARGdov 9:08 PM: ”…that is ture”
- Slinky stinks 9:08 PM: “he was spanish”
- Jos 9:08 PM: "ah”
- ARGdov 9:08 PM: "that, however, is not true”
- ARGdov 9:08 PM: "Im not spanish”
- Slinky stinks 9:08 PM: "or are you??????!?!?!?!”
- Jos 9:08 PM: "waito”
- otherLiam 9:08 PM: ”>newcomer”
- otherLiam 9:08 PM: “>spanish”
- otherLiam 9:08 PM: "Hi Slinky.”
- ARGdov 9:08 PM: "lets all chill.”
- Jos 9:08 PM: "IA”
- Slinky stinks 9:08 PM: "vsauce theme starts playing”
- Jos 9:08 PM: "do you know if José was around?”
- Jos 9:08 PM: "We lost contact with him when he found JId servers”
- Slinky stinks 9:09 PM: "nah, he was a newcomer around 2016”
- Slinky stinks 9:09 PM: "wait the jose on AO is not jos?”
- otherLiam 9:09 PM: "oh, archives guy.”
- Slinky stinks 9:09 PM: "oooh”
- Slinky stinks 9:09 PM: "that jose”
- Xenquility 9:09 PM: "jose as in archives guy”
- Slinky stinks 9:09 PM: "was he Beta jos?”
- Jos 9:09 PM: "i think so”
- ARGdov 9:09 PM: "guyslets stop speculating”
- ARGdov 9:09 PM: "please”
- ARGdov 9:09 PM: "im going to ask again”
- Slinky stinks 9:10 PM: "can i use the phrase?”
- ARGdov 9:10 PM: "the RITUAL”
- otherLiam 9:10 PM: "Slinky you can’t use anything rn.”
- ARGdov 9:10 PM: "did you hear about anything like that happening a few days ago?”
- ARGdov 9:10 PM: "That seems a little more important than "someone might end up stabbing us in the back, in the future"”
- IsocelesAssassin 9:10 PM: "I don’t ever recall José appearing at all. If I’m remembering correctly, the Lunar Children site remained inactive after 2016 or so.”
- ARGdov 9:10 PM: "at least in terms of chronology”
- Slinky stinks 9:11 PM: "yugi is pako”
- Slinky stinks 9:11 PM: "jk”
- Jos 9:11 PM: "slinky stop at once please”.
- Slinky stinks 9:11 PM: "yeah sorry”
- IsocelesAssassin 9:11 PM: "I haven’t heard of any ceremony taking place, though those are a dime a dozen, as I’m sure you all know.”
- ARGdov 9:11 PM: "well, not necesarily”
- ARGdov 9:11 PM: "but I suppose its not surprising”
- Jos 9:11 PM: "Probalbt its for the inner circle only”
- ARGdov 9:11 PM: "we were in a call recently”
- IsocelesAssassin 9:11 PM: "Relatively speaking knowing our circumstances.”
- ARGdov 9:12 PM: "someone, potentially our universes Tyler, spoke to us, and said he had a "ritual he had to get to"”
- ARGdov 9:12 PM: "he also stated that things were about to get 'more complicated’ and we wouldnt be able to talk to him like that for awhile”
- ARGdov 9:12 PM: "well, we dont know if it was tyler”
- Jos 9:12 PM: "to purge his bad side or something like that”
- IsocelesAssassin 9:12 PM: "Tyler spoke to you?”
- ARGdov 9:12 PM: "he kept trying to tell us and it kept cutting off”
- Jos 9:12 PM: "also thanks for replying my question”
- Jos 9:12 PM: ”:p”
- ARGdov 9:12 PM: “he kept saying, everytime we asked”
- otherLiam 9:12 PM: "Well, we aren’t sure if it’s Tyler.”
- ARGdov 9:12 PM: ”“no Im anot-"”
- ARGdov 9:12 PM: "and then it got cut off”
- ARGdov 9:12 PM: "we’re not sure who it was”
- ARGdov 9:12 PM: "but he did call us "old friends"”
- ARGdov 9:12 PM: "we still dont know what was going on there”
- IsocelesAssassin 9:13 PM: "Interesting.”
- otherLiam 9:13 PM: "That person “waking up” was another accidental play by Slinky. He asked us to remove someone from the room he was in and we obliged, then spoke to us.”
- IsocelesAssassin 9:13 PM: "I haven’t heard anything about this.”
- ARGdov 9:13 PM: "well, not before turning said person invisible”
- IsocelesAssassin 9:13 PM: "Considering Tyler’s current situation, that’s very odd.”
- ARGdov 9:13 PM: "and yeah, I wouldnt think so”
- ARGdov 9:13 PM: "and yeah, thats what we think as well”
- otherLiam 9:13 PM: "What’s Tyler’s situation?”
- ARGdov 9:13 PM: "we’re not sure who it was”
- ARGdov 9:13 PM: "kidnapped by a cult in another dimension”
- ARGdov 9:13 PM: "thats the situation”
- IsocelesAssassin 9:14 PM: "Essentially.”
- otherLiam 9:14 PM: "Is there more about that situation that you know?”
- ARGdov 9:15 PM: "I mean, we know he was kidnapped, put into a catatonic state, seemingly, and is being held for use during the 11/11 ritual to summon luna, presumably”
- ARGdov 9:15 PM: ”(which suggests the other universe’s Tyler may in fact be dead? dunno)”
- IsocelesAssassin 9:16 PM: “I don’t know the exact specifics as details are scarce. Nocta has been playing it a lot more safely as of late.”
- IsocelesAssassin 9:16 PM: "I only know that Tyler is being held somewhere until further notice.”
- ARGdov 9:16 PM: "exactly”
- ARGdov 9:16 PM: "it seems unlikely that that was tyler, then”
- IsocelesAssassin 9:17 PM: "At least, that’s what I’ve been able to decipher from what information I’ve been able to get a hold of.”
- ARGdov 9:17 PM: "right”
- Xenquility 9:17 PM: "Isoceles, any chance you could help us with a cipher?”
- IsocelesAssassin 9:18 PM: "Solve it yourself, "adventurer”.”
- Slinky stinks 9:18 PM: “….”
- ARGdov 9:18 PM: "pff”
- Xenquility 9:18 PM: "Harsh”
- otherLiam 9:18 PM: "Holy fuck what a put-down”
- ARGdov 9:18 PM: "thats some great shade ngl”
- IsocelesAssassin 9:18 PM: "I can’t spoonfeed you and time is scarce.”
- ARGdov 9:19 PM: "ok”
- ARGdov 9:19 PM: "is there anything else you want to tell us?”
- Xenquility 9:19 PM: "Why doesn’t our timeline have an astral observatory, if the same events in the truth arc played out in the beta timeline?”
- IsocelesAssassin 9:20 PM: "Only what I’ve told you all in the past.”
8/23/19 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:51 PM: “ʜᴇʟʟᴏ ᴛʜᴇʀᴇ.”
- otherLiam 10:52 PM: "Good evening.”
- Jos 10:52 PM: "Hey hi”
- Jos 10:52 PM: "Sadly I must go to sleep, or in computer terms, drop the ram lol, goodnight”
- otherLiam 10:53 PM: "How’re you holding up? Hopefully the Elegy fiasco didn’t put you in any danger.”
- otherLiam 10:53 PM: "gnight Jos.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:53 PM: "ᴅᴇsᴘᴀɪʀ ɴᴏᴛ ʏᴇ ᴍᴏʀᴛᴀʟs, ɪ ʜᴀᴠᴇ ʀᴇᴛᴜʀɴᴇᴅ ᴡɪᴛʜ ᴘᴜʀᴘᴏsᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:53 PM: "ᴀɴᴅ ɢᴏᴏᴅ ɴɪɢʜᴛ, ᴊᴏs.”
- otherLiam 10:54 PM: "Well that sounds good. I for one was despairing pretty hard.”
- otherLiam 10:54 PM: "So if you’ve got some good news that’d be great.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:55 PM: "ɴᴏ. ᴛʜᴀᴛ ɪs ᴡʜʏ ɪ ᴀᴍ ʜᴇʀᴇ ᴛʜᴏᴜɢʜ. ɪ ᴅᴇᴄɪᴅᴇᴅ ɴᴏᴛ ᴛᴏ ʙᴇ sᴏ ᴘᴀssɪᴠᴇ ɪɴ ᴛʜᴇsᴇ ᴇᴠᴇɴᴛs, sɪɴᴄᴇ ɪ ꜰᴀᴄᴇᴅ ᴀ ʟᴏɢɪᴄᴀʟ ǫᴜᴀɴᴅʀʏ ᴀꜰᴛᴇʀ ᴅᴀʏᴅʀᴇᴀᴍɪɴɢ– ᴍʏ ᴘᴜʀᴘᴏsᴇ ɪɴ ʏᴏᴜʀ ǫᴜᴇsᴛ, ᴀs ᴘʀᴏᴍɪsᴇᴅ, ɪs ᴛᴏ ʜᴇʟᴘ ʏᴏᴜ sᴏʟᴠᴇ ᴛʜᴇ ᴛʀᴏᴜʙʟᴇs ᴏɴ ᴀᴏ sᴏ ʏᴏᴜ ᴄᴀɴ ʙʀᴇᴀᴋ ɪɴᴛᴏ ᴛʜᴇ ᴛʀᴜᴛʜ ᴀɴᴅ ᴡᴏʀᴋ ᴛᴏᴡᴀʀᴅs ʏᴏᴜʀ ɢʀᴇᴀᴛᴇʀ ɢᴏᴀʟ ᴏꜰ sᴛᴏᴘᴘɪɴɢ ᴍᴏᴏɴ ᴄᴜʟᴛ ᴀᴄᴛɪᴠɪᴛʏ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:55 PM: "sᴏ ɪ ᴄᴀᴍᴇ ᴛᴏ ᴛʜᴇ ᴄᴏɴᴄʟᴜsɪᴏɴ ᴛʜᴀᴛ ᴜʟᴛɪᴍᴀᴛᴇʟʏ ʜᴇʟᴘɪɴɢ ʏᴏᴜ ᴏᴜᴛ ɪɴ ᴛʜɪs ᴄɪʀᴄᴜᴍsᴛᴀɴᴄᴇ ᴀs ᴡᴇʟʟ ᴡᴀs ᴘʀᴏʙᴀʙʟʏ ᴘᴀʀᴛ ᴏꜰ ᴛʜᴀᴛ ɢᴏᴀʟ, ᴜʟᴛɪᴍᴀᴛᴇʟʏ. ɴᴏ ᴄᴀᴛᴄʜ, ɴᴏ ᴛʀᴀᴅᴇs. ᴊᴜsᴛ ᴘᴀʀᴛ ᴏꜰ ᴛʜᴇ ꜰɪʀsᴛ ᴅᴇᴀʟ. sᴏ ɪ ᴅɪᴅ sᴏᴍᴇ ᴅɪɢɢɪɴɢ.”
- otherLiam 10:56 PM: "Appreciate you taking that on. What did you find?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:57 PM: "ɪsᴏᴄᴇʟᴇs ᴀɴᴅ ɪ ᴄʜᴇᴄᴋᴇᴅ ɪɴᴛᴏ ᴀ ꜰᴇᴡ ᴛʜɪɴɢs. ɪ'ᴍ ʟᴇss ᴏꜰ ᴀɴ ᴇxᴘᴇʀᴛ ɪɴ ᴛʜᴇ ᴍᴀᴛᴛᴇʀs ᴏꜰ ɪʟʟᴏɢɪᴄᴀʟ ᴇʟᴅʀɪᴛᴄʜ ɴᴇʀᴅ ᴍᴀɢɪᴄ, ʙᴜᴛ ʜᴇ sᴏʀᴛ ᴏꜰ ɪs ᴛʜʀᴏᴜɢʜ ᴛʀɪᴀʟ, ᴇʀʀᴏʀ, ᴀɴᴅ ᴇxᴘᴇʀɪᴇɴᴄᴇ. sᴏ ᴡᴇ ᴀsᴋᴇᴅ ᴀʀᴏᴜɴᴅ ᴡɪᴛʜ sᴏᴍᴇ ᴏꜰ ᴏᴜʀ ᴏᴛʜᴇʀ ᴀʟʟɪᴇs ᴀɴᴅ ᴅɪᴅ sᴏᴍᴇ ʀᴇsᴇᴀʀᴄʜ.”
- otherLiam 10:58 PM: "I don’t suppose someone had a perfect solution to fix both our temporal fuck-up and whatever the Elegy did?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:59 PM: "ɪ ᴀssᴜᴍᴇ ᴀᴛ sᴏᴍᴇ ᴘᴏɪɴᴛ ʏᴏᴜ ᴡɪʟʟ ᴀsᴋ ᴀʙᴏᴜᴛ ᴏᴜʀ ᴏᴛʜᴇʀ ᴀʟʟɪᴇs, ɪ ᴀᴍ ɴᴏᴡ ʀᴇᴀʟɪᴢɪɴɢ, sɪɴᴄᴇ ʏᴏᴜ ᴀʟʟ ᴄʀᴀᴠᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ, ʙᴜᴛ ᴡᴇ'ʟʟ sᴀᴠᴇ ᴛʜᴀᴛ sᴜʙᴊᴇᴄᴛ ꜰᴏʀ ɴᴏᴡ.”
- otherLiam 10:59 PM: "I certainly want to know, but I wasn’t going to pry. Especially when there’s something more pressing.”
- otherLiam 10:59 PM: "The information we really need right now is knowing what the damage is, basically. The Elegy’s never been played. We don’t even know how fucked we are right now, and we need to know that in order to un-fuck ourselves.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:03 PM: "ᴛᴏ ʙᴇ ǫᴜɪᴛᴇ ʜᴏɴᴇsᴛ, ᴡᴇ ʜᴀᴠᴇ ɴᴏ ɪᴅᴇᴀ ᴡʜᴀᴛ ᴛʜᴇ ᴇʟᴇɢʏ ᴅɪᴅ. ɪᴛ ᴄᴇʀᴛᴀɪɴʟʏ ᴄᴀᴜsᴇᴅ ᴛʜᴇ sʜᴜᴛᴅᴏᴡɴ ᴏɴ ᴛʜᴇ ᴏʙsᴇʀᴠᴀᴛᴏʀʏ sɪᴛᴇ, ʙᴜᴛ ᴛʜᴀᴛ ᴡᴀs ᴍᴏʀᴇ ᴄɪʀᴄᴜᴍsᴛᴀɴᴛɪᴀʟ. ᴛʜᴀᴛ sᴛᴀsɪs ᴛʜᴀᴛ ᴛʜᴇ sɪᴛᴇ ɪɴ ᴡᴀs ɪɴ ɪᴛsᴇʟꜰ ᴘᴏᴡᴇʀꜰᴜʟ ᴍᴀɢɪᴄ, ᴏʀ ᴡʜᴀᴛ ʜᴀᴠᴇ ʏᴏᴜ– ʙᴜᴛ ᴡʜᴀᴛᴇᴠᴇʀ ᴇɴᴅᴇᴅ ᴜᴘ ʜᴀᴘᴘᴇɴɪɴɢ ᴡɪᴛʜ ᴛʜᴇ ᴇʟᴇɢʏ sᴏɴɢ ɪs ᴘʀᴏʙᴀʙʟʏ sᴏᴍᴇᴛʜɪɴɢ ᴍᴏʀᴇ sɪɴɪsᴛᴇʀ. ᴛʏᴘɪᴄᴀʟʟʏ, ᴛʜᴇ ᴇʟᴇɢʏ sᴏɴɢ ɪɴ ᴛʜᴇ ɢᴀᴍᴇ ᴄʀᴇᴀᴛᴇs ᴀ ᴄʟᴏɴᴇ sᴛᴀᴛᴜᴇ ᴏꜰ ᴛʜᴇ ᴘʟᴀʏᴇʀ ᴡʜᴏ ᴘʟᴀʏs ɪᴛ, ᴄᴏʀʀᴇᴄᴛ? ʙᴜᴛ ᴛʜᴀᴛ ᴅᴏᴇsɴ'ᴛ sᴇᴇᴍ ᴛᴏ ʙᴇ ʜᴏᴡ ɪᴛ ᴡᴏʀᴋs ɪɴ ʀᴇᴀʟɪᴛʏ, ᴏᴛʜᴇʀᴡɪsᴇ ɪ'ᴍ sᴜʀᴇ sʟɪɴᴋʏ ᴡᴏᴜʟᴅ ʜᴀᴠᴇ sᴀɪᴅ sᴏᴍᴇᴛʜɪɴɢ ᴀʙᴏᴜᴛ ᴀ ᴡᴇɪʀᴅ sᴛᴀᴛᴜᴇ ɪɴ ʜɪs ʀᴏᴏᴍ. sᴏ ᴘᴇᴏᴘʟᴇ ᴋɴᴏᴡʟᴇᴅɢᴇᴀʙʟᴇ ᴀʙᴏᴜᴛ ᴛʜɪs sɪɴɪsᴛᴇʀ sᴏʀᴄᴇʀʏ sᴏʀᴛ ᴏꜰ ʜᴀᴠᴇ ᴛᴏ ʟᴏɢɪᴄ ʜᴏᴡ ᴛʜɪs ᴀᴄᴛᴜᴀʟʟʏ ᴀꜰꜰᴇᴄᴛs ᴏᴜʀ ʀᴇᴀʟɪᴛʏ. ᴡᴇʟʟ, ʀᴇᴀʟɪᴛɪᴇs, ɪ ɢᴜᴇss.
- Slinky stinks 11:04 PM: "I mean, no slinky statues here so…”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:04 PM: "ᴛʜᴀᴛ ʙᴇɪɴɢ sᴀɪᴅ, ʀɪɢʜᴛ ɴᴏᴡ ᴡᴇ ᴋɴᴏᴡ ᴛʜᴀᴛ ᴛʜᴇ sᴏɴɢ ᴄᴀᴜsᴇᴅ ᴛᴇʀʀɪʙʟᴇ ᴛʜɪɴɢs ɪɴ ᴛʜᴇ ᴘᴀsᴛ. sᴏ ᴜɴᴅᴇʀsᴛᴀɴᴅɪɴɢ ᴡʜᴀᴛ ʜᴀᴘᴘᴇɴᴇᴅ ᴍᴀʏ ɴᴇᴇᴅ sᴏᴍᴇ ᴅᴇᴄᴏɴsᴛʀᴜᴄᴛɪɴɢ ᴏꜰ ᴛʜᴏsᴇ ᴇᴠᴇɴᴛs. ᴡᴇ ᴀʀᴇ ʟᴏᴏᴋɪɴɢ ɪɴᴛᴏ ɪᴛ.”
- otherLiam 11:04 PM: "Yes, in the game it creates a statue that’s used to solve puzzles. Unfortunately, the entity which gave us these powers used that statue to represent itself when it was trapped in the game. So what it likely did instead was summon it.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ɪɴ ᴛʜɪs ᴅᴇᴇᴘ ᴅɪᴠᴇ ɪ ᴘᴇʀsᴏɴᴀʟʟʏ ᴍᴀʏ ʜᴀᴠᴇ ꜰᴏᴜɴᴅ ᴀ ᴡᴀʏ ᴛᴏ ʀᴇᴠᴇʀᴛ ᴛʜᴇ ᴡᴇʙsɪᴛᴇ, ʜᴏᴡᴇᴠᴇʀ.”
- otherLiam 11:05 PM: "Well that’s good news, at least. What needs to be done?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ᴛʜᴀᴛ’s ᴛʜᴇ ʙᴇsᴛ ɴᴇᴡs ꜰᴏʀ ʏᴏᴜ ᴀʟʟ. ɴᴏᴛʜɪɴɢ, ᴏɴ ᴏᴜʀ ᴇɴᴅ. ᴛʜɪs ɪs ᴀᴄᴛᴜᴀʟʟʏ sᴏᴍᴇᴛʜɪɴɢ ɪ ᴀᴍ ᴄᴀᴘᴀʙʟᴇ ᴏꜰ ᴅᴏɪɴɢ.”
- otherLiam 11:10 PM: "So we’d still have to fix the temporal fuck-up we made?”
- otherLiam 11:14 PM: "Then before we commit to this, let me just ask: we know the Astral Observatory website is down, and that it was previously in a state of temporal flux. What does that actually mean outside of the website, though? Are the people that post on the website actually effected by these things?”
- otherLiam 11:14 PM: "We only have this small window into that timeline, so it’s hard to know the scale of what actually happened.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:18 PM: "ᴡᴇʟʟ, ʏᴜᴜᴋɪ ɪs ᴛʜᴇ ᴍᴏsᴛ ᴀꜰꜰᴇᴄᴛᴇᴅ, sɪɴᴄᴇ sʜᴇ ᴡᴀs ᴀsᴄᴇɴᴅᴇᴅ. ɪ ʜᴀᴠᴇ ǫᴜɪᴛᴇ ᴀ ꜰᴀᴍɪʟɪᴀʀɪᴛʏ ᴡɪᴛʜ ᴛʀᴀᴠᴇʟɪɴɢ ᴛʜʀᴏᴜɢʜ ᴅᴀᴛᴀ ᴀɴᴅ ʙᴇɪɴɢ ᴛʜᴀᴛ sᴘɪʀɪᴛs ᴛᴇɴᴅ ᴛᴏ ʜᴀᴜɴᴛ ᴊᴏʜɴɪsᴅᴇᴀᴅ ᴀs ᴀsᴄᴇɴᴅᴇᴅ sᴏᴜʟs, ɪᴛ sᴇᴇᴍs ʏᴜᴜᴋɪ ɪs ᴍᴜᴄʜ ɪɴ ᴛʜᴇ sᴀᴍᴇ ᴡᴀʏ ᴘʀɪsᴏɴᴇʀ, ᴘᴇʀʜᴀᴘs ᴀs ᴀ sɪᴍᴘʟᴇ ʙɪɴᴅ ᴛᴏ ᴋᴇᴇᴘ ᴛʜᴇ ᴊᴏʜɴɪsᴅᴇᴀᴅ ᴄᴏɴɴᴇᴄᴛɪᴏɴ ᴏᴘᴇɴ; ᴛʜᴀᴛ ɪs ᴏɴʟʏ ᴀ ᴛʜᴇᴏʀʏ. ɢʀᴇᴛʜ ɪs ᴀʟsᴏ sᴇᴇᴍɪɴɢʟʏ ᴀꜰꜰᴇᴄᴛᴇᴅ. ɪ ᴡᴏᴜʟᴅ ɪᴍᴀɢɪɴᴇ ᴇᴠᴇʀʏᴏɴᴇ ᴇʟsᴇ ɪs ᴊᴜsᴛ ꜰʀᴜsᴛʀᴀᴛᴇᴅ ᴀɴᴅ ᴄᴏɴꜰᴜsᴇᴅ, ᴇᴠᴇɴ ɴᴏᴄᴛᴀ. ʏᴏᴜ ᴀʀᴇ sɪᴍᴘʟʏ sᴇᴇɪɴɢ ʙɪᴛs ᴏꜰ ᴀsᴛʀᴀʟ ᴏʙsᴇʀᴠᴀᴛᴏʀʏ ɪɴ ꜰʟᴜx. sᴏᴍᴇ ᴏꜰ ᴛʜɪs sᴛᴜꜰꜰ ɪs ꜰʀᴏᴍ ᴛʜᴇ ᴘᴀsᴛ, sᴏᴍᴇ ꜰʀᴏᴍ ᴛʜᴇ ᴘʀᴇsᴇɴᴛ, ᴀɴᴅ sᴏᴍᴇ ᴏꜰ ɪᴛ ɴᴇᴠᴇʀ ʜᴀᴘᴘᴇɴᴇᴅ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:18 PM: "ᴇxᴄᴇᴘᴛ ᴏꜰ ᴄᴏᴜʀsᴇ, ɪsᴏᴄᴇʟᴇs, ʜᴇ ᴄᴀɴ ᴍᴀɴᴇᴜᴇᴠᴇʀ sᴜᴄʜ ᴛᴇᴍᴘᴏʀᴀʟ ꜰʟᴜxᴇs ꜰᴀɪʀʟʏ ᴡᴇʟʟ ᴀɴᴅ ᴛʀɪᴇᴅ ᴛᴏ ᴍᴇssᴀɢᴇ ʏᴏᴜ ᴀʟʟ ᴛʜᴇʀᴇ ꜰɪʀsᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:18 PM: "ɪ ʙᴇʟɪᴇᴠᴇ ʏᴏᴜ sᴀᴡ ɪᴛ?”
- otherLiam 11:19 PM: "Yeah, we saw it. Basically telling us we messed up.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:21 PM: "ʏᴏᴜ ᴍᴀʏ ᴛʜɪɴᴋ ᴄɪʀᴄʟᴇʜᴜɴᴛᴇʀ ɪɴ ᴍʏ ᴛɪᴍᴇʟɪɴᴇ ɪs ᴀ ʙɪᴛ ʜᴀʀsʜ ʙᴜᴛ ʏᴏᴜ ʜᴀᴠᴇ ᴛᴏ ᴜɴᴅᴇʀsᴛᴀɴᴅ ʜɪs ᴘᴏsɪᴛɪᴏɴ. ʜᴇ’s ᴅᴇᴀʟᴛ ᴡɪᴛʜ ʏᴏᴜ ᴀʟʟ ᴍᴏʀᴇ ᴛʜᴀɴ ᴀɴʏᴏɴᴇ ᴇʟsᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:21 PM: "ᴡᴇʟʟ, ᴛʜᴀᴛ’s ɴᴏᴛ ᴛʀᴜᴇ ᴀᴄᴛᴜᴀʟʟʏ. ʙᴜᴛ ʏᴏᴜ ᴋɴᴏᴡ ᴡʜᴀᴛ ɪ ᴍᴇᴀɴ.”
- otherLiam 11:22 PM: "I can imagine dealing with us for an extended period of time could test anyone’s patience.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:23 PM: "ᴀɴʏᴡᴀʏs, ʏᴏᴜ ᴋɴᴏᴡ ᴛʜᴇ ᴘʀᴏᴘᴏsɪᴛɪᴏɴ. ɪᴛ’s ᴛʜᴇ ʙᴇsᴛ ɪ ᴄᴀɴ ᴅᴏ ᴀɴᴅ ɪ'ᴍ ʙᴇɪɴɢ ɢᴇɴᴜɪɴᴇ, ᴅᴇsᴘɪᴛᴇ ᴍʏ ᴇᴠᴇʀʏ ᴄᴇʟʟ sᴄʀᴇᴀᴍɪɴɢ ᴀᴛ ᴍᴇ ɪɴ ʀɪɢʜᴛᴇᴏᴜs ꜰᴜʀʏ ꜰᴏʀ ʙᴇɪɴɢ sᴏ ᴋɪɴᴅ.”
- Slinky stinks 11:24 PM: "Thank you Babel!”
- otherLiam 11:24 PM: "And yes, thank you very much for doing that work for us.”
- Slinky stinks 11:24 PM: "And yeah, it’s risky but it can turn out good too”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ᴀɴʏᴡᴀʏs ɪ ᴅᴏɴ'ᴛ ʙᴇʟɪᴇᴠᴇ ᴡᴀɪᴛɪɴɢ ᴏɴ ᴛʜɪs ɪᴅᴇᴀ ɪs ɢᴏᴏᴅ ᴇɪᴛʜᴇʀ. ʟᴏɴɢᴇʀ ᴛʜᴇ sɪᴛᴇ ɪs ᴅᴏᴡɴ ᴛʜᴇ ꜰᴀʀ ᴡᴏʀsᴇ ᴄʀᴇsᴄᴇɴᴛ ʜᴇᴀᴅ ɪs, ɪ'ᴅ ɪᴍᴀɢɪɴᴇ.”
- otherLiam 11:28 PM: "Yeah, we don’t really have another option, here.”
- ADULT_LINK 11:28 PM: "it sounds like its our only move so”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:29 PM: "ᴏᴋ ᴛʜᴇɴ, ɢᴇᴛ ʀᴇᴀᴅʏ.”
- otherLiam 11:29 PM: "Well… here’s hoping.”
- Slinky stinks 11:29 PM: ”:moony: let’s go”
- otherLiam 11:29 PM: “See you on the other side.”
- ADULT_LINK 11:29 PM: "best of luck”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:37 PM: ((A screenshot of the front page of Astral Observatory is posted))
- Slinky stinks 11:38 PM: "Yessss”
- otherLiam 11:38 PM: "Well, we’re back in it. For better or worse.”
- Slinky stinks 11:38 PM: "Still fucked tho, we have our thing”
- otherLiam 11:39 PM: "Yeah that’s what he said would happen.”
- Slinky stinks 11:39 PM: "Jos and I will try to discover the URLs”
- otherLiam 11:39 PM: "Jos is asleep.”
- Slinky stinks 11:39 PM: "Tho quick reminder it’s 5:40 now”
- Slinky stinks 11:39 PM: "So tomorrow”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:41 PM: "ɪꜰ ɪ ᴄᴏᴜʟᴅ ᴍᴀᴋᴇ ᴀ ʀᴇᴄᴏᴍᴍᴇɴᴅᴀᴛɪᴏɴ?”
- otherLiam 11:41 PM: "By all means.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:42 PM: "ᴅᴇsᴘɪᴛᴇ sᴏᴍᴇ ᴄʜᴀsᴛɪsɪɴɢ ᴡʜᴇɴ ᴡᴇ ꜰᴏᴜɴᴅ ᴛʜᴇ ᴡᴇʙsɪᴛᴇ ɪɴ ᴛʜɪs sᴛᴀᴛᴇ ɪɴɪᴛɪᴀʟʟʏ, ɪ ᴅɪᴅ sᴀʏ ʏᴏᴜ ᴡᴇʀᴇ ᴏɴ ᴛʜᴇ ʀɪɢʜᴛ ᴛʀᴀᴄᴋ. ʏᴏᴜ ʟᴏᴄᴀᴛᴇᴅ ᴍᴏᴏɴᴍᴀɴ ɪɴ ᴛʜᴇ sɪᴛᴇ, ᴏʀ ᴀᴛ ʟᴇᴀsᴛ sᴏᴍᴇ ꜰʀᴀɢᴍᴇɴᴛ ᴏꜰ ʜɪs ᴄᴏɴsᴄɪᴏᴜs… ɪ'ᴍ ɴᴏᴛ 100% ᴏɴ ʜᴏᴡ ᴛʜᴇsᴇ ᴛʜɪɴɢs ᴀʀᴇ ᴛᴇᴄʜɴɪᴄᴀʟʟʏ sᴘᴇᴀᴋɪɴɢ.”
- otherLiam 11:43 PM: "You think we can dig Moonman out of this flux before we fix it?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:44 PM: "ɪsᴏᴄᴇʟᴇs ᴍᴀʏ ʜᴀᴠᴇ ʙᴇᴇɴ ʟᴇss ᴇɴᴛʜᴜsᴇᴅ ʙᴜᴛ ɪ ᴀᴍ ᴍᴏʀᴇ ɢᴜᴇʀʀɪʟʟᴀ ɪɴ ᴍɪɴᴅsᴇᴛ ᴀɴᴅ ᴀᴘᴘʀᴏᴀᴄʜ. sᴏ ᴛʜᴇ sɪᴛᴇ ɪs ᴀ ʟɪᴛᴛʟᴇ ᴅɪsᴄᴏᴍʙᴏʙᴜʟᴀᴛᴇᴅ? ᴛɪᴍᴇ ɪs ᴏᴜᴛ ᴏꜰ sʏɴᴄ? ᴡᴇ ᴡᴇʀᴇ ᴀʙᴏᴜᴛ ᴛᴏ ᴘʟᴀʏ ᴀ sᴏɴɢ ᴡʜᴇɴ sᴏᴍᴇᴏɴᴇ ʀᴜɪɴᴇᴅ ᴛʜᴇ ᴏᴘᴘᴏʀᴛᴜɴɪᴛʏ. ʏᴏᴜ sʜᴏᴜʟᴅ ᴅᴏ ɪᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:44 PM: “ɪ ᴀᴍ ᴘʀᴇᴛᴛʏ ᴏꜰ ᴛʜᴇ ᴍɪɴᴅsᴇᴛ ᴛʜɪs ᴡᴀs ᴛʜᴇ ᴄᴏʀʀᴇᴄᴛ ᴄʜᴏɪᴄᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:44 PM: “ᴊᴜsᴛ ᴘʟᴀʏ ᴛʜᴇ ᴄᴏʀʀᴇᴄᴛ sᴏɴɢ.”
- otherLiam 11:46 PM: "We were considering playing the Inverted Song of Time, before the Elegy was played.”
- otherLiam 11:46 PM: "Would slowing down time really fix things?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:47 PM: "ɪ ᴄᴀɴ'ᴛ sᴀʏ ᴏɴᴇ ᴡᴀʏ ᴏʀ ᴛʜᴇ ᴏᴛʜᴇʀ. ʙᴜᴛ ᴛʜᴇʀᴇ’s ᴏɴʟʏ ᴏɴᴇ ᴡᴀʏ ᴛᴏ ꜰɪɴᴅ ᴏᴜᴛ ɪɴ ᴛʜɪs ᴄɪʀᴄᴜᴍsᴛᴀɴᴄᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:47 PM: "ᴛʜᴇ ᴇɴᴅ ʀᴇsᴜʟᴛ ᴍᴜsᴛ ʙᴇ ʙᴇᴛᴛᴇʀ ᴛʜᴀɴ ᴡʜᴇʀᴇ ᴡᴇ'ᴠᴇ ʙᴇᴇɴ ʙᴇꜰᴏʀᴇ ᴛʜɪs ᴀɴᴅ ɴᴏᴡ, ʜᴇʀᴇ, ᴀɢᴀɪɴ.”
- otherLiam 11:49 PM: "Is the site being in flux like this a time-sensitive issue? I’m not above using songs and items without consensus when the situation requires it, but usually we prefer to have everyone agree on using them before we do so, and everyone seems to be asleep right now.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:51 PM: "ɪ'ᴍ ᴘʀᴇᴛᴛʏ sᴜʀᴇ ɪ ʜᴀᴠᴇ ᴀʟᴡᴀʏs sᴛʀᴇssᴇᴅ ᴛʜᴀᴛ ᴛɪᴍᴇ ɪs ᴀɴ ɪssᴜᴇ ʙᴜᴛ ᴡʜᴇɴ ʏᴏᴜ'ᴠᴇ ʟɪᴛᴇʀᴀʟʟʏ ᴘᴜᴛ ɪᴛ ɪɴ ᴀ sᴛᴀᴛᴇ ᴏꜰ ᴄᴏɴꜰᴜsɪᴏɴ ɴᴇᴇᴅʟᴇss ᴛᴏ sᴀʏ ᴛʜᴀᴛ ꜰᴏʀᴍ ᴏꜰ ꜰᴀʟsᴇ sᴛᴀʙɪʟɪᴛʏ ᴡᴀɪᴛɪɴɢ ᴛᴏ sᴇᴇ ʜᴏᴡ ᴛʜɪɴɢs ᴘʟᴀʏs ᴏᴜᴛ sᴇᴇᴍs ʟɪᴋᴇ ᴀ ʙᴀᴅ ɪᴅᴇᴀ ᴛᴏ ᴍᴇ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:51 PM: "ʙᴜᴛ ᴅᴏ ᴡʜᴀᴛᴇᴠᴇʀ ʏᴏᴜ ꜰᴇᴇʟ ɪs ʙᴇsᴛ. ɪ ᴅɪᴅ ᴡʜᴀᴛ ɪ sᴀɪᴅ ɪ ᴡᴏᴜʟᴅ ꜰᴏʀ ᴛʜᴇ ᴅᴀʏ.”
- otherLiam 11:53 PM: "The hell with it, then.”
- otherLiam 11:53 PM: ((The Inverted Song of Time is posted))
- Slinky stinks 11:53 PM: "This is my jam”
8/24/19 - Chat with Moonman and GHOSTBABEL
- Slinky stinks 12:04 AM: “Tenebris is here already, we can’t undo that, and I’m sorry 4 that again, but we also opened the door for moonman right?”
- otherLiam 12:04 AM: "I don’t think so. He’s still trapped.”
- moonman31 12:04 AM: "No i’m not”
- Slinky stinks 12:04 AM: "Boom”
- otherLiam 12:04 AM: "Oh shit.”
- Slinky stinks 12:04 AM: "Plot twist”
- otherLiam 12:04 AM: "I also just saw your PM Moonman.”
- otherLiam 12:04 AM: "You’re welcome.”
- otherLiam 12:04 AM: "Good to see you back.”
- Slinky stinks 12:05 AM: "Yeah it’s nice to have you here again”
- otherLiam 12:06 AM: "How’re you feeling?”
- moonman31 12:06 AM: "To be honest not great”
- moonman31 12:06 AM: "I have had a strange time recently”
- otherLiam 12:07 AM: "Don’t overtax yourself, I imagine you’ve been through a lot. What exactly happened to you?”
- moonman31 12:07 AM: "Okay”
- moonman31 12:07 AM: "I am going to try and explain this best as I can so please don’t think I’m crazy”
- moonman31 12:07 AM: "Everything was fucking weird”
- moonman31 12:07 AM: "I can’t really explain it, but it was like I was exactly where I normally am, but also not.”
- moonman31 12:07 AM: "You can tell you’re in a different space, and then eventually you realize it’s a completely different place”
- moonman31 12:07 AM: "and then slowly reality becomes this nightmarish psychedelic vision of echoing traumas”
- moonman31 12:07 AM: "but also maybe not”
- moonman31 12:07 AM: "that is how I perceived it”
- moonman31 12:07 AM: "and it was terribl”
- ADULT_LINK 12:10 AM: "damn that sounds fucky”
- Slinky stinks 12:10 AM: "That sounds so bad”
- moonman31 12:10 AM: "At some point I heard a song”
- moonman31 12:10 AM: "it was really loud and then…”
- moonman31 12:10 AM: "something appeared”
- Slinky stinks 12:10 AM: "Oh yeah…”
- moonman31 12:10 AM: "I don’t know”
- moonman31 12:10 AM: "Actually that was the second time I heard a song”
- moonman31 12:10 AM: "the first time was soothing and I felt like I was being drawn back towards home”
- moonman31 12:10 AM: "but the second song just”
- Slinky stinks 12:11 AM: "I think i know what that may be, tho I can’t confirm it because I wasn’t there”
- moonman31 12:11 AM: "ripped shit asunder”
- moonman31 12:11 AM: "and i saw something”
- moonman31 12:11 AM: "and then it ran off into somewhere”
- moonman31 12:11 AM: "here maybe”
- moonman31 12:11 AM: "i don’t know”
- Slinky stinks 12:12 AM: "First of all, I’m sorry and then, I’m pretty sure that thing you saw was an statue”
- moonman31 12:12 AM: "That was no fucking statue”
- ADULT_LINK 12:12 AM: "lets not assume we know what he saw”
- Slinky stinks 12:12 AM: "As I said I can’t confirm it but..”
- Slinky stinks 12:12 AM: “Oh nvm”
- moonman31 12:12 AM: "well after that i continued to follow where the first had been leading me, but everything was moving too fast”
- moonman31 12:12 AM: "the third song that played made me realize it was all of you”
- moonman31 12:12 AM: "and i reached out you pulled me back here”
- Slinky stinks 12:14 AM: "Okay it kinda makes sense”
- Slinky stinks 12:14 AM: "The order of the songs”
- ADULT_LINK 12:15 AM: "sorry if we caused you any duress btw”
- otherLiam 12:15 AM: "That lines up with what we know.”
- otherLiam 12:15 AM: "The second song being the Elegy, and GB doing his giggery-pokery to bring AO back doing something similar.”
- moonman31 12:16 AM: "wait”
- Slinky stinks 12:17 AM: "Thank you for the info, and also sorry if we pushed you too much or something”
- moonman31 12:17 AM: "GB?”
- otherLiam 12:17 AM: "GhostBabel, yeah. You met him. I think you called him edgy and made fun of his font.”
- moonman31 12:17 AM: "it just”
- moonman31 12:17 AM: "makes me think of something i saw while i was there”
- otherLiam 12:18 AM: "What’s that?”
- moonman31 12:18 AM: "right before the last song was played i saw an image”
- ADULT_LINK 12:18 AM: "oh?”
- otherLiam 12:19 AM: "What of?”
- moonman31 12:19 AM: "IT’S ON MY DRIVE”
- moonman31 12:19 AM: "WHAT THE FUCK”
- Slinky stinks 12:20 AM: "That looks a lot like patrem but green”
- Slinky stinks 12:20 AM: "Just spitballing”
- otherLiam 12:21 AM: "Alright, easy Moonman. We’ll figure this out.”
- moonman31 12:21 AM: "shit man”
- Slinky stinks 12:22 AM: "Yeah that whole trip sounds so bad, hope you get better or something”
- otherLiam 12:22 AM: "They’re just trying to freak you out, man.”
- moonman31 12:22 AM: "ɪᴛ’s sɪᴍᴘʟᴇ, ɪ ᴡᴀs ᴅᴏɪɴɢ ᴡʜᴀᴛ ɪ ʜᴀᴅ ᴛᴏ ᴅᴏ ᴛᴏ ʙʀɪɴɢ ᴛʜᴇ sɪᴛᴇ ᴏɴʟɪɴᴇ. ᴅᴏɴ'ᴛ ɢᴇᴛ sᴏ ꜰʟᴜsᴛᴇʀᴇᴅ ʙʏ ᴍʏ ᴘʀᴇsᴇɴᴄᴇ ᴡʜᴇɴ ɪᴛ’s ʙᴇɴᴇꜰɪᴄɪᴀʟ.”
- moonman31 12:22 AM: "wljfhaslkdfg\”
- moonman31 12:22 AM: "i didnt type that”
- otherLiam 12:22 AM: "uhh.”
- otherLiam 12:22 AM: "Hi, GB.”
- ADULT_LINK 12:22 AM: "um”
- otherLiam 12:23 AM: "Cmon, don’t scare the guy right now.”
- ADULT_LINK 12:23 AM: "gb did you hack moonman?”
- moonman31 12:23 AM: "ʏᴏᴜ sʜᴏᴜʟᴅ ᴀʟʟ ʀᴇᴀʟɪᴢᴇ ᴛʜɪs ɪs ᴡʜᴀᴛ ɪ ᴅᴏ ʙʏ ɴᴏᴡ, ᴊᴜsᴛ ᴛʜᴏᴜɢʜᴛ ɪ'ᴅ ɪɴᴛᴇʀᴠᴇɴᴇ ʙᴇꜰᴏʀᴇ ᴀɴʏ ᴏɴᴇ ᴘᴏɪɴᴛᴇᴅ ꜰɪɴɢᴇʀs ᴜɴɴᴇᴄᴇssᴀʀɪʟʏ.”
- moonman31 12:23 AM: "this is really fucked”
- moonman31 12:23 AM: "and stop dele”
- otherLiam 12:23 AM: "Moonman, what you saw was GhostBabel trying to help you. That image is probably on your drive because, well… that’s where he is right now.”
- Slinky stinks 12:24 AM: "He is deleting his text while he types”
- moonman31 12:24 AM: "ɪ'ᴍ sᴛɪʟʟ ᴛʏᴘɪɴɢstop”
- otherLiam 12:24 AM: "Y’all. Take turns.”
- Slinky stinks 12:24 AM: "Babel why don’t you use your account? Moonman has been through a lot”
- ADULT_LINK 12:24 AM: "lmao at least warn the dude before you just start typing on his account”
- moonman31 12:24 AM: "eklfa;w;jflalwr56y”
- moonman31 12:24 AM: "i think he’s stopped for now”
- ADULT_LINK 12:25 AM: "you’re gonna scare him man”
- otherLiam 12:25 AM: "I think GB is currently inside moonman’s computer. Using his own account might not be an option.”
- otherLiam 12:25 AM: "You can relax though, Moonman. GB’s a large part of the reason we were able to get you out of there.”
- moonman31 12:25 AM: "motherfucker”
- moonman31 12:25 AM: "he took over chrome and put me on EDGE”
- moonman31 12:25 AM: "on my SECOND screen”
- otherLiam 12:26 AM: "Alright now that’s just cruel.”
- Slinky stinks 12:26 AM: "lol”
- otherLiam 12:26 AM: "At least give him Firefox.”
- ADULT_LINK 12:26 AM: "sorry he’s fuckin with you lmao”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:26 AM: "ᴛᴜᴛ ᴛᴜᴛ. ᴀᴛ ʟᴇᴀsᴛ ʏᴏᴜ ɢᴇᴛ ᴀ ʙʀᴏᴡsᴇʀ.”
- moonman31 12:26 AM: "fuck”
- Slinky stinks 12:26 AM: "Hello babel”
- otherLiam 12:27 AM: "Babel: Why are you in Moonman’s PC?”
- otherLiam 12:27 AM: "Moonman: Do you have any idea how you actually got into that state?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:27 AM: "ɪ ᴜsᴜᴀʟʟʏ ᴜsᴇ ᴍᴏʀᴇ ᴇʟᴏǫᴜᴇɴᴛ ʟᴀɴᴜᴀɢᴇ ʙᴜᴛ ᴡʜᴇɴ ᴡɪʟʟ ʏᴏᴜ ᴘᴇᴏᴘʟᴇ ʀᴇᴀʟɪᴢᴇ ɪ'ᴍ ᴀ ꜰᴜᴄᴋɪɴɢ ᴘsʏᴄʜᴏᴘᴀᴛʜ ᴡɪᴛʜ ᴀ ᴡᴇɪʀᴅ ʜᴏɴᴏʀ sʏsᴛᴇᴍ?”
- moonman31 12:27 AM: "I know it was nocta”
- moonman31 12:27 AM: "somehow”
- moonman31 12:27 AM: "or at least he coordinated it”
- Slinky stinks 12:28 AM: "Well, Babel is a good and classic internet Troll”
- Slinky stinks 12:28 AM: "Wink wink”
- otherLiam 12:29 AM: "Slinky, your humor license is still revoked.”
- otherLiam 12:29 AM: "Last time you made a joke you submitted a mask”
- Slinky stinks 12:29 AM: "Oh yeah I forgot”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:29 AM: "ᴜɢʜ, ɴᴇᴠᴇʀ ʀᴇꜰᴇʀ ᴛᴏ ᴍᴇ ᴀs ᴀɴ ɪɴᴛᴇʀɴᴇᴛ ᴛʀᴏʟʟ. ɪ ᴀᴍ ᴍᴜᴄʜ ᴍᴏʀᴇ ɢʀᴀɴᴅ ᴛʜᴀɴ sᴜᴄʜ ᴀ ʟᴏᴡʟʏ sᴇʟꜰ ᴀssᴜᴀɢɪɴɢ ᴄʀᴇᴀᴛᴜʀᴇ ᴀs ᴛʜᴀᴛ. ᴍʏ ᴇᴠɪʟ ɪs ʟᴇss ᴊᴏʟʟɪᴇs ᴀɴᴅ ᴍᴏʀᴇ ᴀʀᴛ.”
- moonman31 12:30 AM: "psychopath is right I guess”
- otherLiam 12:30 AM: "Well, Nocta being behind it doesn’t surprise me. Worth noting that Moonman isn’t banned anymore, either.”
- Slinky stinks 12:30 AM: "I mean you type in a special way, you mess around sometimes but you also help us, idk that sounds a lot like a hs troll to me lol, jk”
- otherLiam 12:30 AM: "Slinky.”
- Slinky stinks 12:31 AM: "Okay I’ll stop now”
- otherLiam 12:31 AM: "Please stop antagonizing the psychopath.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:31 AM: "ɪ'ᴍ ɴᴏᴛ sᴜʀᴇ ᴡʜᴀᴛ ʜs ʀᴇꜰᴇʀs ᴛᴏ ʙᴜᴛ ɪ ʀᴇꜰᴜsᴇ ᴛᴏ ꜰɪɴᴅ ᴏᴜᴛ. ɢᴏᴏᴅʙʏᴇ.”
- moonman31 12:31 AM: "homestuck bitch”
- moonman31 12:31 AM: "aw he left”
- otherLiam 12:31 AM: "annnd he left.”
- Slinky stinks 12:32 AM: "Okay, I must go to sleep now, I’m glad moonman is back, and I hope he gets better, good morning for me lol”
- otherLiam 12:32 AM: "gnight slink.”
- moonman31 12:32 AM: "I don’t think this is over but thank you all”
- moonman31 12:32 AM: "I am going to eat and rest.”
- otherLiam 12:32 AM: "No, it’s not over yet. But at least you’re safe now. Take care man.”
8/30/19 - Chat with Moonman and GHOSTBABEL
- moonman31 2:11 PM: “the weather is crazy right now”
- Xenquility 2:12 PM: "Rain?”
- moonman31 2:12 PM: "nah not yet, soon though”
- moonman31 2:12 PM: "Everything was cool here and suddenly we got all these hurricane warnings today”
- Slinky stinks 2:13 PM: "its because it was 10hour version”
- Xenquility 2:13 PM: "Think you’ll be okay?”
- moonman31 2:13 PM: "I should be?”
- moonman31 2:13 PM: "Florida is used to hurricanes”
- moonman31 2:13 PM: "just not so unexpectedly as this”
- Mr t series good 2:13 PM: "You dumbasses”
- Slinky stinks 2:13 PM: "yeah but an hurricane is a hurricane g”
- otherLiam 2:13 PM: "As a fellow Floridian, he’ll be okay.”
- Slinky stinks 2:14 PM: "take care just in case”
- otherLiam 2:14 PM: "The state’s infrastructure is built for hurricanes.”
- otherLiam 2:14 PM: "That being said, did Wolfcat actually play a song?”
- Mr t series good 2:14 PM: "Yeah”
- Mr t series good 2:14 PM: "That madlad”
- Slinky stinks 2:14 PM: "he did a "Pro slinky move"”
- Slinky stinks 2:14 PM: "and posted the 10h version of the SoS”
- otherLiam 2:15 PM: "hmm”
- moonman31 2:15 PM: ”???”
- moonman31 2:15 PM: “what are you guys talking about”
- Jos 2:15 PM: "Hello, resume?”
- Jos 2:15 PM: "Also my moonman”
- moonman31 2:15 PM: "it’s hurricane season…”
- Slinky stinks 2:15 PM: "wait is there a hurricane season?”
- otherLiam 2:15 PM: "there is”
- Xenquility 2:16 PM: "There’s a good chance it wasn’t wolfcat”
- moonman31 2:16 PM: "you think the song of storms summoned a hurricane?”
- Jos 2:16 PM: ”(:̲̅:̲̅:̲̅m̲̅a̲̅r̲̅i̲̅j̲̅u̲̅a̲̅n̲̅a̲̅:̲̅:̲̅:̲̅() this one after “death” should be gret”
- Xenquility 2:16 PM: “There’s literally a hurricane heading to Florida right now”
- Jos 2:16 PM: "NOW that you mention that”
- moonman31 2:16 PM: "wait”
- moonman31 2:16 PM: "what is the name of that hurricane”
- Slinky stinks 2:16 PM: "its an alternate universe hurricane”
- Xenquility 2:16 PM: "Dorian”
- Slinky stinks 2:16 PM: "imagine its called john lol”
- moonman31 2:17 PM: "Weird”
- moonman31 2:17 PM: "no ours is Helena”
- Slinky stinks 2:17 PM: "Helena???”
- moonman31 2:17 PM: "it feels like its not a coincidence though”
- moonman31 2:17 PM: “the timing is too perfect”
- moonman31 2:17 PM: “do you think someone is trying to get us?”
- otherLiam 2:17 PM: "You said you just got hurricane warnings, right?”
- moonman31 2:17 PM: "I mean all of us?”
- Mr t series good 2:18 PM: "Wolf caused it moonman”
- Slinky stinks 2:18 PM: "damn…”
- moonman31 2:18 PM: "There’s a lot of us in the various Floridas…”
- moonman31 2:18 PM: "Wolf?”
- otherLiam 2:18 PM: "We’ve known about Dorian for awhile, so it suddenly appearing out of nowhere for you seems pretty bad.”
- moonman31 2:18 PM: "doesn’t seem like Wolf would do that :\”
- Jos 2:18 PM: "Wolf has been weird the past week.”
- Xenquility 2:18 PM: "How long ago did the warnings appear?”
- Slinky stinks 2:18 PM: "i mean”
- Jos 2:18 PM: "i have a lot of proof”
- Xenquility 2:18 PM: ”(Wolf is always weird)”
- Slinky stinks 2:18 PM: “helena sounds familiar”
- Jos 2:18 PM: "no no”
- Jos 2:18 PM: "weird stuff”
- Jos 2:18 PM: "but”
- otherLiam 2:18 PM: ”…That reminds me. Moonman, it was mentioned to us that you think there’s a traitor in our midst. Why do you think that?”
- moonman31 2:19 PM: “Because they were posting your discord convos in the truth”
- Mr t series good 2:19 PM: "What If Wolfs the traitor”
- Slinky stinks 2:19 PM: "Wait what”
- moonman31 2:19 PM: "that’s all gone now though”
- Mr t series good 2:19 PM: "Would Match with him Posting Songs”
- moonman31 2:19 PM: "it was in the Internet Detectives thread”
- Jos 2:19 PM: ”@otherLiam accept friend”
- otherLiam 2:19 PM: “we are now frens”
- Mr t series good 2:20 PM: "Nice”
- Slinky stinks 2:20 PM: "accept frend too liam”
- otherLiam 2:20 PM: "did it”
- Wolfcat 2:21 PM: "i posted the song of storms in reference to the actual hurricane hitting florida right now”
- Mr t series good 2:21 PM: "Oh”
- otherLiam 2:21 PM: "Were they posting discord convos from here, or the main ID discord?”
- Wolfcat 2:21 PM: "i never meant for it to be an actual submission”
- Mr t series good 2:21 PM: "Sorry then wolf”
- otherLiam 2:21 PM: "Well, Slinky didn’t mean the Elegy to be an actual submission”
- moonman31 2:21 PM: "they were from the ID discord”
- moonman31 2:21 PM: "mainly”
- otherLiam 2:21 PM: "but here we are”
- Slinky stinks 2:21 PM: "lol”
- Slinky stinks 2:21 PM: "okay”
- Slinky stinks 2:21 PM: "prolly it was the first post”
- Slinky stinks 2:21 PM: "it was made by nocta”
- otherLiam 2:21 PM: "Then that doesn’t necessarily mean we have a traitor, anyone can join that thing and take screenshots.”
- Slinky stinks 2:22 PM: "but its deleted”
- Wolfcat 2:22 PM: "nocta was also spying on our tumblr if im remebering correctly”
- Slinky stinks 2:22 PM: "and a lot of people joined and quitted recently”
- moonman31 2:22 PM: "uh well i thought you need special perms to go beyond the welcome area”
- moonman31 2:22 PM: "but this was going on for a while”
- Slinky stinks 2:23 PM: "oh yeah”
- Slinky stinks 2:23 PM: "the ID role”
- Slinky stinks 2:23 PM: "i couldn’t see the general with my Side Acc”
- otherLiam 2:23 PM: "Hrm.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 2:26 PM: "ᴅᴏ ʏᴏᴜ ᴛʜɪɴᴋ ᴛᴡᴏ ʜᴜʀʀɪᴄᴀɴᴇs ᴀʀᴇ ᴀ ᴄᴏɪɴɪᴄɪᴅᴇɴᴄᴇ? sᴇᴇᴍs ꜰɪsʜʏ ᴛᴏ ᴍᴇ.”
- Jos 2:27 PM: "I don’t think so”
- Mr t series good 2:27 PM: "Babel you think the Song caused it”
- Slinky stinks 2:27 PM: "i mean now everything its a coincidence”
- Jos 2:27 PM: "I mean”
- Slinky stinks 2:27 PM: "we cant asume stuff now bc we dont have Any info”
- ARGdov 2:28 PM: "God shit is bad”
- ARGdov 2:28 PM: "Sadly Im prepccupied”
- Mr t series good 2:28 PM: "Oof”
- ARGdov 2:28 PM: "Dont do anything stupid you guys”
- Wolfcat 2:29 PM: "who do you think we are?”
- Slinky stinks 2:29 PM: "dont post songs as memes”
- Mr t series good 2:29 PM: ”:moonman:”
- Slinky stinks 2:29 PM: “thats what you guys told me lol”
- ɢʜᴏsᴛʙᴀʙᴇʟ 2:29 PM: "ᴡᴇʟʟ ᴡᴇ ᴘᴜʟʟᴇᴅ ᴏꜰꜰ sᴏᴍᴇ ʀɪsᴋʏ sᴛᴜꜰꜰ. ɪ ᴛᴏʟᴅ ʏᴏᴜ ᴛʜᴇʀᴇ ᴡᴇʀᴇ ᴡᴏᴜʟᴅ ᴘᴏssɪʙʟʏ ʙᴇ ᴄᴏɴsᴇǫᴜᴇɴᴄᴇs. sʜᴏʀᴛʟʏ ᴀꜰᴛᴇʀ ᴛʜᴀᴛ ᴛʜᴇ ꜰɪʀsᴛ sᴛᴏʀᴍ ᴅᴇᴠᴇʟᴏᴘᴇᴅ. ᴅᴏᴇsɴ'ᴛ sᴇᴇᴍ ᴛᴏ ᴄᴏɪɴɪᴄɪᴅᴇɴᴛᴀʟ ᴛᴏ ᴍᴇ ᴀɴʏᴡᴀʏs.”
- Slinky stinks 2:29 PM: "and it happened again”
- Jos 2:30 PM: "yeah, as i said, it is not, but i can’t speak much”
- Slinky stinks 2:30 PM: "does the length of the song also means sum
- lime if i post a 10 hour version of something it would mean more effectively”
- ARGdov 2:30 PM: "I doubt it”
- ɢʜᴏsᴛʙᴀʙᴇʟ 2:31 PM: "ᴘʀᴏʙᴀʙʟʏ ɴᴏᴛ, ʙᴜᴛ ᴡᴇ ᴛᴀᴍᴘᴇʀᴇᴅ ᴡɪᴛʜ ᴛʜᴇ ɪɴꜰɪɴɪᴛᴇ ᴀɴᴅ ɪᴛ ᴛᴀᴍᴘᴇʀᴇᴅ ʙᴀᴄᴋ. ᴏʀ sᴏᴍᴇᴏɴᴇ ᴍᴀɴɪᴘᴜʟᴀᴛᴇᴅ ʜᴏᴡ ᴏᴜᴛ ᴏꜰ ʙᴀʟᴀɴᴄᴇ ᴛʜᴇ sᴛᴀʙɪʟɪᴛʏ ᴏꜰ ʀᴇᴀʟɪᴛʏ ɪs ɢᴇᴛᴛɪɴɢ.”
- moonman31 2:32 PM: ”:neutral_face:”
- ɢʜᴏsᴛʙᴀʙᴇʟ 2:33 PM: “ᴄᴀʟʟ ɪᴛ ᴀ ᴛʜᴇᴏʀʏ ᴛʜᴇɴ. ᴄᴀʟʟ ᴍᴇ ᴀ ᴘᴇssɪᴍɪsᴛ, ʙᴜᴛ I ᴡᴏᴜʟᴅ ᴛᴀᴋᴇ ᴇᴠᴇʀʏᴛʜɪɴɢ ᴍᴏʀᴇ sᴇʀɪᴏᴜsʟʏ, ɪɴ ʏᴏᴜʀ sʜᴏᴇs. ᴘᴇʀsᴏɴᴀʟʟʏ.”
- Slinky stinks 2:33 PM: "moonman poker faces”
- Jos 2:33 PM: "We are”
- ARGdov 2:33 PM: "We’re concerned”
- Slinky stinks 2:34 PM: "take care moony, we dont know how interdimensional hurricanes can be”
- moonman31 2:34 PM: "meh”
- Slinky stinks 2:34 PM: "just asking”
- Slinky stinks 2:34 PM: "how was that hurricane that fucked up A LOT called?”
- Slinky stinks 2:34 PM: "who is @0118072119”
- Slinky stinks 2:34 PM: "is in both servers and it freaks me out a little lol”
- Jos 2:36 PM: "Idk just a player”
- moonman31 2:43 PM: ((Moonman posts a screenshot of a Google search, showing results for a hurricane named Helena))
- Mr t series good 2:43 PM: "Oh shit”
- Slinky stinks 2:43 PM: "what the heck”
- Jos 2:44 PM: "Do you have google over there?”
- moonman31 2:44 PM: "What? Yeah”
- ARGdov 2:44 PM: "Daaamn”
- ARGdov 2:44 PM: "Weird one thing presicted it coming a couple days ago”
- ARGdov 2:44 PM: "Although wait”
- ARGdov 2:44 PM: "Category 1 is a weak hurricane right?”
- moonman31 2:45 PM: "Uh yeah i guess they announced it as a storm a few days ago but suddenly its like a CAT 4”
- ARGdov 2:45 PM: "Jesus fuck ok”
- ARGdov 2:45 PM: "Yeah ok so Wolf is responsible”
- moonman31 2:46 PM: "wait”
- moonman31 2:46 PM: "google your hurricane”
- moonman31 2:46 PM: "and see how it compares”
- Jos 2:46 PM: ((Jos posts a screenshot of a Google search similar to Moonman’s, only the names are replaced with “Dorian”))
- Jos 2:46 PM: “sorry for the spasnih stuff”
- moonman31 2:47 PM: "seems the same”
- Slinky stinks 2:47 PM: "hmmm”
- Slinky stinks 2:47 PM: "yeah”
- ARGdov 2:47 PM: "Simmilar but not the same”
- Slinky stinks 2:47 PM: "is helena hitting in georgia too?”
- otherLiam 2:47 PM: "might just be us being parallel earths, might have been wolfcat posting the song of storms as a meme.”
- Slinky stinks 2:47 PM: "Simmilar but not the same”
- Slinky stinks 2:47 PM: "LIKE THE WHOLE TIMELINE”
- Slinky stinks 2:47 PM: "that caps sorry”
- Mr t series good 2:48 PM: "Yes”
- ARGdov 2:48 PM: "The hurricane in the other timelie was weak”
- Slinky stinks 2:48 PM: "i pressed by accident”
- ARGdov 2:48 PM: "And then not so long after Wolf posted it it got absurdly strong”
- Jos 2:48 PM: "Actually”
- Jos 2:48 PM: "not only song of storm.”
- Jos 2:48 PM: "but the healing song”
- Jos 2:48 PM: "both hidden as memes”
- ARGdov 2:50 PM: "Yeesh”
- otherLiam 2:50 PM: "i doubt the song of healing counted”
- moonman31 2:51 PM: ((Moonman posts a news article about hurricane Helena))
- Xenquility 2:52 PM: ((Xenquility posts the same news article as it appears in our timeline, having the name replaced with “Dorian”))
- otherLiam 2:52 PM: "hmmm.”
- otherLiam 2:52 PM: "for the record”
- otherLiam 2:52 PM: "there has never been a hurricane Helena in our timeline.”
- Slinky stinks 2:53 PM: "hmmm”
- otherLiam 2:53 PM: "we had a Tropical Storm Helena once. We’ve had Hurricanes Elena and Helene.”
- Slinky stinks 2:53 PM: "i mean yeah”
- Slinky stinks 2:53 PM: "it has been a helena tropical storm”
- Slinky stinks 2:53 PM: "9 deds”
- moonman31 2:55 PM: "Dorian /ˈdɔːriən/ is a unisex given name of Greek origin. In Greek the meaning of the name Dorian is: Of Doris, a district of Greece; or of Doros, a legendary Greek hero. Doros was the son of Hellen of Sparta (who was the daughter of Zeus and Leda). Doros was the founder of the Dorian tribe, and the most likely origin of Doros’ name was the Greek word "doron”, meaning “gift”. The Dorians were an obscure, ancient Hellenic tribe that were supposed to have existed in the north-eastern regions of Greece, ancient Macedonia and Epirus.”
8/31/19 - Chat with Moonman and GHOSTBABEL
- moonman31 12:04 PM: ((A screenshot of a news article reporting that hurricane Helena is no longer headed towards Moonman’s location is posted))
- moonman31 12:04 PM: “damn y'all”
- Slinky stinks 12:05 PM: "is that good or bad”
- moonman31 12:05 PM: "it moved away”
- Jos 12:05 PM: "Yes,”
- Slinky stinks 12:05 PM: "dont tell me the goddamn ritual worked on the AO timeline too lol”
- moonman31 12:05 PM: "what”
- Slinky stinks 12:06 PM: "its kinda hard to explain without breaking the 4th wall a little so lets leave it there”
- moonman31 12:06 PM: "Y'all fuckin with magic again huh”
- Jos 12:06 PM: ”
- we did a little ritual to the “sun”, the counter of luna, as a joke to move the huricane away, and it worked? lol”
- Jos 12:06 PM: “Just kidding”
- Jos 12:06 PM: "how it is going”
- moonman31 12:07 PM: "I mean good now that I won’t get eaten by a giant storm”
- Slinky stinks 12:07 PM: "yeah are you good n stuff”
- Slinky stinks 12:07 PM: “well, thats nice to hear i guess”
- Jos 12:07 PM: "that might be the fetish of someone outthere on the internet”
- Slinky stinks 12:08 PM: "rule 34 my friend”
- Slinky stinks 12:08 PM: "huricane rule 34”
- Slinky stinks 12:08 PM: "imagine that actually exists”
- Jos 12:08 PM: "well, seems like AO is pretty chill rn”
- Jos 12:08 PM: "and jid is the same”
- Slinky stinks 12:09 PM: "and the elegy didnt do that much of a thing apart of making moony see that thing (sorry again)”
- ARGdov 12:09 PM: "tl;dr a friend of ours performed a ritual as a joke to redirect the hurricane”
- ARGdov 12:09 PM: "Well”
- ARGdov 12:09 PM: "I dunno if he was joking, he got a few other friends to do it too”
- Slinky stinks 12:10 PM: "oh rigth”
- Slinky stinks 12:10 PM: "we also did it”
- Slinky stinks 12:10 PM: "so it kinda counts”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:10 PM: "sᴏ ᴡʜᴀᴛ ᴡᴀs ɪᴛ ᴛʜᴇɴ, ᴛʜᴇ sᴜɴ’s sᴏɴɢ?”
- Slinky stinks 12:10 PM: "nope”
- Jos 12:10 PM: "Helios song*”
- Jos 12:10 PM: "but with images”
- Jos 12:10 PM: "lol”
- Slinky stinks 12:10 PM: "we invoked helios with something”
- Slinky stinks 12:10 PM: "yeah lol”
- Slinky stinks 12:10 PM: "imagine now we can use gods aswell lmao”
- Slinky stinks 12:10 PM: "that would be rad ngl”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:11 PM: "sᴏ ʏᴏᴜ ᴘʟᴀʏᴇᴅ ᴛʜᴇ sᴜɴ’s sᴏɴɢ ᴍᴀɴᴜᴀʟʟʏ? ᴏʀ ᴛʜᴀᴛ’s ᴡʜᴀᴛ ʏᴏᴜ ᴅɪᴅ, ᴇssᴇɴᴛɪᴀʟʟʏ. ᴠᴇʀʏ ᴘʀɪᴍɪᴛɪᴠɪsᴛ ᴏꜰ ʏᴏᴜ.”
- Slinky stinks 12:11 PM: "no, we didnt play any songs”
- Slinky stinks 12:11 PM: "a friend did a kinda ritual and told us to draw a image so it would make more effect”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:12 PM: "ʏᴏᴜ ᴍɪss ᴍʏ ᴘᴏɪɴᴛ. ᴇɪᴛʜᴇʀ ᴡᴀʏ ᴡᴇ'ʀᴇ ᴀꜰꜰᴇᴄᴛɪɴɢ ᴇᴀᴄʜ ᴏᴛʜᴇʀ ᴡɪᴛʜ ᴛʜᴏsᴇ sᴏʀᴛs ᴏꜰ ᴀᴄᴛɪᴏɴs sᴏ ᴛᴏ sᴘᴇᴀᴋ.”
- Slinky stinks 12:12 PM: "oh”
- Slinky stinks 12:12 PM: "i dont know how to read sorry”
- Jos 12:12 PM: "pff, songs are for casuals, manual is better…”
- Jos 12:12 PM: "yeah”
- moonman31 12:13 PM: "fuckin casuals”
- moonman31 12:13 PM: "git gud like my ID boys”
- Slinky stinks 12:13 PM: "songs are for normies reeeeeeeee”
- Slinky stinks 12:13 PM: "so aprantly now if we do a ritual it may also work? or wtf does this mean lol”
- Jos 12:14 PM: "The song of time fucked up AO on oyur time, the magic can also move the storm on your universe so we can affect stuff from here”
- Jos 12:14 PM: "the thing is why, maybe because tyler is there?”
- Jos 12:14 PM: "he is there and therefore that universe was affected”
- Jos 12:14 PM: "as this universe was affected when he used to be in this one”
- Slinky stinks 12:14 PM: "oh rigth”
- Slinky stinks 12:14 PM: "bc he is our link”
- Slinky stinks 12:14 PM: "ok it makes sense”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:15 PM: "ᴍᴀᴋᴇs ʏᴏᴜ ᴡᴏɴᴅᴇʀ, ᴡʜᴏ ɪs ᴏᴜʀ ʟɪɴᴋ? ᴀʀᴇ ᴡᴇ ᴀʟʟ ʟɪɴᴋ?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:15 PM: "ɪ ᴄᴀɴ ᴍᴀᴋᴇ ᴊᴏᴋᴇs.”
- Jos 12:16 PM: "probably your tyler”
- moonman31 12:16 PM: "oof”
- Slinky stinks 12:16 PM: "lol”
- Jos 12:16 PM: "from your universe, or someone else”
- moonman31 12:16 PM: "that’s some deeplore humor”
- Jos 12:16 PM: "Hiiija!”
- Jos 12:16 PM: "pot break sounds”
- Slinky stinks 12:16 PM: "GNHA!”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:17 PM: "ɪ ʀᴇᴀᴅ ᴛʜɪɴɢs ᴏɴ ᴛʜᴇ ɪɴᴛᴇʀɴᴇᴛ.”
- moonman31 12:17 PM: "can’t really blame you lol”
- moonman31 12:17 PM: "ok so”
- moonman31 12:17 PM: "that is gud but”
- moonman31 12:17 PM: "we are still kind of in a stalemate”
- moonman31 12:17 PM: "plus now we have some new spooks about apparently so”
- otherLiam 12:18 PM: "That’s true. Right now we’re sort of waiting on GB to get us into the subspace.”
- Jos 12:18 PM: "I still wonder who is the AO with the alien mask”
- otherLiam 12:18 PM: "As usual, we’re all dependent on his skills.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:18 PM: "ᴀʙᴏᴜᴛ ᴛʜᴀᴛ, ɪ ᴋɴᴏᴡ ᴇxᴀᴄᴛʟʏ ᴡʜᴀᴛ ᴛᴏ ᴅᴏ ɴᴏᴡ.”
- Slinky stinks 12:18 PM: "yup”
- otherLiam 12:19 PM: "Oh, awesome. Do you know how long it’ll take?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:19 PM: "ᴡᴇ ʜᴀᴠᴇ ᴏɴᴇ sᴍᴀʟʟ ᴘʀᴏʙʟᴇᴍ ᴛʜᴀᴛ ɪ ɴᴇᴇᴅ ᴛᴏ ᴅᴇᴀʟ ᴡɪᴛʜ ʙᴇꜰᴏʀᴇ ᴡᴇ ᴄᴀɴ ᴛʀᴜʟʏ ᴘʀᴏᴄᴇᴇᴅ.”
- Slinky stinks 12:19 PM: "what problem…”
- Jos 12:20 PM: "enemy eyes?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:20 PM: "ɪ ᴛʜɪɴᴋ ɪᴛ ʙᴇsᴛ ɴᴏᴛ ᴛᴏ ᴛᴇʟʟ ʏᴏᴜ ᴀs ᴏꜰ ɴᴏᴡ ʙᴇᴄᴀᴜsᴇ ɪ'ᴍ sᴜʀᴇ ɪᴛ ᴡᴏᴜʟᴅ ᴄᴀᴜsᴇ ᴀ ᴘᴀɴɪᴄ, ʙᴜᴛ ɪ ʜᴀᴠᴇ ʟɪᴛᴛʟᴇ ʀᴇᴀsᴏɴ ᴛᴏ ᴡᴏʀʀʏ ᴀs ᴏꜰ ɴᴏᴡ.”
- Slinky stinks 12:20 PM: "you lost the hat?”
- otherLiam 12:20 PM: "well that’s unsettling”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:20 PM: "ɴᴏ.”
- Slinky stinks 12:20 PM: "okay…”
- otherLiam 12:20 PM: "but alright, handle your business. let us know if we can do anything to help.”
- Slinky stinks 12:21 PM: "yup”
- Slinky stinks 12:21 PM: “tho if its a very big problem you should tell us so we can solve it”
- otherLiam 12:21 PM: "Is there anything we can do to prevent Nocta from doing whatever he did to Moonman to other people?”
- Jos 12:22 PM: "I think the problem is telling us”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:22 PM: "ɪ ꜰᴇᴇʟ ʟɪᴋᴇ ᴛʜɪs ɪs ɴᴏᴛ ᴀ ᴘʀᴏᴍɪsɪɴɢ ɴᴏᴛᴇ ᴛᴏ ʟᴇᴀᴠᴇ ʏᴏᴜ ᴏɴ. ʙᴜᴛ ɪ ᴄᴀɴ ᴀssᴜʀᴇ ʏᴏᴜ ᴡᴇ ᴄᴏɴᴛɪɴᴜᴇ ᴛᴏ ᴍᴏᴠᴇ ꜰᴏʀᴡᴀʀᴅ. ɪɴ ᴛʜᴀᴛ ᴇɴᴅ ɪ ᴡɪʟʟ ᴛʀᴜsᴛ ᴏɴᴇ ɪɴᴅɪᴠɪᴅᴜᴀʟ ᴏᴜʀ ꜰɪɴᴀʟ ᴍᴏᴠᴇ ᴛᴏ ɢᴀɪɴ ᴛʜᴇ ɢʀᴏᴜᴘ’s ᴛʀᴜsᴛ ʙᴜᴛ ɪᴛ ɪꜰ ɪᴛ ɪs sʜᴀʀᴇᴅ ɪ'ᴍ ᴀꜰʀᴀɪᴅ ᴀ ʀᴏɢᴜᴇ ᴡɪʟʟ ᴘᴜʟʟ ᴀɴ ɪɴᴛᴇʀɴᴇᴛ ᴅᴇᴛᴇᴄᴛɪᴠᴇ ꜰᴀᴍᴏᴜs sᴛᴜɴᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:22 PM: "ɪ'ᴍ ɴᴏᴛ ɢᴏᴏᴅ ᴀᴛ ᴅᴇᴄɪᴅɪɴɢ sᴏ ɪ ᴛʜɪɴᴋ ʏᴏᴜ sʜᴏᴜʟᴅ ᴄʜᴏᴏsᴇ.”
- moonman31 12:24 PM: "lol”
- moonman31 12:24 PM: "idk feels like a troll to me”
- moonman31 12:24 PM: "i mean at least as far as making yall choose”
- Slinky stinks 12:25 PM: "ummm”
- Slinky stinks 12:25 PM: "who tho”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:25 PM: "ᴀɴᴅ ʏᴏᴜ sʜᴏᴜʟᴅ ᴛᴀʙ ᴏᴜᴛ ᴏꜰ ᴘᴏʀɴʜᴜʙ ᴡʜɪʟᴇ ɪ'ᴍ ᴏɴ.”
- otherLiam 12:25 PM: "Nah, it makes sense. I’d be worried about us doing a headass move too.”
- Mr t series good 12:25 PM: "im not even on pornhub rn”
- Slinky stinks 12:25 PM: "ay i closed the tab 15 mins ago”
- Slinky stinks 12:25 PM: "dont @ me”
- moonman31 12:26 PM: "i was about to say”
- moonman31 12:26 PM: "i don’t think he was talking to me”
- otherLiam 12:29 PM: "give thr info to Jos.”
- Jos 12:29 PM: "o/”
- otherLiam 12:29 PM: "we voted”
- moonman31 12:29 PM: ”:open_mouth:”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:29 PM: “ᴀʟʀɪɢʜᴛ ᴛʜᴇɴ.”
- Slinky stinks 12:30 PM: ”\o/”
- Mr t series good 12:30 PM: “ok”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:32 PM: “ɪᴛ ɪs ᴅᴏɴᴇ. ɪ ʜᴏᴘᴇ ʏᴏᴜ ᴡɪʟʟ ᴋᴇᴇᴘ ᴛᴏ ʏᴏᴜʀ ᴘʀᴏᴍɪsᴇs.”
- Slinky stinks 12:32 PM: "neat”
- Jos 12:32 PM: "I know nothing tbh”
- otherLiam 12:33 PM: "aight neat.”
- moonman31 12:34 PM: "i don’t really know what’s going on tbh”
- Slinky stinks 12:34 PM: "me neither”
- Xenquility 12:34 PM: "No one has know what’s been going on for the past four years”
- Jos 12:34 PM: "I wish i knew”
- Slinky stinks 12:34 PM: "well moonman how is that hurricane crisis going”
- moonman31 12:34 PM: "same”
- otherLiam 12:34 PM: "GB is being paranoid about our stupidity, that’s all.”
- Slinky stinks 12:35 PM: "i think he should be”
- otherLiam 12:35 PM: "Rightly so, yeah.”
- Slinky stinks 12:35 PM: "lol”
- Slinky stinks 12:35 PM: "well, any news about my fuck up?”
- otherLiam 12:36 PM: "What do you mean? Like, “has anyone seen Tenebris lately”?”
- Slinky stinks 12:36 PM: "yup”
- moonman31 12:36 PM: ((A meme mocking the player Slinky is posted))
- Slinky stinks 12:36 PM: "just that”
- Slinky stinks 12:36 PM: “honestly, AO memes are better”
- otherLiam 12:37 PM: "damn that’s cold”
- otherLiam 12:37 PM: "and im not sure we’ll know the full extent of how bad you fucked up for a while.”
- Slinky stinks 12:37 PM: "im gonna pull out the Alpha version of that meme”
- moonman31 12:38 PM: "what”
- Slinky stinks 12:38 PM: ((A meme mocking the player Slinky is posted))
- moonman31 12:38 PM: "damn”
- Xenquility 12:38 PM: "oh hey what a cool and original meme”
- moonman31 12:38 PM: "tom and jerry is classic tho”
- Slinky stinks 12:38 PM: "yeah tom and jerry is the best”
- Xenquility 12:39 PM: "whoever made that must be extremely sexy”
- Jos 12:39 PM: "ᛨᛆᛘᚾ”
- Slinky stinks 12:39 PM: "jos with his runes s freaking me out”
- Jos 12:39 PM: "ᛋᛚᛁᚾᚴᛦ᛫ ᛒᚮᚮᚮᚮ”
- moonman31 12:39 PM: "damn cold xen”
- moonman31 12:39 PM: "i saw that shit”
- (…)
- Xenquility 5:24 PM: "I’m still of the opinion none of that spellcasting stuff was canon”
- ADULT_LINK 5:24 PM: "it does that”
- Xenquility 5:24 PM: "I know what it does in the actual game”
- Slinky stinks 5:24 PM: "wait is the MOON on ooc?”
- ARGdov 5:25 PM: "You guys should probably be talking about this in ID”
- Slinky stinks 5:25 PM: "or is it a normal moon”
- Slinky stinks 5:25 PM: "yeah thats what i said”
- mfgreth 10:31 PM: ((Greth posts a “thinking” emoji))
- moonman31 10:34 PM: ((Moonman posts a “thinking” emoji))
- moonman31 10:34 PM: wait”
- moonman31 10:34 PM: mindfuck”
- Slinky stinks 10:35 PM: "lol”
- moonman31 10:35 PM: "is that actually greth”
- mfgreth 10:35 PM: ”)()()()(“
- Slinky stinks 10:36 PM: “i guess he is”
- moonman31 10:36 PM: "i thought you were evil”
- Slinky stinks 10:36 PM: "wait”
- mfgreth 10:36 PM: "i thought you were dead”
- ADULT_LINK 10:36 PM: "why would greth be evil”
- moonman31 10:36 PM: "i thought you guys said he turned evil”
- Slinky stinks 10:36 PM: "mindfuck”
- ADULT_LINK 10:36 PM: "i think that was some time shenannigan fuckyness?”
- ADULT_LINK 10:36 PM: "¯\_(ツ)_/¯”
- mfgreth 10:37 PM: ”:okretard:”
- moonman31 10:37 PM: “i actually never noticed him being here”
- moonman31 10:37 PM: "isn’t that like inherently a bad idea”
- moonman31 10:37 PM: "it also fucks with me on so many levels”
- Slinky stinks 10:37 PM: "this is a mindfuck lvl 600”
- Wolfcat 10:38 PM: ”:munky:”
- Wolfcat 10:38 PM: “me rn”
- Slinky stinks 10:38 PM: “UH OH”
- ARGdov 10:38 PM: "Wait what”
- mfgreth 10:38 PM: "awa”
- moonman31 10:38 PM: "i mean but seriously”
- ARGdov 10:38 PM: "Last we checked Greth had been posessed by Patrem”
- Slinky stinks 10:38 PM: "yeah moony”
- ARGdov 10:38 PM: "And he was travelling paralelos”
- Slinky stinks 10:38 PM: "i feel you”
- Slinky stinks 10:38 PM: "yeah”
- Slinky stinks 10:38 PM: "this is ooc greth i think”
- ARGdov 10:39 PM: "Although he may not know hes being controlled?”
- Slinky stinks 10:39 PM: "its a big mindfuck”
- mfgreth 10:39 PM: "big brain time”
- moonman31 10:39 PM: "i want to meme but i’m freaked out”
- ARGdov 10:39 PM: "This is weirdo”
- mfgreth 10:40 PM: "perhaps you should all aggregate your thoughts”
- Slinky stinks 10:40 PM: "moony this is more confusing to us”
- moonman31 10:40 PM: "kasjf”
- moonman31 10:40 PM: "what”
- ARGdov 10:40 PM: "Perhaps we should”
- ARGdov 10:40 PM: "I guess”
- Wolfcat 10:40 PM: "very wyrd”
- ARGdov 10:40 PM: "What does it mean”
- Slinky stinks 10:40 PM: "Aggregation”
- Slinky stinks 10:40 PM: "AGAIN”
- ARGdov 10:40 PM: ”@mfgreth who are you?”
- mfgreth 10:40 PM: “I’m Greth, what?”
- ARGdov 10:41 PM: "Are you “our” greth”
- Wolfcat 10:41 PM: "are you ok arg”
- ARGdov 10:41 PM: "Yes”
- Slinky stinks 10:41 PM: "yes he is greth”
- mfgreth 10:41 PM: "sometimes I wonder that”
- Slinky stinks 10:41 PM: "but WICH greth”
- mfgreth 10:41 PM: "I mean am I your Greth?”
- mfgreth 10:41 PM: "or is your greth here now”
- moonman31 10:41 PM: "you mean me fuck off with that”
- ARGdov 10:41 PM: "Moonmans not from our timeline”
- moonman31 10:41 PM: "yeah”
- moonman31 10:41 PM: "you know what they meant”
- ARGdov 10:42 PM: "So no hes not “our greth””
- mfgreth 10:42 PM: "i said it was big brain time”
- ADULT_LINK 10:42 PM: "im confused so”
- ARGdov 10:42 PM: "I am wondering though”
- ADULT_LINK 10:42 PM: "i’m gonna go back to playin diablo 3”
- ARGdov 10:42 PM: "Ok guys”
- Slinky stinks 10:42 PM: "Big brain time huh”
- ARGdov 10:42 PM: "Remember when Tyler or whoever said things were about to get more complicated”
- Slinky stinks 10:42 PM: "oh shit”
- Slinky stinks 10:42 PM: "yeah”
- mfgreth 10:42 PM: "ok you all are angry so let’s have a candid conversation”
- ARGdov 10:42 PM: "Thorin suggested a third timeline could be getting thrown into the mix”
- ARGdov 10:42 PM: "Were not angry”
- Slinky stinks 10:43 PM: "oh no”
- ARGdov 10:43 PM: "Just confused?”
- Slinky stinks 10:43 PM: "oh yeah”
- ARGdov 10:43 PM: "Is “greth” ok?”
- mfgreth 10:43 PM: "I am better than ever”
- ARGdov 10:43 PM: "Do you remember the vlogs?”
- mfgreth 10:43 PM: "yeah because I shot them”
- ARGdov 10:43 PM: "The vlogs you made”
- ARGdov 10:43 PM: "Ok”
- Jos 10:43 PM: "Whats going on?”
- ARGdov 10:43 PM: "Hmm”
- ARGdov 10:43 PM: "Greth is talking”
- Jos 10:44 PM: "Resume”
- ARGdov 10:44 PM: "Its confusing”
- mfgreth 10:44 PM: "honestly”
- mfgreth 10:44 PM: "Everything is great.”
- ARGdov 10:44 PM: "Theres that phrase again”
- Jos 10:44 PM: "Wait if moonman os beta Greth”
- moonman31 10:44 PM: "this stepford motherfucker”
- ARGdov 10:44 PM: "Could mean something or nothing”
- ADULT_LINK 10:44 PM: "wait hold up”
- ADULT_LINK 10:44 PM: "i didnt suggets a third timeline”
- Jos 10:44 PM: "Nocta?”
- ARGdov 10:44 PM: ”@mfgreth are you still in the timeline you originated from?”
- ADULT_LINK 10:44 PM: “i said it’d be fucked if there was a third”
- ADULT_LINK 10:44 PM: "nothing indicates that there is”
- ARGdov 10:45 PM: "Same-same, really”
- ARGdov 10:45 PM: "I mean”
- ADULT_LINK 10:45 PM: "ehh”
- ARGdov 10:45 PM: "Im just trying to figure this out”
- mfgreth 10:45 PM: "timelines are pointless imo at this point but yeah”
- ARGdov 10:45 PM: "Who this is”
- mfgreth 10:45 PM: "I am Greth PRIME”
- ADULT_LINK 10:45 PM: "its greth you dingdong”
- mfgreth 10:45 PM: "or whatever”
- ADULT_LINK 10:45 PM: ”:P”
- Jos 10:45 PM: “Aka nocta?”
- ARGdov 10:45 PM: "So Im guessing hes our greth”
- Slinky stinks 10:45 PM: "greth dont meme pls”
- Slinky stinks 10:45 PM: "but if he is our greth”
- ARGdov 10:45 PM: "Who probably has Patrem in there”
- Slinky stinks 10:45 PM: "why is he no patt”
- Slinky stinks 10:45 PM: "exactly”
- ARGdov 10:46 PM: "Just lurking in the background”
- ARGdov 10:46 PM: "Because patrem doesnt need to posess someoen full time”
- Slinky stinks 10:46 PM: "just when he is asleep i guess”
- ARGdov 10:46 PM: "He can just stick around in there head and when he takes over they blackout”
- Slinky stinks 10:46 PM: "hmm”
- Slinky stinks 10:46 PM: "still confusing af”
- ARGdov 10:47 PM: "Not really but ok”
- ARGdov 10:47 PM: "Think of it as Jekyll and Hydr”
- Jos 10:47 PM: "Oue greth might be nocta”
- ARGdov 10:47 PM: ”*Hyde”
- Jos 10:47 PM: “Be cautious.”
- ARGdov 10:47 PM: "Wait what”
- ARGdov 10:47 PM: "No nocta is Kevin”
- Jos 10:47 PM: "If moonman os greth beta”
- Jos 10:47 PM: "And greth vlogs got possesed by patrem?”
- moonman31 10:48 PM: ”:moony: :gun:”
- moonman31 10:48 PM: “tbh”
- ARGdov 10:48 PM: “God fuck I dont know”
- ARGdov 10:48 PM: "This is bizarre”
- ARGdov 10:48 PM: "I gotta go for a bit”
- Wolfcat 10:48 PM: ”:truth: :moony: :truth:”
- mfgreth 10:48 PM: ((An image titled “meta.gif” is posted))
- ARGdov 10:48 PM: “Aaaah”
- ARGdov 10:48 PM: "Ill be back in a bit”
- Jos 10:48 PM: "Well fuck”
- Slinky stinks 10:48 PM: "oh KAY”
- Jos 10:49 PM: "Moonman, send product please”
- Jos 10:49 PM: "We need to evade ourselves from this chaos”
- moonman31 10:49 PM: "oh ok”
- Slinky stinks 10:49 PM: "moonman send your dealer”
- moonman31 10:49 PM: ((Ascii art of marijuana is posted))
- Jos 10:50 PM: "Perfect”
- Slinky stinks 10:50 PM: "ah yes”
- Jos 10:50 PM: ”:cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud:”
- Jos 10:50 PM: “:cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud: :cloud_lightning:”
- Slinky stinks 10:50 PM: "D I G I T A L W E E D”
- Slinky stinks 10:50 PM: "hope babel does not get high”
- Jos 10:50 PM: "Oh shit, so much smoke i made a ecosystem”
- Slinky stinks 10:50 PM: "Josniverse”
- Wolfcat 10:50 PM: ”:wariowaggle:”
- Wolfcat 10:50 PM: “:cloud:”
- Slinky stinks 10:51 PM: “ave you guys seen the gif greth sent”
- Jos 10:51 PM: ((Jos reposts “meta.gif”))
- Slinky stinks 10:51 PM: "he deleted it”
- Slinky stinks 10:51 PM: "File name?”
- Jos 10:51 PM: "Meta”
- Slinky stinks 10:51 PM: "Of course”
- Slinky stinks 10:51 PM: "this is kinda meta”
- Jos 10:52 PM: "Ton”
- Jos 10:52 PM: "Undertale confirmed”
- Slinky stinks 10:52 PM: "na na NA NA”
- Slinky stinks 10:52 PM: "you know the song”
- Slinky stinks 10:52 PM: "okay, now talking about that gif”
- Slinky stinks 10:52 PM: "you know what does it look like?”
- Slinky stinks 10:52 PM: "just spitballing”
- Jos 10:54 PM: "Probably”
- Jos 10:54 PM: "Also offtopic:”
- Jos 10:54 PM: "Who is more badass”
- Jos 10:54 PM: "Scp foundation “
- Jos 10:54 PM: "Or”
- Jos 10:54 PM: "Windstorm ?”
- moonman31 10:55 PM: "ok im out”
- moonman31 10:55 PM: "my life has been weird enough lately”
- moonman31 10:55 PM: "bbl”
- Jos 10:55 PM: "Mm why?”
- Slinky stinks 10:55 PM: "windstorm?”
- Jos 10:55 PM: "Dont leave man”
- Jos 10:55 PM: ”:c”
- moonman31 10:56 PM: “no im just logging off discord”
- moonman31 10:56 PM: "sheesh”
- Jos 10:56 PM: "Alright”
- mfgreth 10:56 PM: "bye”
- Jos 10:56 PM: "Be safe…”
- Slinky stinks 10:56 PM: "take care g”
- moonman31 10:56 PM: "FUCK OFF”
- moonman31 10:56 PM: "not you guys other me ok”
- moonman31 10:56 PM: "sayonara”
9/3/19 - Chat with Moonman and GHOSTBABEL
- moonman31 11:58 AM: “what the fuck is going on”
- Slinky stinks 11:58 AM: "moonman”
- ARGdov 11:58 AM: "apparently someone accidentally played the elegy again because tenebris decided to fuck with song playing rules”
- Slinky stinks 11:58 AM: "Can i ask you sum?”
- moonman31 11:58 AM: "what’s up”
- Slinky stinks 11:58 AM: "okay”
- Slinky stinks 11:58 AM: "remember you said you saw something”
- moonman31 11:59 AM: "yeah”
- Slinky stinks 11:59 AM: "https://cdn.discordapp.com/attachments/611329478316130346/618208412290777098/06091401120312050118091407150620080516012008.gif”
- Slinky stinks 11:59 AM: “it looked like this?”
- moonman31 11:59 AM: "no”
- Slinky stinks 11:59 AM: "hmmm”
- moonman31 11:59 AM: "but i recognize that image”
- Slinky stinks 11:59 AM: "do you have any clue of what this is?”
- mfgreth 12:00 PM: "that’s endymion
- mfgreth 12:00 PM: "it’s a painting”
- Slinky stinks 12:00 PM: “i knew it was a fuvking painting”
- ARGdov 12:00 PM: "endymion”
- moonman31 12:00 PM: "wait”
- moonman31 12:00 PM: "yeah i was gonna say that”
- moonman31 12:00 PM: "what the fuck”
- moonman31 12:00 PM: "ok well”
- Slinky stinks 12:01 PM: ”@Jos”
- ARGdov 12:01 PM: ((The Diana and Endymion painting is posted))
- moonman31 12:01 PM: “oh he’s gone”
- moonman31 12:01 PM: "ok”
- Slinky stinks 12:01 PM: "it was a painting”
- moonman31 12:01 PM: "weird”
- ARGdov 12:01 PM: "fuck ok”
- ARGdov 12:01 PM: "I gotta learn what the myth is”
- ARGdov 12:01 PM: "its”
- ARGdov 12:01 PM: "oh shit”
- ARGdov 12:01 PM: "the name of the myth is "Diana and Endymion"”
- Slinky stinks 12:01 PM: "moony do you know what does that myth rpresent?”
- ARGdov 12:01 PM: "I think we need to figure it out for ourselves, dude”
- Slinky stinks 12:01 PM: "ok..”
- moonman31 12:01 PM: "epic”
- Slinky stinks 12:02 PM: "if thats an arcangel…”
- moonman31 12:02 PM: "ok well”
- moonman31 12:02 PM: "i will try and help the best i can”
- ARGdov 12:02 PM: "what the fuck is this myth”
- ARGdov 12:02 PM: "its really fucked up”
- Wolfcat 12:02 PM: "slinky what sound file did you post?”
- Slinky stinks 12:02 PM: "explain”
- ARGdov 12:03 PM: "so tl;dr this goddess named Selene really crushed on this guy named Endymion, and she ARGdov 12:03 PM: "really liked how he looked when he was sleeping”
- ARGdov 12:03 PM: "so she was like”
- ARGdov 12:03 PM: ”“yo zeus, can I have this guy””
- ARGdov 12:03 PM: “and Zeus was like "lol sure"”
- ARGdov 12:03 PM: "and put him into eternal sleep, so she could always go and look at him”
- Slinky stinks 12:03 PM: "ummm”
- ARGdov 12:03 PM: "she then proceeded to basically rape him while he was sleeping and sired a bunch of babies from him”
- Slinky stinks 12:03 PM: "THAT ESCALATED QUICKLY”
- Jos 12:04 PM: ”@slinç”
- Jos 12:04 PM: “slin ky what”
- moonman31 12:04 PM: "sounds like some moon occultist shit 2 me”
- ARGdov 12:04 PM: "but here’s the thing”
- Slinky stinks 12:04 PM: "it was a painting after all”
- ARGdov 12:04 PM: "the original name of the goddess was Selene”
- Jos 12:04 PM: "yes why wouldnt it be?”
- Slinky stinks 12:04 PM: "hm”
- Jos 12:04 PM: "it has painting shape”
- ARGdov 12:04 PM: "guess what her name was when the renaissance painters learned about this myth”
- Wolfcat 12:04 PM: "slinky, where did you get the elegy?”
- ARGdov 12:04 PM: "they changed the name to "Diana"”
- Slinky stinks 12:04 PM: "diana?”
- Slinky stinks 12:04 PM: "wolf i’ll pm you wait”
- ARGdov 12:04 PM: "Diana was the name of Patrem (aka Hank’s) wife”
- Slinky stinks 12:05 PM: "oh fuck”
- ARGdov 12:05 PM: "Patrem thought Luna was Diana”
- Slinky stinks 12:05 PM: "and i think tyler is endymion maybe”
- ARGdov 12:05 PM: "so, while it’s a bit of a stretch- Diana in this myth is meant to represent Luna, probably”
- Wolfcat 12:05 PM: "i just need to know where it originated”
- Slinky stinks 12:05 PM: "eternal sleep”
- ARGdov 12:05 PM: "if thats so thats fucked up lol”
- Slinky stinks 12:05 PM: "okay ill pm you wolfo”
- ARGdov 12:05 PM: "but yeah I do think Endymion would make sense as Tyler”
- ARGdov 12:05 PM: "but then that raises a bunch of fucked up questions.”
- ARGdov 12:05 PM: "Mainly how much does the myth actually apply to this situation”
- Slinky stinks 12:06 PM: "guys i just noticed a thing”
- Slinky stinks 12:06 PM: "the "elegy” i posted”
- ARGdov 12:07 PM: “because I kind of assume that Luna doesnt want to bone Tyler to have his babies, and I doubt she’s capable of even doing that”
- Slinky stinks 12:07 PM: "has an artist attached to it”
- Slinky stinks 12:07 PM: "wait”
- ARGdov 12:07 PM: "wait does it?”
- ARGdov 12:07 PM: "who’s the artist?”
- ARGdov 12:07 PM: ”(also where did you find it anyways?)”
- Slinky stinks 12:07 PM: ((A screenshot showing the file “NewPathsOpen.mp3” is shown depicting the artist of the file reading “Elegy of Emptiness Dubstep Glitch Remix - By Zaxiade (Majora’s Mask 3DS N64)”))
- Slinky stinks 12:07 PM: “lol”
- ARGdov 12:08 PM: "oh ok thats the youtuber who made it”
- Slinky stinks 12:08 PM: "its a error”
- ARGdov 12:08 PM: "oh is it?”
- ARGdov 12:08 PM: "my bad”
- Slinky stinks 12:08 PM: "prolly greth did a mistake f”
- Slinky stinks 12:08 PM: "lemme search form it anyways”
- ARGdov 12:08 PM: "ok”
- Slinky stinks 12:09 PM: "no silent comments”
- Slinky stinks 12:09 PM: "its just a mistake”
- Slinky stinks 12:09 PM: "okay so now we have a myth about falling asleep and rapists”
- Slinky stinks 12:09 PM: "and a monster we still dont know what/where is it”
- ARGdov 12:10 PM: "Im not sure if the raping/having his babies part is going to apply here
- but at the very least the sleeping part”
- Slinky stinks 12:10 PM: "or is it????”
- Slinky stinks 12:10 PM: "7u7”
- ARGdov 12:10 PM: "Im not sure”
- ARGdov 12:10 PM: "I hope not”
- Slinky stinks 12:10 PM: "got pmd”
- ARGdov 12:10 PM: "and I kind of doubt it but I could be wron”
- ARGdov 12:10 PM: "oh?”
- Slinky stinks 12:11 PM: "sure you looked hard enough?”
- Slinky stinks 12:11 PM: "only hint you’ll ever get”
- Slinky stinks 12:11 PM: "we need to go deeper”
- ARGdov 12:11 PM: ”….”
- ARGdov 12:11 PM: “ok so there MIGHT be a comment on that youtube”
- ARGdov 12:11 PM: "video”
- Slinky stinks 12:11 PM: "GOT A PIC”
- ARGdov 12:11 PM: ”??”
- Slinky stinks 12:11 PM: “there is a comment”
- ARGdov 12:11 PM: "oh?!”
- ARGdov 12:11 PM: "fuck”
- Slinky stinks 12:12 PM: "its occult”
- Slinky stinks 12:12 PM: "i dont see it but there is a comment”
- ARGdov 12:12 PM: "Im confused”
- ARGdov 12:12 PM: "can you send me the pic?”
- Slinky stinks 12:12 PM: ((A screenshot of a comment made by Greth Vlogs containing a cipher is shown))
- ARGdov 12:12 PM: "oh damn”
- Slinky stinks 12:12 PM: "i dont see the comment on the video but h sent me these”
- Slinky stinks 12:12 PM: "im gonna translate wait”
- Slinky stinks 12:12 PM: "got it”
- Slinky stinks 12:12 PM: "we are going much deeper even now”
- ARGdov 12:15 PM: "Daaamn”
- ARGdov 12:15 PM: "thats a lot of…something”
- ARGdov 12:15 PM: "it doesnt mean a while lot right now”
- ARGdov 12:15 PM: "what does that even mean”
- Slinky stinks 12:16 PM: "idk”
- Slinky stinks 12:16 PM: "i just know he left that on purpose”
- ARGdov 12:16 PM: "well yeah of course”
- Slinky stinks 12:16 PM: "so we should check the other audio files just in case”
- ARGdov 12:16 PM: "and its a hint of…something I guess”
- moonman31 12:16 PM: ((A similar screenshot is shown showing two more replies made by Greth Vlogs, both containing ciphers))
- ARGdov 12:16 PM: ”“we are going much deeper now"”
- ARGdov 12:16 PM: "oh gosh”
- moonman31 12:17 PM: "i can help now and then”
- Slinky stinks 12:17 PM: "Where did you get those moony?”
- moonman31 12:17 PM: "same video”
- ARGdov 12:17 PM: "ok we probably need to actually find those comments because those are going to take forever to copy from an image”
- Slinky stinks 12:17 PM: "why i dont see them”
- Wolfcat 12:17 PM: "brainlet”
- moonman31 12:17 PM: "ORUGKIDQN53WK4RAN5TCA4LVNFXHIZLTONSW4Y3FEB2GQ4TFMUQHAYLSORZSA33GEBQSA53IN5WGK===”
- ARGdov 12:17 PM: "try refreshing?”
- moonman31 12:17 PM: "O5UGC5BAO5UWY3BAPFXXKIDEN4QHO2DFNYQGK5TFOJ4XI2DJNZTSAZLOMRZT6IDXNFWGYIDZN52SAYLXMFUXIIDGN5ZCA2LUEB2G6IDUMFVWKIDZN52T6IDXNFWGYIDZN52SAZTJM5UHIPY=”
- Slinky stinks 12:17 PM: "ty”
- Slinky stinks 12:17 PM: "xen”
- Slinky stinks 12:17 PM: "i think you wanna see this”
- Slinky stinks 12:17 PM: "the power of quintessence three parts of a whole”
- Slinky stinks 12:17 PM: "what will you do when everything ends? will you await for it to take you? will you fight?”
- Slinky stinks 12:17 PM: ”@Xenquility knows about this stuff”
- Slinky stinks 12:17 PM: “he can help us”
- ARGdov 12:18 PM: "quin·tes·sence /ˌkwinˈtesəns/ -the most perfect or typical example of a quality or class. -the aspect of something regarded as the intrinsic and central constituent of its character. -a refined essence or extract of a substance.”
- Slinky stinks 12:19 PM: "yee”
- ARGdov 12:19 PM: "I kind of figured thats what it meant since thats what quintessential means but I wanted to double check”
- Slinky stinks 12:19 PM: "what will you do when everything ends? will you await for it to take you? will you fight?”
- Slinky stinks 12:19 PM: "what the fuck does that mean”
- ARGdov 12:19 PM: "presumably when the world ends”
- Slinky stinks 12:20 PM: "11/11”
- Slinky stinks 12:20 PM: "they are going 4 the giant awakening ritual”
- ARGdov 12:20 PM: ”“three parts of a whole"”
- ARGdov 12:20 PM: "hmmm”
- Slinky stinks 12:20 PM: "i mean”
- ARGdov 12:21 PM: "ok, I get what that means, but I dont understand what its referring to”
- Slinky stinks 12:21 PM: "we havent met the four IIII yet”
- Slinky stinks 12:21 PM: "only three kinda”
- moonman31 12:21 PM: "four giants, and 3”
- ARGdov 12:21 PM: ”“three parts of a whole”, 3….somethings make up a larger whole”
- moonman31 12:21 PM: “just missing a 2”
- ARGdov 12:21 PM: ”…damn yeah”
- moonman31 12:21 PM: “just sayin”
- Slinky stinks 12:21 PM: "wait what?”
- Slinky stinks 12:21 PM: "i mean we havent met II yet”
- Slinky stinks 12:21 PM: "the rest we know them”
- moonman31 12:22 PM: "you are fresh slinky i like that”
- Slinky stinks 12:22 PM: "ty :D”
- moonman31 12:22 PM: "my boy DOV knew what was up though”
- Slinky stinks 12:22 PM: "but yeah”
- ARGdov 12:22 PM: "so here’s what we do know”
- ARGdov 12:22 PM: ”“The ceremony seems to require the following individuals:”
- ARGdov 12:22 PM: "The Four Giants”
- ARGdov 12:22 PM: ”“The Link” - Tyler””
- ARGdov 12:22 PM: “"The Mask” - Tenebris"”
- Slinky stinks 12:22 PM: “I is the "true patrem” as he said”
- Slinky stinks 12:22 PM: “III is the one they hate, as seen is the comments of the videos”
- ARGdov 12:23 PM: "assuming this is about the ritual, which Im not sure it is, Im still not sure what the three parts would mean”
- Slinky stinks 12:23 PM: "and IIII is the one with the glad mans pic”
- Slinky stinks 12:23 PM: "we still have II left”
- ARGdov 12:23 PM: "didnt we already figure out one of them is Tenebris”
- Slinky stinks 12:23 PM: "I is the true patrem”
- ARGdov 12:23 PM: "that | is tenebris?”
- ARGdov 12:23 PM: "shit wait not”
- Slinky stinks 12:24 PM: "tho idk if he is tenebris”
- ARGdov 12:24 PM: "that IIIII is tenebris””
- Slinky stinks 12:24 PM: "it was I”
- Slinky stinks 12:24 PM: "not IIII”
- Slinky stinks 12:24 PM: "i think”
- Slinky stinks 12:24 PM: "the majora pic is I”
- Slinky stinks 12:24 PM: "and he was the Im glad you did that UwU”
- ARGdov 12:25 PM: "right ok…huh”
- ARGdov 12:25 PM: "dunno who IIIII is, maybe that’s tyler then, who the fuck knows”
- Slinky stinks 12:25 PM: "its confusing”
- ARGdov 12:25 PM: "Ive got a feeling its not referring to that though”
- Slinky stinks 12:25 PM: "IIII is the glad mans dud”
- ARGdov 12:25 PM: "ah”
- ARGdov 12:25 PM: "Im not sure what the three parts would be then”
- ARGdov 12:25 PM: "I do have a thought though but it’s probably wrong and wont really help us”
- Slinky stinks 12:27 PM: "hm”
- ARGdov 12:27 PM: "because when I think of "three parts of a whole” in the context of religion, I think of the holy trinity in christianity. “
- ARGdov 12:27 PM: “But that’s a stretch, and it doesnt really make anything clearer”
- ARGdov 12:27 PM: ”*in catholicism, specifically, I guess”
- Slinky stinks 12:28 PM: “hmmmm”
- ARGdov 12:28 PM: "I dont think that’s right, to be clea”
- ARGdov 12:28 PM: "maybe it is referring to the ritual”
- Slinky stinks 12:28 PM: "the only thing we know is that they are gonna try something”
- ARGdov 12:29 PM: "ok, so this is a bit of a stretch but”
- ARGdov 12:29 PM: ”“The ceremony seems to require the following individuals:”
- ARGdov 12:29 PM: "The Four Giants”
- ARGdov 12:29 PM: ”“The Link” - Tyler”
- ARGdov 12:29 PM: “"The Mask” - Tenebris"”
- Slinky stinks 12:29 PM: “makes sense”
- ARGdov 12:29 PM: ”“the Four Giants”, “The Link”, and “The Mask"”
- ARGdov 12:29 PM: "three parts”
- ARGdov 12:29 PM: "of a whole”
- ARGdov 12:29 PM: "of course one of those parts is four different people so im not sure if that works, but you need all three of those components to enact the ritual”
- ARGdov 12:29 PM: "if it is referring to the ritual, it probably means that?”
- Mr t series good 12:30 PM: "500 iq dov”
- Jos 12:30 PM: "tldl my pms please im busy”
- Mr t series good 12:30 PM: "yeah probably”
- Mr t series good 12:30 PM: "what does tldl mean”
- Slinky stinks 12:31 PM: "im pretty sure that "ceremony” is the Undecim nocte tyler was asissting”
- ARGdov 12:31 PM: “although, Moonman did suggest that if there are "four giants”, and “three….somethings”, there’s probably two of something else….which would suggest thats not right”
- ARGdov 12:31 PM: “I dont think it was Undecim Nocte”
- ARGdov 12:31 PM: "that ceremony Tyler went to, I mean”
- ARGdov 12:31 PM: "the day was wrong”
- Slinky stinks 12:31 PM: "we haven’t technically met II and III”
- Slinky stinks 12:31 PM: "they are two”
- Slinky stinks 12:31 PM: "we know who one of them are but we haven’t met them yet”
- ARGdov 12:32 PM: "Im wondering if those images we got that night called "path” and “split” had something to do with it”
- ARGdov 12:32 PM: “Im guessing that the ritual had more to do with more dimension shenanigins”
- Slinky stinks 12:32 PM: "hmmmm”
- Slinky stinks 12:32 PM: "this is really confusing”
- ARGdov 12:32 PM: "because we first got those images the same night”
- ARGdov 12:32 PM: "either way, somethings going deeper”
- ARGdov 12:32 PM: "maybe that literally just means”
- ARGdov 12:32 PM: ”“we are getting closer to conducting the ritual"”
- Slinky stinks 12:33 PM: "okay…”
- ARGdov 12:34 PM: "but I am wondering if Moonman pointing out that there are "four giants” and “we just need to find two of something” means the three components thing isnt referring to the ritual”
- ARGdov 12:34 PM: “Im not sure”
- ARGdov 12:34 PM: "I guess we’ll find out”
- Slinky stinks 12:34 PM: "lets wait then”
- ARGdov 12:34 PM: "I dont think there’s much else we can do at the moment so….yeah”
- Slinky stinks 12:35 PM: "also what the fuck with the "elegy dubstep glitch remix"”
- ARGdov 12:35 PM: "we’ve got a few pieces of information but not much else to go by, just more clues to stack up on top of other shit”
- Slinky stinks 12:35 PM: "dunno”
- Slinky stinks 12:35 PM: "okay so lets wait and stand proud”
- Slinky stinks 12:35 PM: "lol”
- Mr t series good 12:37 PM: "is that a jojo reference”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:38 PM: "sᴍᴀʟʟ ᴜᴘᴅᴀᴛᴇ ᴏɴ ᴏᴜʀ sɪᴛᴜᴀᴛɪᴏɴ: ɪ ꜰᴇᴇʟ ᴀᴏ ʜᴀs ʙᴇᴄᴏᴍᴇ ᴍᴏʀᴇ ᴜɴsᴛᴀʙʟᴇ. sᴏᴍᴇᴛʜɪɴɢ ʜᴀs ɪᴛ, ɪɴ ʟɪᴇᴜ ᴏꜰ ʟɪɢʜᴛᴇʀ ᴛᴇʀᴍs, ‘ꜰᴜᴄᴋᴇᴅ ᴜᴘ’. ɪᴛ ᴍᴀʏ ɴᴏᴛ ᴀᴘᴘᴇᴀʀ sᴏ ʙᴜᴛ ᴛʜᴇ ᴅᴀᴛᴀ ɪs ɴᴏᴛ ᴡʜᴇʀᴇ ɪᴛ ᴡᴀs.”
- ARGdov 12:39 PM: "jesus fuck”
- Mr t series good 12:39 PM: "babel as i like to say”
- Mr t series good 12:39 PM: "it be like that”
- ARGdov 12:39 PM: "maybe thats Tenebris’ doing?”
- Mr t series good 12:39 PM: "probably yeah”
- ARGdov 12:39 PM: "seeing as we somehow accidentally played it twice through some nonsense”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:39 PM: "sᴘᴇᴀᴋɪɴɢ ʙʟᴜɴᴛʟʏ ɪᴛ ᴡᴀs ᴀʟᴡᴀʏs ᴀ ʟɪᴛᴛʟᴇ ᴜɴsᴛᴀʙʟᴇ, ᴇsᴘᴇᴄɪᴀʟʟʏ ᴘᴏsᴛ-ᴇxᴄᴜʀsɪᴏɴ ᴛᴏ ʀᴇsᴄᴜᴇ ᴍᴏᴏɴʜᴇᴀᴅ, ʙᴜᴛ…”
- Slinky stinks 12:40 PM: "oh hello babel”
- Wolfcat 12:40 PM: "I think I understand the Endymion symbolism now”
- Slinky stinks 12:40 PM: "how”
- Wolfcat 12:41 PM: "the IDs are repeatedly raping AO”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:41 PM: "ɪ ᴀᴍ ɴᴏᴛ ᴇɴᴛɪʀᴇʟʏ sᴜʀᴇ ᴀʙᴏᴜᴛ ᴛʜᴀᴛ, ʙᴜᴛ ʏᴏᴜ ᴀʀᴇ ᴀᴡᴀʀᴇ ᴛʜᴀᴛ ᴛʜᴇsᴇ ᴡᴇʙsɪᴛᴇs ʜᴀᴠᴇ ᴀ ᴛᴇɴᴅᴇɴᴄʏ ᴛᴏ ʜᴏsᴛ sᴘɪʀɪᴛs, ʏᴇs? ᴊᴏʜɴɪsᴅᴇᴀᴅ ɪs ᴄᴏɴɴᴇᴄᴛᴇᴅ ᴛᴏ ᴀᴏ ᴛʜʀᴏᴜɢʜ sᴛʀᴀɴɢᴇ ᴇɴᴏᴜɢʜ ᴍᴇᴀɴs ʙᴜᴛ ᴡʜᴇɴ ɴᴏᴄᴛᴀ sᴛᴀʀᴛᴇᴅ ᴀᴅᴅɪɴɢ sᴘɪʀɪᴛs ᴛᴏ ʜɪs ᴏᴡɴ ɪɴᴠᴇɴᴛᴏʀʏ, ᴀs ɪᴛ ᴡᴇʀᴇ, ᴛʜɪɴɢs ʜᴀᴠᴇ… ᴡᴇʟʟ, ɢᴏᴛᴛᴇɴ ᴡᴏʀsᴇ.”
- ARGdov 12:42 PM: "I mena thats not surprising
- Slinky stinks 12:42 PM: "when we will be able to enter the subspace?”
- Slinky stinks 12:42 PM: “sorry for the question”
- ARGdov 12:42 PM: "Johnisdead is a wonky, psyehcedlic hellscape maze of a website”
- ARGdov 12:42 PM: "I never considered that was due to it hosting the spirits, but I guess it makes sense”
- Slinky stinks 12:42 PM: "if they are heading to do their thing on 11/11 we dont have that much of a time”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:43 PM: "ɪ ᴛʜɪɴᴋ ᴛʜᴇ ɴᴇxᴛ ʙᴇsᴛ sᴛᴇᴘ ᴏꜰ ᴏᴜʀs ɪs ᴛᴏ ʜᴇʟᴘ ᴛʜᴇ ᴘʀɪᴍᴀʀʏ sᴘɪʀɪᴛ ᴛʜᴀᴛ ɪs ᴄᴀᴜsɪɴɢ ᴛʜɪs ɪssᴜᴇ ᴇsᴄᴀᴘᴇ ᴛᴏ sᴏᴍᴇᴡʜᴇʀᴇ ᴇʟsᴇ, ꜰʀᴀɴᴋʟʏ ᴘᴜᴛ.”
- Slinky stinks 12:43 PM: "you know that migth be tenebris rigth?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:43 PM: "ɪ ᴅᴏɴ'ᴛ ᴛʜɪɴᴋ sᴏ.”
- Slinky stinks 12:44 PM: "moony saw a thing”
- ARGdov 12:44 PM: "wait if its not tenebris who the fuck would it be”
- Slinky stinks 12:44 PM: "prolly the spirit and or tenebris”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:44 PM: "ʏᴏᴜ ᴀʀᴇ ǫᴜɪᴄᴋ ᴛᴏ ᴀssᴜᴍᴇ ʙᴇɴ ɪs ᴛʜᴇ ᴄᴀᴜsᴇ ᴏꜰ ᴀʟʟ ʏᴏᴜʀ ᴡᴏᴇs.”
- Mr t series good 12:44 PM: "who else could it be?”
- ARGdov 12:44 PM: "tenebris, actuallly. we dont know what happened to Ben”
- Mr t series good 12:44 PM: ”:thinking:”
- ARGdov 12:44 PM: “so”
- ARGdov 12:44 PM: "lets think”
- ARGdov 12:44 PM: "Yuki’s probably in there too, but shit didnt get super wonky until a long time after she got ascended”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:45 PM: "ᴛʜᴀᴛ ʙᴇɪɴɢ sᴀɪᴅ ᴛʜɪs sᴘɪʀɪᴛ ɪsɴ'ᴛ ᴄᴀᴜsɪɴɢ ᴀɴʏ ᴅɪʀᴇᴄᴛ ʜᴀʀᴍ ᴛᴏ ʏᴏᴜ, ʙᴜᴛ ɪᴛ ᴍᴀᴋᴇs ɪᴛ ᴅᴀɴɢᴇʀᴏᴜs ᴛᴏ ᴏᴘᴇʀᴀᴛᴇ ᴏɴ ᴛʜᴇ ʟᴇᴠᴇʟ ᴡᴇ ɴᴇᴇᴅ ᴛᴏ ʙᴇ ᴀᴛ.”
- ARGdov 12:45 PM: "Moonman was trapped there for a time but he’s out now”
- Mr t series good 12:45 PM: "so maybe she is the one thats causing this”
- ARGdov 12:45 PM: "I just said she was added a long time before shit went a little nuts”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:45 PM: "ᴛʜᴀᴛ’s ᴊᴜsᴛ ɪᴛ, ɪ ᴡᴀs ᴡᴏʀᴋɪɴɢ ᴍʏ ᴡᴀʏ ᴀʀᴏᴜɴᴅ ɢᴇᴛᴛɪɴɢ ᴛʜᴇʀᴇ ʙᴜᴛ ɪ ʙᴇʟɪᴇᴠᴇ ʏᴜᴜᴋɪ ɪs ᴛʜᴇ ᴏɴᴇ ᴄᴀᴜsɪɴɢ ᴛʜɪs, ɪɴᴅɪʀᴇᴄᴛʟʏ ᴏʀ ɴᴏᴛ.”
- ARGdov 12:45 PM: "I think, at least”
- ARGdov 12:45 PM: "oh”
- ARGdov 12:45 PM: "well then”
- Slinky stinks 12:46 PM: "thats why isaid it may be tenebris”
- ARGdov 12:46 PM: "I have a big mouth”
- Slinky stinks 12:46 PM: "bc when moon head was Inside with thm he saw himor at least that thing”
- ARGdov 12:46 PM: "but hang on where can we let her escape too?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:46 PM: "ɪ ᴄᴏᴜʟᴅ ʙᴇ ᴡʀᴏɴɢ ʙᴜᴛ ɪ ʜᴀᴠᴇ ᴍʏ ᴅᴏᴜʙᴛs ᴀʙᴏᴜᴛ ᴍʏ ᴏᴡɴ ᴀʙɪʟɪᴛʏ ᴛᴏ ᴀɴᴀʟʏᴢᴇ ᴛʜᴇsᴇ ᴛʜɪɴɢs.”
- ARGdov 12:47 PM: "the only other website we know of that can properly host spirits that’s still around is johnisdead”
- ARGdov 12:47 PM: "and thats literally a digital purgatory”
- Slinky stinks 12:47 PM: "sorry im playing gta while typing”
- ɢʜᴏsᴛʙᴀʙᴇʟ 12:48 PM: "sᴏᴍᴇᴛɪᴍᴇs ᴀ sᴍᴀʟʟ sᴀᴄʀɪꜰɪᴄᴇ ɪs ɴᴇᴇᴅᴇᴅ ꜰᴏʀ ᴛʜᴇ ɢʀᴇᴀᴛᴇʀ ɢᴏᴏᴅ. ʙᴇsɪᴅᴇs, ɪꜰ ʏᴏᴜ ᴀʟʟ ᴀʀᴇ ᴀʙʟᴇ ᴛᴏ sᴛᴏᴘ ᴛʜᴇ ᴇɴᴅ ɢᴏᴀʟ ᴏꜰ ᴀ ᴍᴏᴏɴ ᴄᴜʟᴛ ᴅᴇsᴛʀᴏʏɪɴɢ ᴏᴜʀ ʀᴇᴀʟɪᴛɪᴇs ᴛʜᴇɴ ɪ ᴅᴏɴ'ᴛ ᴛʜɪɴᴋ ʏᴜᴜᴋɪ ᴡᴏᴜʟᴅ ᴜʟᴛɪᴍᴀᴛᴇʟʏ ᴏʙᴊᴇᴄᴛ.”
- Slinky stinks 12:48 PM: "hm”
- ARGdov 12:49 PM: "true”
- ARGdov 12:49 PM: "I just wish there was a better way than trapping her in Johnisdead”
- Slinky stinks 12:50 PM: "if we trapped her we could talk to er thru pididoip@gmail.com maybe”
- ARGdov 12:51 PM: “actually are any souls still in there? Im assuming so.”
- Slinky stinks 12:51 PM: "i htink so but they dont talk anymore for some reason”
- ARGdov 12:51 PM: "well they rarely do unless we send an email”
- otherLiam 12:52 PM: "She’s already trapped in AO. Trading one purgatory for another really isn’t that bad.”
- ARGdov 12:52 PM: "I guess so”
- ARGdov 12:52 PM: "but how do we do it? and can we tell her we’re doing it?”
- Slinky stinks 12:52 PM: "and how are we going to do that”
- Slinky stinks 12:52 PM: "yee”
- otherLiam 12:52 PM: "At least on JID she’ll have company.”
- Slinky stinks 12:52 PM: "i mean she still can post”
- Slinky stinks 12:52 PM: "She has company”
- ARGdov 12:53 PM: "ok Im going to redownload the discord app so I can hkeep up with things today on my phone”
- ARGdov 12:53 PM: "Ok downloaded”
- ARGdov 12:53 PM: "I need to get gas and go to work”
- otherLiam 12:54 PM: "There are some items/songs that could work, but I’d be worried about Tenebris misinterpreting them.”
- ARGdov 12:54 PM: "I think there may be other options”
- Slinky stinks 12:54 PM: "tenbris is gonna yoink those items and we all know that”
- otherLiam 12:54 PM: ”…this is a stupid idea but what if we PM: “ her account with a link to johnisdead?”
- ARGdov 12:54 PM: ”@ɢʜᴏsᴛʙᴀʙᴇʟ do you have any way of moving her to JiD on your end?”
- Slinky stinks 12:54 PM: “could be”
- Slinky stinks 12:54 PM: "the liam’s idea could work pretty nice”
- otherLiam 12:56 PM: "The issue is, johnisdead is still locked.”
- Slinky stinks 12:56 PM: "ah fuck thats rigth”
- Slinky stinks 12:56 PM: "hmm”
- Slinky stinks 12:56 PM: "this is so confusing”
- ɢʜᴏsᴛʙᴀʙᴇʟ 1:00 PM: "sᴏʀʀʏ, ɪ ᴡᴀs ᴀᴡᴀʏ ꜰʀᴏᴍ ᴋᴇʏʙᴏᴀʀᴅ ᴇᴀᴛɪɴɢ ᴘɪᴢᴢᴀ. ᴀɴᴅ ɴᴏ, ɪ ᴡᴏᴜʟᴅ ʜᴀᴠᴇ ᴛᴏ ʟᴏᴏᴋ ɪɴᴛᴏ ɪᴛ.”
- Slinky stinks 1:01 PM: "damn you like pizza”
- Slinky stinks 1:01 PM: "okay so thats weird”
- Slinky stinks 1:01 PM: "the pass is still a secret”
- ɢʜᴏsᴛʙᴀʙᴇʟ 1:04 PM: "ʜᴇᴀᴅɪɴɢ ᴏꜰꜰ ꜰᴏʀ ɴᴏᴡ, ɪ ᴡɪʟʟ ʜᴀᴠᴇ ᴍᴏʀᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ʟᴀᴛᴇʀ, ᴘᴇʀʜᴀᴘs.”
- Slinky stinks 1:04 PM: "ok”
- Slinky stinks 1:04 PM: "goodbye gb”
10/13/19 - Chat with Yuukichan
- ᴉʞnnʎ 12:10 AM: ((“SIGNALS.gif” is posted - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=SIGNALS.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=SIGNALS.gif</a>))
- otherLiam 12:11 AM: “uh”
- otherLiam 12:11 AM: “How the hell?”
- ARGdov 12:12 AM: “wow what”
- otherLiam 12:12 AM: “Well welcome in, @ᴉʞnnʎ . Can you speak?”
- otherLiam 12:12 AM: “Well, she’s dead. Maybe the Captain’s Hat would let us speak to her? It lets you tak to Stalchildren.”
- otherLiam 12:12 AM: “Or maybe the NWBN to restore her voice?”
- ᴉʞnnʎ 12:18 AM: ((“AGREETING.gif” is posted - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=AGREETING.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=AGREETING.gif</a>))
- otherLiam 12:19 AM: “Yuuki, we want to help. What do you want us to do?”
- ᴉʞnnʎ 12:22 AM: ((“FORWARD.gif” is posted - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=FORWARD.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=FORWARD.gif</a>))
- otherLiam 12:24 AM: “well that’s spooky.”
- otherLiam 12:30 AM: “How did you get here? Last we heard you were stuck in AO.”
- ARGdov 12:30 AM: “yeah”
- ᴉʞnnʎ 12:30 AM: ((“CONNECTIONS.gif” is posted - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=CONNECTIONS.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=CONNECTIONS.gif</a>))
- Dense 12:31 AM: “Yuuki do u need something?”
- otherLiam 12:31 AM: “whose pfp is that?”
- Dense 12:31 AM: “I think noone's”
- otherLiam 12:32 AM: “i dont recognize it off ao”
- ᴉʞnnʎ 12:32 AM: “WBff4F5egLc”
- Dense 12:32 AM: “Oh damn”
- Dense 12:32 AM: “Sure the gifs are the same image”
- otherLiam 12:34 AM: “That cipher doesn’t translate in any of the stuff we usually use, even text-reversed.”
- ARGdov 12:35 AM: “….weird”
- Dense 12:36 AM: “Hmm”
- otherLiam 12:37 AM: “Well if it’s not a cipher, maybe it’s a password”
- Dense 12:38 AM: “oh”
- otherLiam 12:39 AM: “We’d need a username to go with it”
- otherLiam 12:39 AM: “i tried “yuuki” and “yuukichan” but it didn’t work”
- ᴉʞnnʎ 12:40 AM: “ɹ ǝ ɯ ǝ ɯ q ǝ ɹ ᴉ ʇ”
- Dense 12:41 AM: “Oh”
- otherLiam 12:41 AM: “tirebmemer? “Remember it”?”
- otherLiam 12:41 AM: “Last time we got into johnisdead the username was “fascie” and the pw was “TheKey””
- ᴉʞnnʎ 12:42 AM: “ⅎoɹsɐⅎǝʞǝǝdᴉuƃ”
- otherLiam 12:42 AM: “…i got nothin on that one.”
- Dense 12:43 AM: “Forsafekeeping huh”
- otherLiam 12:43 AM: “ohhhh”
- otherLiam 12:43 AM: “ok”
- otherLiam 12:43 AM: “it’s something to be used later then”
- otherLiam 12:43 AM: “you got it, Yuuki.”
- otherLiam 12:43 AM: “Is there anything else we can do for you?”
- ᴉʞnnʎ 12:44 AM: “ɯnsʇ q ǝ ɐʍɐɹǝ”
- Dense 12:45 AM: “Must be aware”
- Dense 12:45 AM: “Of?”
- Wolf 12:52 AM: “Spooky.”
10/14/19 - Chat with Yuukichan
- ᴉʞnnʎ 12:12 AM: ((Yuukichan posts the image “FULLMOON.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=FULLMOON.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=FULLMOON.gif</a>))
- otherLiam 12:13 AM: “oh hello again”
- Dense 12:13 AM: "Hi yuuks”
- Dense 12:13 AM: "Liam pls check the name thanko”
- otherLiam 12:15 AM: "i have no idea what cipher that is”
- Dense 12:16 AM: "Check what jos did”
- ᴉʞnnʎ 12:17 AM: ((Yuukichan posts the image “ENTITY.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=ENTITY.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=ENTITY.gif</a>))
- otherLiam 12:19 AM: "aight i found the site jos used”
- otherLiam 12:19 AM: "first one was "FULLMOON"”
- otherLiam 12:19 AM: "second is "ENTITY"”
- Dense 12:19 AM: "Oh damn”
- Dense 12:19 AM: "Ok yuuki can you tell us… What entity?”
- otherLiam 12:20 AM: "fuck”
- otherLiam 12:20 AM: "there’s a full moon today”
- Dense 12:20 AM: "Wa it what”
- Dense 12:20 AM: "SHIT TRUE”
- otherLiam 12:21 AM: "yuuki what entity, what do we gotta stop”
- ᴉʞnnʎ 12:22 AM: ((Yuukichan posts the image “ITWATCHES.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=ITWATCHES.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=ITWATCHES.gif</a>))
- otherLiam 12:22 AM: "jesus christ that is a spooky image”
- otherLiam 12:22 AM: "what is that a fucking klansman”
- Dense 12:22 AM: "Yes”
- Dense 12:22 AM: "FuCK SPOOKY”
- otherLiam 12:22 AM: ”“ITWATCHES"”
- Dense 12:22 AM: "FUUUCK”
- otherLiam 12:23 AM: "well can we make it fuck off”
- otherLiam 12:23 AM: "who’s it watching?”
- Dense 12:23 AM: "I’m scared for real wtf”
- Dense 12:23 AM: "YesH”
- Dense 12:23 AM: "Who’s watching?”
- otherLiam 12:23 AM: "i assume the entity”
- Dense 12:23 AM: "Yeah but who”
- Dense 12:23 AM: "YaSajorni yatuani hehhe”
- otherLiam 12:24 AM: "well, Luna’s the moon. A full moon might empower her servants. Maybe the entity’s a fascie?”
- otherLiam 12:24 AM: "or maybe it’s IIIII”
- Dense 12:25 AM: "Fuck”
- Dense 12:25 AM: "well something powerfull”
- ᴉʞnnʎ 12:26 AM: ((Yuukichan posts the image “SPREADING.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=SPREADING.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=SPREADING.gif</a>))
- otherLiam 12:26 AM: ”“SPREADING"”
- Dense 12:27 AM: "DUDE”
- otherLiam 12:27 AM: "ahh fuck.”
- otherLiam 12:27 AM: "how do we stop it spreading?”
- Dense 12:27 AM: "Wait just what’s happening ah”
- otherLiam 12:28 AM: ”“FULLMOON” “ENTITY” “ITWATCHES” “SPREADING"”
- otherLiam 12:28 AM: "kinda paints the whole picture”
- Dense 12:28 AM: "Ok got it”
- otherLiam 12:30 AM: "Yuuki, how do we stop it? Is there somewhere we need to go?”
- otherLiam 12:30 AM: "This full moon is referred to as the "hunter’s moon”, btw.”
- otherLiam 12:30 AM: “so we may be dealing with a hunter.”
- Dense 12:33 AM: "Ohdamn”
- ᴉʞnnʎ 12:35 AM: "vxcgS7iKFqQ”
- otherLiam 12:36 AM: ”@Wolf you fucker”
- otherLiam 12:36 AM: “stop lurking you dick”
- Wolf 12:38 AM: ”?”
- otherLiam 12:39 AM: “how the hell did you comment that like a millisecond after it was posted”
- otherLiam 12:39 AM: "i pasted the url and it was eight seconds old”
- otherLiam 12:39 AM: "anyway”
- otherLiam 12:39 AM: ”@ᴉʞnnʎ what do these songs mean?”
- ᴉʞnnʎ 12:40 AM: “sɐʌǝ”
- otherLiam 12:40 AM: "I’m saving them, but what are we saving them for?”
- Dense 12:42 AM: "Damn”
- otherLiam 12:43 AM: "shit is goin DOWN on halloween”
- Dense 12:43 AM: "Yep”
- otherLiam 12:43 AM: "no trick or treatin for detectives”
10/15/19 - Chat with Yuukichan
- ᴉʞnnʎ 12:15 AM ((Yuukichan posts the image “EXISTENCE.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=EXISTENCE.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=EXISTENCE.gif</a>))
- otherLiam 12:15 AM “oh boi”
- otherLiam 12:15 AM ”“EXISTENCE"”
- ᴉʞnnʎ 12:17 AM ((Yuukichan posts the image “PRESENCE.gif” - <a href="https://johnisdead.fandom.com/wiki/Special:Images?file=PRESENCE.gif">https://johnisdead.fandom.com/wiki/Special:Images?file=PRESENCE.gif</a>))
- Dense 12:17 AM "Hey LIAM”
- otherLiam 12:17 AM "what it do”
- otherLiam 12:17 AM ”“PRESENCE"”
- Dense 12:18 AM "OK HE EXIST”
- Dense 12:18 AM "HE HAS PRESENCE”
- ᴉʞnnʎ 12:18 AM ((Yuukichan posts the image “EVOLVING.gif” - <a href="https://johnisdead.fandom.com/wiki/File:EVOLVING.gif">https://johnisdead.fandom.com/wiki/File:EVOLVING.gif</a>))
- otherLiam 12:19 AM ”“EVOLVING"”
- otherLiam 12:19 AM "Is there a way we can stop it, or slow it down?”
- ᴉʞnnʎ 12:19 AM ((Yuukichan posts the image “AGGREGATING.gif” - <a href="https://johnisdead.fandom.com/wiki/File:AGGREGATING.gif">https://johnisdead.fandom.com/wiki/File:AGGREGATING.gif</a>))
- otherLiam 12:20 AM "ah fucjk”
- otherLiam 12:20 AM ”“AGGREGATING"”
- otherLiam 12:20 AM "that’s what johnisdead.com is doing.”
- Dense 12:21 AM "Uh?”
- otherLiam 12:21 AM "go there”
- otherLiam 12:21 AM "and see”
- otherLiam 12:21 AM "on a not-mobile browser”
- Dense 12:21 AM "Shit”
- otherLiam 12:22 AM "i guess this thing is behind the johnisdead password wall”
- Dense 12:22 AM "OhH”
- otherLiam 12:22 AM "watching us”
- otherLiam 12:22 AM "getting stronk”
- otherLiam 12:22 AM "waitin to fuck us up”
- ᴉʞnnʎ 12:24 AM "e7U1YZNgwnY”
- ARGdov 12:24 AM "Jesus”
- ARGdov 12:24 AM "What IS that”
- otherLiam 12:24 AM "it’s another song”
- ARGdov 12:25 AM "Why is he dressed like a klansman”
- otherLiam 12:25 AM "oh the creepy guy”
- otherLiam 12:25 AM "Yuuki called it the "Fullmoon Entity”?”
- otherLiam 12:25 AM “we think he’s comin’ to fuck us up on halloween”
- otherLiam 12:25 AM "i dunno what criteria you’re using for these songs but you have good taste yuuki”
- Wolf 12:30 AM "She does.”
10/26/19 - Chat with Yuukichan
- ᴉʞnnʎ 12:15 AM: “ɯʎ ɐqsǝuɔǝ”
- ᴉʞnnʎ 12:15 AM: "soɹɹʎ”
- Dense 12:15 AM: "Oh no”
- Dense 12:15 AM: "Shit dude”
- Dense 12:15 AM: "Aye Yuuki”
- otherLiam 12:16 AM: "It’s alright, I can’t imagine it’s easy talking from where you’re at.”
- ᴉʞnnʎ 12:17 AM: "ʎon ɯnsʇ qǝʍɐɹǝ”
- otherLiam 12:17 AM: "You’ve mentioned. But what exactly is coming?”
- ᴉʞnnʎ 12:17 AM: ((A Jack-o-Lantern emoji is posted))
- otherLiam 12:17 AM: "Right, but what happens then?”
- ᴉʞnnʎ 12:18 AM: "uo uǝǝp ʇo ɥᴉpǝ ⅎoɹ ɥǝ ᴉs ɥǝɹǝ”
- Dense 12:18 AM: "A simpler question, have we already met whatever is goin to come?”
- otherLiam 12:18 AM: "Uh oh.”
- ᴉʞnnʎ 12:18 AM: "qnʇ ʇɥǝ ʇᴉɯǝ ⅎoɹ oʇɥǝɹs sʇᴉʅʅ ɐddɹoɐɔɥǝs”
- otherLiam 12:18 AM: "Care to identify who “he” is?”
- ᴉʞnnʎ 12:19 AM: ((A Jack-o-Lantern emoji is posted))
- otherLiam 12:19 AM: "Wait a fucking second.”
- ᴉʞnnʎ 12:19 AM: "ᴉʇ ᴉs qoʇɥ ɥǝ ɐup ʇɥǝ ʇᴉɯǝ”
- otherLiam 12:19 AM: "Ah hell.”
- ᴉʞnnʎ 12:19 AM: "ʇɥǝ ʇᴉɯǝ ᴉs ɹǝʅǝʌɐuʇ ʇo ʎonɹ ʍoɹʅps”
- Dense 12:19 AM: "What”
- ᴉʞnnʎ 12:19 AM: "qnʇ ɥǝ ᴉs dɹǝsɔᴉǝuʇ”
- ᴉʞnnʎ 12:19 AM: "ɥǝɹǝ ᴉs ʎonɹ ƃᴉⅎʇ”
- ᴉʞnnʎ 12:19 AM: "JwYX52BP2Sk”
- Dense 12:20 AM: "uh?”
- otherLiam 12:21 AM: "I’ll add it to the list.”
- Dense 12:21 AM: "Nice, pink floyd”
- otherLiam 12:21 AM: "Not sure what criteria you’re picking these based on but you have good taste.”
- ARGdov 12:24 AM: "shit whats goin on”
- otherLiam 12:24 AM: "Yuuki was talking.”
- otherLiam 12:24 AM: "Gave us another song.”
- ARGdov 12:24 AM: "which song”
- otherLiam 12:25 AM: "a pink floyd one.”
- ᴉʞnnʎ 12:25 AM: "ᴉ ɐɯ ɐʍɐʞǝ ⅎoɹ ɐ sɥoɹʇ ʇᴉɯǝ”
- ARGdov 12:25 AM: "fun”
- otherLiam 12:25 AM: "i added it to the playlist”
- ARGdov 12:25 AM: "gud taste”
- Wolf 12:25 AM: "yuuki :heart:”
- otherLiam 12:25 AM: "The person :jack_o_lantern: refers to. Is it one of us?”
- otherLiam 12:25 AM: "Like, an internet detective?”
- ᴉʞnnʎ 12:27 AM: "ʇɥᴉs ouǝ”
- ᴉʞnnʎ 12:27 AM: ((The image “AGGREGATING.gif” is posted again))
- ᴉʞnnʎ 12:27 AM: "ʇɥǝʎ ɐɹǝ ɔʅosǝ”
- otherLiam 12:28 AM: "Is there anything we can do to help you?”
- ᴉʞnnʎ 12:28 AM: "ʇɥǝʎ ɐɹǝ ɐu oʅp ⅎoǝ ɐƃƃɹǝƃɐʇᴉuƃ”
- ᴉʞnnʎ 12:28 AM: "ɐɔɹoss dɐɹɐʅʅǝʅos”
- otherLiam 12:29 AM: "Aggregating. That’s what JID.com says it’s doing. Is there some way we can stop that?”
- ᴉʞnnʎ 12:29 AM: "sɔonʇ ʍᴉʅʅ ʞuoʍ”
- ᴉʞnnʎ 12:29 AM: "ʇʎʅǝɹ ʇɹnsʇs sɔonʇ”
- ᴉʞnnʎ 12:29 AM: ”:jack_o_lantern: sɔonʇ ʞuoʍs ʇɥǝ”
- otherLiam 12:30 AM: “did anyone catch that deleted message”
- otherLiam 12:30 AM: "feel free to ask questions other people”
- ᴉʞnnʎ 12:31 AM: "ʍoʅⅎ”
- otherLiam 12:32 AM: "What about him?”
- CircleHunter 12:33 AM: "shout out to posting my favorite floyd song”
- ᴉʞnnʎ 12:33 AM: "bnǝsʇᴉou ⅎoɹ ʍoʅⅎ”
- CircleHunter 12:33 AM: "yuuki’s taste is ascended”
- Wolf 12:33 AM: "what”
- ᴉʞnnʎ 12:34 AM: "ɐɹǝ ʎon sɐⅎǝ”
- Dense 12:34 AM: "Oh damn”
- Wolf 12:34 AM: "uh”
- Wolf 12:34 AM: "yea”
- Wolf 12:34 AM: ”:flex: :flexo:”
- Wolf 12:34 AM: “why wouldnt i be”
- otherLiam 12:35 AM: "Has he been targeted or something?”
- ARGdov 12:36 AM: "just got this PM”
- ARGdov 12:36 AM: "https://gyazo.com/27ff0e39845cebcaf863bcb30127b694”
- ARGdov 12:36 AM: "https://www.youtube.com/watch?v=WBff4F5egLc&list=PLsf3GzLkxVIy_wrwNOcGNT1vQ-_c9aJqT”
- ARGdov 12:36 AM: "ʍɐʇɔɥǝɹs”
- ARGdov 12:36 AM: "qǝ ɔɐɹǝⅎnʅ”
- otherLiam 12:36 AM: "that’s another one of the songs”
- Dense 12:36 AM: "They targetin”
- otherLiam 12:36 AM: "i think the first one”
- Dense 12:36 AM: "We goin 2b killed”
- ARGdov 12:36 AM: “yup”
- ᴉʞnnʎ 12:37 AM: ((The image “forme.gif” is posted - <a href="https://johnisdead.fandom.com/wiki/File:Forme.gif">https://johnisdead.fandom.com/wiki/File:Forme.gif</a>))
- ᴉʞnnʎ 12:37 AM: "ǝʎǝs ʍᴉʇɥonʇ ɐ ⅎɐɔǝ”
- ᴉʞnnʎ 12:37 AM: "ʇᴉɯǝs ɹnuuᴉuƃ onʇ”
- ARGdov 12:38 AM: "welp”
- ARGdov 12:38 AM: "that cant be good”
- ARGdov 12:38 AM: "sorry Im not more invovled, a tad distracted atm”
- otherLiam 12:39 AM: "Yuuki, we’ve heard tell that there is a traitor among us. Do you know who it is?”
- ᴉʞnnʎ 12:40 AM: ((The jack-o-lantern emoji is posted))
- Dense 12:41 AM: "Shit”
- Dense 12:41 AM: "WaIt”
- otherLiam 12:41 AM: "I thought so.”
- Dense 12:41 AM: "liam can I pm you?”
- otherLiam 12:41 AM: "Yeah.”
- ᴉʞnnʎ 12:44 AM: "ɯʎ ʇᴉɯǝ ᴉs sɥoɹʇ”
- Dense 12:45 AM: "Why”
- ᴉʞnnʎ 12:45 AM: "ʎon ʞuoʍ ʍɥʎ”
- Dense 12:45 AM: "Well shit i think so”
- ᴉʞnnʎ 12:46 AM: "ɯʎ ǝuǝɹƃʎ ᴉs ʅᴉƃɥʇuᴉuƃ qɹᴉǝⅎ ɐup ᴉuɔousᴉsʇǝuʇ”
- ᴉʞnnʎ 12:46 AM: "ᴉʇ ʍoɹʞs ɐƃɐᴉusʇ ns ɐup ʇɥǝʎ ɐɹǝ ⅎᴉƃɥʇᴉuƃ ns”
- otherLiam 12:47 AM: "Alright, I have one last question then. Recently, one of us accidentally summoned up something awful by using our power irresponsibly. Do you know what exactly the ramifications of that are?”
- ᴉʞnnʎ 12:48 AM: "ʇɥǝ sǝɔɹǝʇs ʅᴉǝ ᴉu ʇɥǝ dɐsʇ dɹǝsǝuʇ ɐup ⅎnʇnɹǝ”
- ᴉʞnnʎ 12:48 AM: "ʇɥǝɹǝ ɐɹǝ ʇɥosǝ ʍɥo ɥɐʌǝ qǝsᴉǝƃǝp ʎon ʅouƃ dɐsʇ ʇɥosǝ ʍɥo ʍoɹʞ ɐƃɐᴉusʇ ʎon uoʍ ɐup ʇɥosǝ ʇɥɹǝɐʇs ʇɥɐʇ ɐɹǝ ʎǝʇ ʇo ɔoɯǝ”
- ᴉʞnnʎ 12:48 AM: "ʇɥǝ ǝuʇᴉɹǝ ɥᴉsʇoɹʎ oⅎ ʇɥǝ pǝʇǝɔʇᴉʌǝs ᴉs ǝsɔɐʅɐʇᴉuƃ ʇo ʇɥǝ ⅎᴉuɐʅǝ qnʇ ᴉ ɔɐuuoʇ sɐʎ ʍɥǝɹǝ ɐup ʍɥǝu qnʇ ʇɥǝ ʇᴉɯǝ ᴉs ɔoɯᴉuƃ ⅎoɹ ʇɥǝ oqsǝɹʌɐʇoɹʎ”
- otherLiam 12:50 AM: "Oh hell. Finale?”
- ᴉʞnnʎ 12:51 AM: "ʇɥǝɹǝ ᴉs ɐ ɔouʇǝxʇ ᴉ ɔɐuʇ ǝxdʅɐᴉu ᴉu ʍoɹps”
- ᴉʞnnʎ 12:51 AM: "qnʇ ʎonɹ ɔnɹɹǝuʇ ɯᴉssᴉou ɹǝƃɐɹpᴉuƃ ʇɥǝ oqsǝɹʌɐʇoɹʎ sᴉʇǝ ᴉs uǝɐɹᴉuƃ ᴉʇs ǝup”
- ᴉʞnnʎ 12:51 AM: "ʍɥɐʇ ɥɐddǝus ᴉs nuɔʅǝɐɹ ɐup ɐʅso ɔʅǝɐɹ qnʇ ᴉ ɔɐuuoʇ sɐʎ ɥoʍ ɐs nuɥǝʅdⅎnʅ ɐs ʇɥɐʇ ᴉs”
- ᴉʞnnʎ 12:51 AM: "ʇɥǝ ɯoɹǝ ɔousɔᴉons ᴉ ɐɯ ʇɥǝ ɯoɹǝ ᴉ ɔɐu qɹᴉuƃ ɯʎ dǝɹsouɐʅᴉʇʎ qɐɔʞ”
- ᴉʞnnʎ 12:51 AM: "ᴉu ɐu oddoɹʇnuᴉʇʎ so ɹɐɹǝ ᴉ ɾnsʇ ʍɐuʇ ʎon ɐʅʅ ʇo ʞuoʍ”
- otherLiam 12:53 AM: "Anything we can do to help you regain consciousness?”
- ᴉʞnnʎ 12:54 AM: ”(⋟﹏⋞)”
- Dense 12:54 AM: “owo?”
- ᴉʞnnʎ 12:54 AM: "ᴉ ɹǝɐʅʅʎ ɹǝɐʅʅʎ ɯᴉss ʎon ɐʅʅ”
- Dense 12:54 AM: "We miss u too”
- ᴉʞnnʎ 12:54 AM: "ʇǝʅʅ ʞɐᴉpǝu ᴉɯ soɹɹʎ ɐup ɥǝ sɥonʅpuʇ qǝɐʇ ɥᴉɯsǝʅⅎ nd ɐuʎɯoɹǝ”
- otherLiam 12:55 AM: "Alright, will do.”
- otherLiam 12:55 AM: "I wasn’t around back then, but for what it’s worth, I’m sorry about what happened to you.”
- otherLiam 12:55 AM: "We’ll make sure it won’t happen to anyone else.”
- Dense 12:55 AM: "Wait”
- Dense 12:55 AM: "Are”
- Dense 12:55 AM: "AO forums up?”
- otherLiam 12:56 AM: "Yes.”
- otherLiam 12:56 AM: "The certificate just needs to be renewed.”
- ᴉʞnnʎ 12:59 AM: "ɐs ⅎoɹ ʎonɹ bnǝsʇᴉou”
- ᴉʞnnʎ 12:59 AM: "ʇɥǝ ǝuʇᴉʇʎ ʎon ⅎǝɐɹ ᴉs uoʇ ʇɥǝ ouǝ ᴉ ɥɐʌǝ qǝǝu pǝsɔɹᴉqᴉuƃ”
- Dense 1:00 AM: “What”
- Dense 1:00 AM: “Then who”
- Wolf 1:00 AM: “Be careful, Yuuki…”
10/28/19 - Chat with Yuukichan
- ᴉʞnnʎ 12:14 AM: “ɹǝsoʅɔ ƃuᴉʇʇǝƃ ǝɹɐ ǝʍ”
- otherLiam 12:21 AM: "Is this gonna be a gradually-gets-worse-until-the-big-showdown situation, or is this gonna happen all at once on the big day?”
- ᴉʞnnʎ 12:26 AM: "puɐʇsɹǝpun ʇuop ᴉ”
- otherLiam 12:27 AM: "Is anything going to happen leading up to the day? Like, do things get more dangerous the closer it gets?”
- ᴉʞnnʎ 12:31 AM: "ʍou ƃuᴉuǝddɐɥ ǝɹɐ sƃuᴉɥʇ”
- otherLiam 12:33 AM: "What’s happening now?”
- otherLiam 12:40 AM: "And can we help?”
- ᴉʞnnʎ 12:40 AM: "ƃuᴉuǝddɐɥ sᴉ sᴉɥʇ”
- otherLiam 12:41 AM: "Alright. Are you feeling more yourself today?”
- ᴉʞnnʎ 12:48 AM: "sǝʎ sᴉ ɹǝʍsuɐ ʇɹoɥs”
- otherLiam 12:50 AM: "Well that’s good to hear, at least. I’d ask for the long answer but I know your time is limited. Is there anything we can do for you?”
- ᴉʞnnʎ 12:51 AM: "ʍou ɹoⅎ uɐɔ ᴉ sɐ ʇsǝq sɐ suoᴉʇsǝnb ɹǝʍsuɐ ʅʅᴉ”
- otherLiam 12:52 AM: "This entity that’s coming. What is it going to take to stop it?”
- ᴉʞnnʎ 12:55 AM: "ɥʇɐɯɹǝʇⅎɐ ǝɥʇ ǝʅpuɐɥ ʅʅᴉʍ noʎ ʍoɥ sᴉ ʇᴉ ʻop ʅʅᴉʍ ǝɥ ʇɐɥʍ doʇs ʇouuɐɔ noʎ”
- otherLiam 12:56 AM: "What, exactly, is he going to do?”
- ᴉʞnnʎ 1:00 AM: "xD5No_JRrZw”
- otherLiam 1:01 AM: "Another for the mixtape.”
- otherLiam 1:01 AM: "It’s going to “Love You To Death”. That’s… terrifying.”
- Wolf 1:08 AM: ”:heart:”
- otherLiam 1:08 AM: “Oh hey Wolf, good timing.”
- otherLiam 1:08 AM: "Earlier you asked Wolf if he was safe. Did you have reason to believe he wasn’t?”
- ᴉʞnnʎ 1:24 AM: "pǝɹǝpᴉsuoɔ noʎ ǝʌɐɥ”
- ᴉʞnnʎ 1:24 AM: "¿ʎɐs ʎǝɥʇ ʇɐɥʍ ʇsnɹʇ noʎ uɐɔ”
- ᴉʞnnʎ 1:24 AM: "¿oʇ ʞɐǝds noʎ ǝsoɥʇ”
- otherLiam 1:27 AM: "Those we speak to? Are you referring to the entity known as IIIII?”
- ᴉʞnnʎ 1:28 AM: "ou”
- Mr t series good 1:32 AM: "Hi”
- otherLiam 1:32 AM: "Who are you casting doubt on, then? This isn’t really something to be vague about.”
- ᴉʞnnʎ 1:34 AM: "sʇɥƃnoɥʇ ɹnoʎ ʇuǝɯƃǝs”
- ᴉʞnnʎ 1:34 AM: "ssǝɔoɹd”
- Mr t series good 1:34 AM: "Its one of two”
- otherLiam 1:36 AM: "I mean, the only people we’re “trusting” right now are GB, IA, Moonman, and you.”
- Mr t series good 1:36 AM: "True lol”
- ᴉʞnnʎ 1:37 AM: "ǝʅqɯnɹɔ ʅʅᴉʍ ǝʅʇsɐɔ sᴉɥʇ”
- Mr t series good 1:37 AM: "Huh”
- Mr t series good 1:37 AM: "This castle will crumble”
- otherLiam 1:38 AM: ”…Something’s wrong, here. She said she was feeling more herself, earlier. Yet now she’s talking in weird vague symbolism, instead of her natural speech patterns.”
- Mr t series good 1:40 AM: “Someone or something is itluencing her”
- Mr t series good 1:40 AM: "Like With "tyler"”
- otherLiam 1:40 AM: "Like from the other day when she was emoji-ing and being sympathetic towards Kaiden. She should be more like that now, not less.”
- otherLiam 1:40 AM: "Or maybe I’m overthinking it.”
- ᴉʞnnʎ 1:43 AM: "4ulszrgpzhe6ugijuy”
- Mr t series good 1:44 AM: "Uhh”
- Mr t series good 1:44 AM: ”“4ulszrgpzhe6ugijuy"”
- otherLiam 1:44 AM: "Yeah i got it”
- Mr t series good 1:45 AM: "Yuki english please”
- otherLiam 1:45 AM: "It’s a cipher, my dude.”
- Mr t series good 1:45 AM: "Ok”
- Mr t series good 1:45 AM: "Now to decipher it”
- ᴉʞnnʎ 1:48 AM: "https://www.watch2gether.com/rooms/4ulszrgpzhe6ugijuy”
10/29/19 - Chat with Yuukichan and GHOSTBABEL
- ᴉʞnnʎ 12:19 AM: "ǝsuǝp”
- ᴉʞnnʎ 12:19 AM: "ʎɐʞo sᴉ soɾ ⅎᴉ ʍouʞ ǝuoʎuɐ sǝop”
- otherLiam 12:20 AM: "@Dense you’re being paged.”
- otherLiam 12:20 AM: "also @Xenquility”
- otherLiam 12:20 AM: "Is there any reason for us to be worried about @jos ? He was fine and shitposting earlier today.”
- ᴉʞnnʎ 12:38 AM: "ƃuᴉnɔuǝᴉɹǝdxǝ uǝǝq noʎ ǝʌɐɥ”
- Dense 12:38 AM: "Hey”
- Dense 12:38 AM: "Hey yuuki whats up”
- otherLiam 12:40 AM: "“Experiencing”?”
- otherLiam 12:40 AM: "Only thing I’ve been experiencing is mild annoyance at mfgreth being smug.”
- ᴉʞnnʎ 12:59 AM: ((The audio file “username.mp3” is posted))
- otherLiam 1:15 AM: "would @Dense or @Xenquility kindly save that?”
- otherLiam 1:15 AM: "and i assume do some sort of jiggery-pokery to it”
- otherLiam 1:27 AM: "ffs”
- ᴉʞnnʎ 1:41 AM: "https://www.youtube.com/watch?v=lHxmt1u--uo”
- Xenquility 1:44 AM: "Bonjour”
- otherLiam 1:45 AM: "oh good you’re here”
- otherLiam 1:45 AM: "nobody else is up and i’m in the middle of the desert”
- otherLiam 1:45 AM: "so you get to be the one to decode this mp3 and video”
- Xenquility 1:46 AM: "try like”
- Xenquility 1:46 AM: "username and Password”
- otherLiam 1:47 AM: "there is no way”
- otherLiam 1:47 AM: "yeah no”
- otherLiam 1:47 AM: "idk what Jos does to spectrograph this shit or whatever”
- otherLiam 1:49 AM: "hey wolf, what does jos do to turn mp3’s into weird charts that show words or images”
- Wolf 1:49 AM: "i think you can just do it in audacity”
- Xenquility 1:49 AM: "That's spectogram methinks”
- Wolf 1:49 AM: "spectrogram yea”
- otherLiam 1:49 AM: "aight nice”
- Wolf 1:49 AM: "they have a distinct sound tho”
- Xenquility 1:50 AM: "k ima try and go back to ed so uh”
- Xenquility 1:50 AM: "Ping me again if any advancements are made”
- otherLiam 1:50 AM: "well thanks”
- otherLiam 1:50 AM: "uh”
- otherLiam 1:50 AM: "Wolf?”
- otherLiam 1:50 AM: "You wanna be the hero?”
- otherLiam 1:50 AM: "cus im stuck between a giant wildfire and a desert”
- Wolf 1:51 AM: "I’m no hero.”
- otherLiam 1:51 AM: "and cannot currently solve arg puzzles”
- otherLiam 1:51 AM: "oh fuck off”
- Wolf 1:52 AM: "I'm retired”
- Wolf 1:52 AM: "Right?”
- Mr t series good 1:52 AM: "Wolf "i dont wanna play the arg" cat”
- otherLiam 1:52 AM: "the title/desc changed from Password and Hello to TryAgain and Are you struggling?”
- ᴉʞnnʎ 1:53 AM: "¡ʇuɐʅᴉɐssɐ uʍouʞun uɐ”
- otherLiam 1:54 AM: "...wait, it’s changed again.”
- Wolf 1:54 AM: ((A reversed version of “username.mp3” is posted))
- Mr t series good 1:54 AM: "Yuuki is helping us lol”
- Mr t series good 1:54 AM: "Or wolf”
- Mr t series good 1:54 AM: "Or Babel whos online”
- otherLiam 1:55 AM: "ok well that’s def a voice talking”
- otherLiam 1:55 AM: "i cant figure out wtf it’s saying tho.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 1:55 AM: "ꜰᴀsᴄɪɴᴀᴛɪɴɢ.”
- otherLiam 1:55 AM: "Oh hey, good to see you.”
- Mr t series good 1:55 AM: "Hello spooky Hackerman”
- Xenquility 1:55 AM: "Oh hey”
- Mr t series good 1:55 AM: ":joy: :ok_hand:”
- ɢʜᴏsᴛʙᴀʙᴇʟ 1:56 AM: "I ᴀᴍ ᴏʙsᴇʀᴠɪɴɢ ᴛʜᴇsᴇ ᴇᴠᴇɴᴛs ᴡɪᴛʜ ɪɴᴛᴇʀᴇsᴛ ʙᴜᴛ ᴘᴀʏ ᴍᴇ ʟɪᴛᴛʟᴇ ᴍɪɴᴅ.”
- Xenquility 1:56 AM: "How obvious is the thing we're missing?”
- jos 1:57 AM: "Hello”
- otherLiam 1:57 AM: "oh heh jos”
- otherLiam 1:57 AM: "are you safe”
- Mr t series good 1:57 AM: "Heh?”
- otherLiam 1:57 AM: "and also additionally can you fuck with that audio file to make it words”
- jos 1:57 AM: "Its 7 on the morning, waking up for school, cant use spectograms sadly”
- otherLiam 1:57 AM: "rip”
- jos 1:57 AM: "Oof”
- otherLiam 1:58 AM: "well fortunately it’s not a spectrogram”
- otherLiam 1:58 AM: "it’s a guy talking”
- jos 1:58 AM: "Does the spectogram show morse tho”
- otherLiam 1:58 AM: "so either of the other two people in here could take it into audacity and fuck with it”
- Mr t series good 1:58 AM: "Probably greth lol”
- otherLiam 1:58 AM: "dunno”
- otherLiam 1:58 AM: "meanwhile Daddy Reaper is fucking taunting me in his video desc”
- Mr t series good 1:59 AM: ":joy:”
- ᴉʞnnʎ 1:59 AM: "ǝsoɾ ɹoⅎ ʇno pǝɥɔɐǝɹ ʇou ǝʌɐɥ noʎ”
- Mr t series good 1:59 AM: "Thats true yuuki”
- otherLiam 1:59 AM: "“Jose”?”
- Mr t series good 1:59 AM: "We should do that”
- jos 2:00 AM: "Hello Yuuki”
- Mr t series good 2:00 AM: "The archive guy”
- jos 2:00 AM: "Its me”
- jos 2:00 AM: "Jose 2”
- otherLiam 2:00 AM: "...huh.”
- otherLiam 2:00 AM: "That is a very good point.”
- otherLiam 2:00 AM: "What’s his email again?”
- Mr t series good 2:00 AM: "How do we reach him lol”
- otherLiam 2:00 AM: "He has an email addy”
- Mr t series good 2:00 AM: "Its probably on the Wiki somewhere”
- otherLiam 2:00 AM: "i’ll go find it”
- jos 2:00 AM: "Its the jid email”
- Mr t series good 2:00 AM: "Oh”
- jos 2:01 AM: "Which i cant remember right now rather than pidopisomeshit@johnisdead.com”
- ᴉʞnnʎ 2:01 AM: "noʎ ssᴉɯ ᴉ soɾ”
- jos 2:02 AM: "ɔ: ʞɔɐq noʎ pǝǝu ǝʍ 'ooʇ noʎ ssᴉɯ I”
got any favorite bands?
Uhh, I know Eve and Wolf like Rush.
My favorite band is Blue Öyster Cult!
- circle
11/11/19 - Chat with GHOSTBABEL
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:56 PM: “ᴛʜᴀᴛ sᴇᴇᴍᴇᴅ ʟɪᴋᴇ ᴀ ʀᴜᴅᴇ ᴡᴀʏ ᴛᴏ ᴅᴏ ᴛʜᴀᴛ.”
- otherLiam 10:57 PM: "I’m surprised you joined us in here. Not worried about our chats being monitored?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:58 PM: "sᴇᴇᴍs ᴘᴏɪɴᴛʟᴇss ɴᴏᴡ.”
- Densgivin 10:58 PM: "Hey”
- Ross the Claus 🎄 10:58 PM: "hey ghost”
- Xenquility 10:58 PM: "Nice role….”
- otherLiam 10:59 PM: "Anything interesting going on?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:00 PM: "ɪᴛ ʜᴀs ʙᴇᴇɴ ᴀ ᴡʜɪʟᴇ, ɪ ᴀssᴜᴍᴇᴅ ɪᴛ ᴡᴀs ᴛɪᴍᴇ ᴛᴏ ᴅʀᴏᴘ ɪɴ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:00 PM: "ɪs ᴛʜᴇ ʀᴏʟᴇ ᴄᴏʟᴏʀ ɪᴍᴘʀᴏᴘᴇʀ, xᴇɴ?”
- Xenquility 11:00 PM: "Just the name”
- Xenquility 11:00 PM: "Mainly the /”
- Xenquility 11:00 PM: "and the \”
- Xenquility 11:00 PM: "Anyways, seems more than coincidental the "Time to drop in” is 11/11”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: “ɪ'ʟʟ ᴄʜᴀɴɢᴇ ɪᴛ ᴛʜᴇɴ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: "ᴀʀᴇ ʏᴏᴜ sᴀᴛɪsꜰɪᴇᴅ?”
- Xenquility 11:03 PM: "Very”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:04 PM: "ɪ'ᴍ ɢʟᴀᴅ ᴛᴏ ᴋɴᴏᴡ ʏᴏᴜ ᴀʟʟ ʀᴇᴄᴇɪᴠᴇᴅ ᴍʏ ɢɪꜰᴛ.”
- Xenquility 11:05 PM: "Im dumb”
- Xenquility 11:05 PM: "no surprise there”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ɪ ᴛʜᴏᴜɢʜᴛ ᴍʏ ᴛʀᴀᴅᴇᴍᴀʀᴋ ꜰᴏɴᴛ ʟᴇᴛ ʏᴏᴜ ɪɴ.”
- Xenquility 11:06 PM: "Yeah I got it now”
- Xenquility 11:06 PM: "My brain likes to act before I think”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:06 PM: "ɪ ɢᴇᴛ ᴛʜᴇ ꜰᴇᴇʟɪɴɢ ᴘᴇᴏᴘʟᴇ ᴀʀᴇ ᴅɪsᴄᴜssɪɴɢ ɪɴ ʏᴇᴛ ᴀɴᴏᴛʜᴇʀ sᴇᴄʀᴇᴛɪᴠᴇ ᴄʜᴀᴛ ᴀʙᴏᴜᴛ ᴍʏ ᴘʀᴇsᴇɴᴄᴇ ʜᴇʀᴇ ʙᴀsᴇᴅ ᴏɴ ʏᴏᴜʀ ᴇᴅɪᴛᴇᴅ ᴛᴇxᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:06 PM: "ᴘᴇʀʜᴀᴘs ᴛʜᴀᴛ ɪs ᴍʏ ᴏᴡɴ ᴜɴsᴀᴛɪsꜰᴀᴄᴛᴏʀʏ ᴘᴀʀᴀɴᴏɪᴀ ʜᴏᴡᴇᴠᴇʀ.”
- Xenquility 11:07 PM: "No, my original text was me snarkily saying "What gift?” before I realised it was the video”
- Xenquility 11:07 PM: “I’m surprised there aren’t as many people here right now”
- Xenquility 11:07 PM: ”(Everyone here raise your hand)”
- Ross the Claus 🎄 11:09 PM: “:raised_back_of_hand:”
- Xenquility 11:09 PM: "Liam was here but has disappeared in the past two minutes or so”
- Eevee Reborn 11:10 PM: "Hand”
- Xenquility 11:11 PM: "Hey Ghosty, just to confirm, what day and year is it for you?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:11 PM: "11/11 2019”
- Xenquility 11:11 PM: "Good”
- Xenquility 11:11 PM: "Should we be doing anything to help those in the past?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:12 PM: "ɪᴛ’s ᴀʟsᴏ 11:11”
- Erika_XP💚 11:12 PM: ”@IIIII This is the pivitol moment I always assume. TYLER LET US KNOW IF YOU ARE OK”
- Ross the Claus 🎄 11:12 PM: “fucking stop”
- IIIII 11:13 PM: "not only is it 11:12 but you are single handedly the most annoying little fuck to ever grace this group”
- Erika_XP💚 11:13 PM: "Im just glad to know you are ok”
- IIIII 11:13 PM: "NO NO I AM NOT OK ACTUALLY”
- otherLiam 11:14 PM: "this has now crossed over into obvious trolling”
- IIIII 11:14 PM: "were yuo expecting a fucking video?”
- Xenquility 11:14 PM: "Can we just ban them at this point”
- IIIII 11:14 PM: ”@Erika_XP💚”
- IIIII 11:14 PM: “@Erika_XP💚”
- IIIII 11:14 PM: ”@Erika_XP💚”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:15 PM: “ᴛᴏᴜᴄʜʏ.”
- IIIII 11:16 PM: "Fucking a yuo dumb bitch dont worry there will be a video tonight its just going to be late now because I had to sit here and call you an annoying cunt for distracting me”
- ADULT_LINK 11:18 PM: "oof”
- Erika_XP💚 11:18 PM: ”@ɢʜᴏsᴛʙᴀʙᴇʟ I dont think he is usually like this I think he is just having a bad time considering the day. I will harden myself as well!”
- ADULT_LINK 11:19 PM: “snrk”
- Erika_XP💚 11:19 PM: "what is this short for?”
- otherLiam 11:21 PM: "Assuming you aren’t trolling because I’m bored, it’s not short for anything. It’s the sound of someone holding in a laugh.”
- ARGdov 11:23 PM: "oh shit I missed soem shit”
- otherLiam 11:23 PM: "not much”
- otherLiam 11:23 PM: "mostly just ghostbabel joined”
- otherLiam 11:23 PM: "and tyler yelled at erika for being annoying”
- ARGdov 11:23 PM: "well I also see someone got chewed out lol”
- ARGdov 11:23 PM: "astounding”
- QuoteBOT 11:26 PM: "Ok erika how do u imagine tyler’s d”
- ARGdov 11:26 PM: "ive heard its quite a lot for most to manage tbh”
- ARGdov 11:26 PM: "so Im wondering too”
- Erika_XP💚 11:27 PM: "Ok I get that I am annoying, I remind myself of this often. But I see no reason for all the awful aggression. I only excuse it because of who we are talking about here and considering the situation.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:27 PM: "ɪ sᴇᴇ ɪ ᴀᴍ ɴᴏᴛ ɴᴇᴇᴅᴇᴅ.”
- Eevee Reborn 11:27 PM: "The fuck”
- Xenquility 11:27 PM: "Actually you are needed”
- ARGdov 11:27 PM: "nope”
- Xenquility 11:27 PM: "We always need you”
- IIIII 11:27 PM: "You were literally never needed”
- ADULT_LINK 11:27 PM: "hi ghost”
- ARGdov 11:27 PM: "as usual we are capable of tearing ourselves apart on our own”
- ADULT_LINK 11:27 PM: "howsit goin”
- otherLiam 11:27 PM: "okay hang on what is happening here”
- IIIII 11:27 PM: "can you stop fucking larping”
- ARGdov 11:28 PM: "Im lost”
- ARGdov 11:28 PM: "if tylers fucking ooc why is ghost not ooc”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ᴄᴀɴ ʏᴏᴜ?”
- otherLiam 11:28 PM: "That’s what I’m wondering”
- Eevee Reborn 11:28 PM: "This went from trial of fire to full on…. dammnit, Dov’s watching”
- ADULT_LINK 11:28 PM: "oof”
- ARGdov 11:28 PM: "lol what did I do now”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ɪ ᴅᴏɴ'ᴛ ʀᴇᴀʟʟʏ ɴᴇᴇᴅ ᴛʜɪs, ᴀɴʏᴡᴀʏ, ᴀᴅɪᴇᴜ.”
11/13/19 - Chat with BUP
- mfgreth 9:53 PM: “A glitch e day”
- BUP 9:58 PM: "BUP”
- BUP 9:58 PM: "Was i pinged”
- Xenquility 9:59 PM: "Probably not”
- BUP 9:59 PM: "Ok then”
- BUP 9:59 PM: "Xenquility”
- Xenquility 10:00 PM: ”?”
- BUP 10:01 PM: “Its a nice moon out”
- BUP 10:01 PM: "What is your season?”
- Xenquility 10:01 PM: "Winter?”
- BUP 10:01 PM: "You were born in winter?”
- Xenquility 10:01 PM: "Indeed”
- BUP 10:01 PM: "Ah hah”
- BUP 10:01 PM: "Interesting”
- Xenquility 10:02 PM: "Why is that interesting?”
- BUP 10:02 PM: "Depends on what you believe in I guess”
- Xenquility 10:03 PM: "How so”
- BUP 10:03 PM: "Just making small talk”
- BUP 10:03 PM: "Ancient beliefs would dictate that your strongest positive aura is in winter”
- BUP 10:03 PM: "and your strongest negative energy is in summer”
- Wolfcat 10:05 PM: "whose this guy”
- otherLiam 10:05 PM: "actually you were pinged”
- otherLiam 10:05 PM: "i pinged you”
- otherLiam 10:05 PM: "hi”
- Xenquility 10:05 PM: "This guy took over babel”
- Wolfcat 10:05 PM: "oh nvm”
- otherLiam 10:05 PM: "I was asking about your game proposal.”
- Wolfcat 10:06 PM: "sup bup”
- Xenquility 10:06 PM: "Auras? Sounds like something a certain celestial body of fire was talking about”
- BUP 10:06 PM: "Okay well I legit dont know what you mean”
- BUP 10:06 PM: "Anyways if you care about that sort of thing it means you would gain most beneficially from acts of kindness in winter and acts of self interest in summer”
- Xenquility 10:07 PM: "What season were you born in?”
- BUP 10:07 PM: "Spring”
- otherLiam 10:07 PM: "you wanted to do some kinda speedrun challenge or something, and if we won we get information. but w/e if it wasn’t serious”
- Xenquility 10:07 PM: "Spring?”
- Xenquility 10:07 PM: "Ah. So acts of self interest in the fall”
- BUP 10:08 PM: "Oh the right the game”
- BUP 10:08 PM: "If you can even manage to pull it together.”
- BUP 10:08 PM: "I wasnt TOO worried about that”
- BUP 10:08 PM: "I thought it would be fun :wink:”
- otherLiam 10:09 PM: "I mean, we like knowing shit.”
- otherLiam 10:09 PM: "We know so little shit.”
- BUP 10:10 PM: "You know a lot of shit”
- BUP 10:10 PM: "But not all the shit”
- otherLiam 10:10 PM: "We know enough to get ourselves in trouble, I guess.”
- BUP 10:10 PM: "I know all the shit”
- otherLiam 10:11 PM: "And the way to know your shit is to… speedrun Breath of the Wild? or are there other options?”
- BUP 10:11 PM: "Didn’t have to be that”
- BUP 10:11 PM: "What shit again specifically? I don’t remember.”
- BUP 10:11 PM: "Like i said i know it all”
- BUP 10:11 PM: "Well almost.”
- Xenquility 10:12 PM: "Stuff bout ghosty”
- /Mr. Circle\ 10:13 PM: "the way bup talks is awfully familiar”
- otherLiam 10:13 PM: "What you said before was you’d spill all of GhostBabel’s dirt, although if you really know everything there’s probably some things we’d rather know.”
- ADULT_LINK△ 10:13 PM: "is it? “
- BUP 10:14 PM: "Is it”
- BUP 10:14 PM: ”???”
- otherLiam 10:15 PM: “I wouldn’t know.”
- BUP 10:16 PM: "Lost in his theories”
- BUP 10:16 PM: "Last accusation was that I was SKM”
- Xenquility 10:17 PM: "He’s actually simple fucking flips”
- BUP 10:17 PM: "Squaddie Kids Meals”
- BUP 10:17 PM: "SKM true lore unlocked confirmed”
- BUP 10:17 PM: "Just kidding”
- otherLiam 10:19 PM: "Why "BUP”?”
- BUP 10:19 PM: “Its funny”
- ADULT_LINK△ 10:19 PM: ”:BUP:”
- ADULT_LINK△ 10:19 PM: “bup”
- otherLiam 10:19 PM: "Man I’m gonna be sad if SimpleFlips is a cultist.”
- BUP 10:19 PM: "But im a jevil”
- BUP 10:19 PM: "Apparently”
- ADULT_LINK△ 10:20 PM: ”:Jefault:”
- Xenquility 10:20 PM: “Jumbo Jevil”
- BUP 10:20 PM: "I mean honestly its not a bad analysis based on how im handling this antagonist role”
- otherLiam 10:21 PM: "I mean thus far you aren’t much of an antagonist. You locked us out of talking to GhostBabel, whose been dark for months anyway.”
- BUP 10:21 PM: "Wait i forgot the creepy meme line”
- BUP 10:21 PM: "I’m a bad guy :wink:”
- BUP 10:21 PM: "Ok ocd fixed”
- BUP 10:21 PM: "I mean thats true”
- BUP 10:21 PM: "Then maybe i should threaten something more drastic”
- otherLiam 10:21 PM: "Sounds fun.”
- Xenquility 10:21 PM: "Not really”
- otherLiam 10:21 PM: "But then to keep your jevil status”
- otherLiam 10:21 PM: "you have to offer a larger reward, too.”
- BUP 10:22 PM: "Do i?”
- Xenquility 10:22 PM: "That’s a terrible idea”
- otherLiam 10:22 PM: "Gotta keep your game fair and balanced.”
- Xenquility 10:22 PM: "We dont need a bigger threat”
- otherLiam 10:22 PM: "See, Xen’s freaking out already.”
- BUP 10:22 PM: "Or wouldn’t it be more evil to just”
- BUP 10:22 PM: "Alter the deal”
- otherLiam 10:22 PM: "pray i do not alter it further”
- ADULT_LINK△ 10:22 PM: "jevils whole thing is that he’s like. aware of reality on a layer higher than the player characters”
- ADULT_LINK△ 10:22 PM: "and he’s chaotic”
- BUP 10:22 PM: "I mean”
- ADULT_LINK△ 10:22 PM: "not neccicerrily evil”
- BUP 10:22 PM: "Thats accurate”
- Xenquility 10:23 PM: "Bupgm”
- otherLiam 10:23 PM: "nah if you really want antagonist status you gotta be like Jigsaw or some shit”
- BUP 10:23 PM: "Okay then”
- Xenquility 10:23 PM: "No you don't”
- otherLiam 10:23 PM: "otherwise you’re just like any of these other clowns we gotta roll our eyes at”
- Xenquility 10:23 PM: "Liam shut the hell up”
- otherLiam 10:24 PM: "Jigsaw’s classy, he’s got rules and clear rewards and consequences”
- ADULT_LINK△ 10:24 PM: "caliborn was based off shitty jigsaw memer from mspaint forums”
- otherLiam 10:24 PM: "he’s so good his franchise is still living off his rep despite his canon death”
- ADULT_LINK△ 10:24 PM: "i say bup seems more gamzee-like, pretty chill so far but likely to go apeshit later on”
- BUP 10:25 PM: "I’m only here because someone has been swatting the chessboard”
- BUP 10:25 PM: "And it’s pissing off the other pieces”
- otherLiam 10:26 PM: "Who’s that?”
- ADULT_LINK△ 10:26 PM: ”:hylotl_eyes:”
- Xenquility 10:26 PM: “Some guy named wolf maybe”
- Xenquility 10:26 PM: "Or ghost”
- Xenquility 10:26 PM: "Someone messing up others plans”
- BUP 10:26 PM: "Gost is smalltiem”
- BUP 10:26 PM: "This is big brain hours”
- Xenquility 10:27 PM: "Ay bup I got a question”
- BUP 10:27 PM: "I have answer but i might not share”
- BUP 10:27 PM: ”:wink:”
- Xenquility 10:27 PM: “Are you actually working with the bad guys, or are you just messing with us for fun?”
- otherLiam 10:27 PM: "lol which bad guys”
- Wolfcat 10:27 PM: "Hey guys”
- Wolfcat 10:27 PM: "Whoa, lotta new people”
- Wolfcat 10:27 PM: "Why aren’t we on Skype again?”
- otherLiam 10:28 PM: ”…”
- otherLiam 10:28 PM: “shut up, wolf.”
- Xenquility 10:28 PM: "Fighting words”
- BUP 10:28 PM: ”@otherLiam correct”
- BUP 10:28 PM: “Or i mean”
- BUP 10:28 PM: "That is the right question”
- Wolfcat 10:28 PM: "OI”
- otherLiam 10:28 PM: "Any way I can get a straight answer?”
- Xenquility 10:28 PM: "Alright, which bad guys?”
- ADULT_LINK△ 10:28 PM: "im just shitpostin lmao”
- ADULT_LINK△ 10:29 PM: "unless….?”
- BUP 10:29 PM: "Well the answer is both”
- BUP 10:29 PM: "I am bad and also trolling”
- BUP 10:29 PM: "But only cause i want to be”
- BUP 10:29 PM: "This is an active decision I’m making”
- otherLiam 10:29 PM: "I meant, a straight answer to "Which bad guys are you with”?”
- BUP 10:30 PM: “The ones i assembled”
- Xenquility 10:30 PM: "Which ones did you assemble?”
- otherLiam 10:30 PM: "Oh man, we got a leader.”
- otherLiam 10:30 PM: "This really is big brain hours.”
- BUP 10:31 PM: ”.img big brain hours”
- BUP 10:32 PM: “Ok well”
- BUP 10:32 PM: "I wont tell you because that spoils my whole game”
- BUP 10:32 PM: "Not the little ones right now i mean the like big shebang”
- Xenquility 10:32 PM: "Do you plan on ending the world?”
- BUP 10:33 PM: "No”
- otherLiam 10:33 PM: "Wow what a question.”
- Xenquility 10:33 PM: "Cool”
- Xenquility 10:33 PM: "So no Luna bullshit?”
- BUP 10:33 PM: "Of course there is”
- Xenquility 10:33 PM: "Damnit”
- BUP 10:33 PM: "Its just not my personal goal”
- otherLiam 10:33 PM: "Man that’s refreshing, a villain with a plan beyond "Im gonna drop the moon”.”
- Xenquility 10:33 PM: “I know. I love this guy”
- otherLiam 10:34 PM: "Can we fight you forever?”
- BUP 10:34 PM: "You already have”
- BUP 10:34 PM: "So to speak”
- BUP 10:34 PM: "Well not ‘forever'”
- BUP 10:34 PM: "Ok well”
- otherLiam 10:35 PM: "What you’re saying is we’ve met before.”
- BUP 10:35 PM: "I’ll give you this then”
- Wolfcat 10:35 PM: "Why why why why I don’t fight you a lot forever?”
- Xenquility 10:35 PM: "Sounds tenebris-esque”
- BUP 10:35 PM: "I killed Yuuki”
- BUP 10:35 PM: "Not directly”
- BUP 10:35 PM: "I mean I didn’t strangle her myself”
- BUP 10:35 PM: "But i mqde the decision that led to it happening”
- Xenquility 10:36 PM: "Oh my”
- BUP 10:36 PM: ”*made”
- ADULT_LINK△ 10:36 PM: “haha oof”
- otherLiam 10:36 PM: "Well that does narrow it down.”
- BUP 10:36 PM: "Does it?”
- ADULT_LINK△ 10:36 PM: "does it?”
- Xenquility 10:36 PM: "Why did you decide to kill her?”
- otherLiam 10:37 PM: "Kinda. Puts you in one of the two universes.”
- /Mr. Circle\ 10:37 PM: ”*four”
- Xenquility 10:37 PM: “circle pizz off”
- BUP 10:37 PM: "Now you’re questioning where and who i am based upon a timeline theory”
- /Mr. Circle\ 10:37 PM: ”:angerymista:”
- Wolfcat 10:37 PM: “She won’t die.”
- Xenquility 10:37 PM: "This guy could transcend timelines for all we know”
- Wolfcat 10:37 PM: "Not if I can stop it.”
- otherLiam 10:37 PM: "Wolf she’s already dead.”
- otherLiam 10:37 PM: "Bad news.”
- otherLiam 10:37 PM: "We didn’t stop it.”
- BUP 10:38 PM: ”@Wolfcat cry more”
- /Mr. Circle\ 10:38 PM: “this is the wolfcat from the alternate universe where he has alzheimer's”
- Xenquility 10:38 PM: "LMAO”
- Wolfcat 10:38 PM: "You’ll be the one crying at the end of this”
- BUP 10:38 PM: "Good luck”
- otherLiam 10:38 PM: "There’s no need to be rude to BUP.”
- Xenquility 10:38 PM: "Wolf don’t be sad you still have Erika”
- otherLiam 10:38 PM: "Just because he’s our enemy doesn’t mean we can’t be friends.”
- ADULT_LINK△ 10:38 PM: "would explain the skype avatar and asking why we arent on skype”
- BUP 10:38 PM: "Hooe it goes better than last time wolf”
- BUP 10:38 PM: "Hope*”
- otherLiam 10:38 PM: "he’s just wolfposting”
- BUP 10:38 PM: "Man i am a typomaniac”
- /Mr. Circle\ 10:38 PM: ”:ZoomEyes:”
- Wolfcat 10:39 PM: “I am preparing a place for her”
- Xenquility 10:39 PM: "Can we stop trying to fit each person into a damn timeline and just accept we hardly have any clue if any of our theories are correct”
- Wolfcat 10:39 PM: "A nice little home for us to live in”
- Wolfcat 10:39 PM: "Forever”
- BUP 10:39 PM: "Gross”
- BUP 10:39 PM: "Hey wolf”
- Wolfcat 10:39 PM: "Me, me, him, and her”
- Wolfcat 10:39 PM: "yea”
- otherLiam 10:39 PM: "yikes.”
- /Mr. Circle\ 10:40 PM: "literally how do you think i wasn’t shitposting last night”
- Xenquility 10:40 PM: "I’ve lost so much faith in humanity I can’t tell the difference anymore”
- ADULT_LINK△ 10:40 PM: "i have lost the ability to tell who’s being serious and who’s fucking around in this server”
- Xenquility 10:40 PM: ”^”
- otherLiam 10:40 PM: “I’m always serious.”
- otherLiam 10:40 PM: ”:wink:”
- otherLiam 10:40 PM: “Oh wait”
- otherLiam 10:40 PM: "“Cus I’m a good guy :wink: “”
- Xenquility 10:41 PM: "i vote song of time lets go save yuuki guys hurray hurrah”
- Xenquility 10:41 PM: ”:BUP:”
- ADULT_LINK△ 10:42 PM: “:BUP:”
- /Mr. Circle\ 10:42 PM: "when the fuck did emojis get so big”
- ADULT_LINK△ 10:42 PM: "why is my bup emoji so scuffed”
- ADULT_LINK△ 10:42 PM: "one of the recent updates”
- Xenquility 10:42 PM: "my bup can beat your bup”
- ADULT_LINK△ 10:42 PM: "the update i got today broke my bandadged betterdiscord :c”
- Xenquility 10:42 PM: "You got your bup on my bup!”
- ADULT_LINK△ 10:42 PM: "i dont have any of my plugins”
- Xenquility 10:42 PM: "No, you got your bup on my bup!”
- Xenquility 10:42 PM: "Buput bupper bups”
- ADULT_LINK△ 10:43 PM: "where did you get your bup”
- Xenquility 10:43 PM: ”:BUP: me baby”
- Xenquility 10:43 PM: “hey @BUP do you own the M channel now?”
- BUP 10:44 PM: "no”
- Xenquility 10:44 PM: "cool”
- BUP 10:45 PM: "Hey wolf”
- Wolfcat 10:45 PM: "yes”
- Xenquility 10:45 PM: "△”
- Xenquility 10:45 PM: ”-BUP”
- Wolfcat 10:45 PM: “I’m already here”
- Xenquility 10:45 PM: "Hey Greth posted that in the premiere chat”
- ADULT_LINK△ 10:45 PM: ”?”
- Xenquility 10:46 PM: “Greth posted △ in the premiere chat for The End”
- /Mr. Circle\ 10:46 PM: "ready for an outlandish alternate timeline theory that i wholeheartedly believe?”
- Xenquility 10:46 PM: ”(The Start Life video)”
- ADULT_LINK△ 10:46 PM: “YES”
- BUP 10:46 PM: "I’m ready”
- /Mr. Circle\ 10:46 PM: "bup is AO helper”
- Xenquility 10:46 PM: "of course”
- Xenquility 10:46 PM: "genius”
- BUP 10:46 PM: "god you wish”
- Wolfcat 10:46 PM: "wholefartedly”
- ADULT_LINK△ 10:46 PM: "lmao”
- Xenquility 10:46 PM: "wholefeetedly”
- /Mr. Circle\ 10:46 PM: "except he’s not helpful at all”
- /Mr. Circle\ 10:46 PM: "and is evil”
- /Mr. Circle\ 10:46 PM: "but like”
- /Mr. Circle\ 10:46 PM: "otherwise literally the same person”
- Xenquility 10:46 PM: "bup is au luna”
- BUP 10:46 PM: "oh!”
- Xenquility 10:47 PM: "Wait”
- BUP 10:47 PM: "guess what!”
- BUP 10:47 PM: "that’s super wrong”
- Xenquility 10:47 PM: "https://images.homedepot-static.com/productImages/930c2484-4b61-4b34-9e86-d8d4858cf565/svn/backyard-x-scapes-fake-rocks-hdd-rof-rocsb-64_1000.jpg”
- Xenquility 10:47 PM: “die fool”
- Xenquility 10:47 PM: “bup is au Alex Hall”
- Wolfcat 10:47 PM: "Helper is an ancient primordial being”
- Xenquility 10:47 PM: "His master plan of evil was stealing our money”
- Xenquility 10:47 PM: "Digital Fireside is his way of kidnapping celebrities to rule the world”
- /Mr. Circle\ 10:47 PM: "bup is actually alex hall shitposting in ID and tyler is going to be very angery”
- BUP 10:48 PM: "Tyler is angry anyways”
- Xenquility 10:48 PM: "BUP is actually au BEN”
- Xenquility 10:48 PM: "My evidence?”
- Xenquility 10:48 PM: "Bup is three letters”
- Xenquility 10:48 PM: "Ben is three letters”
- ADULT_LINK△ 10:48 PM: "clearly bup is me but evil”
- Wolfcat 10:48 PM: "BUP Soteetos”
- ADULT_LINK△ 10:48 PM: "and uses capitals”
- /Mr. Circle\ 10:48 PM: "the face from soteetos needs to be an emoji”
- BUP 10:48 PM: "Wow i love how this entire dialogue is just speculating on who i am
- and nothing that could actually hold my interest”
- /Mr. Circle\ 10:49 PM: "bup is literally a toad”
- BUP 10:49 PM: "you all are shart”
- Wolfcat 10:49 PM: "They always ask who you are”
- Wolfcat 10:49 PM: "But not how you are”
- Xenquility 10:49 PM: "Specishiting”
- ADULT_LINK△ 10:49 PM: "im not actuallu speculating i’m just fucking around”
- Wolfcat 10:49 PM: "How are you tonight Bup”
- ADULT_LINK△ 10:49 PM: "they always ask who you are”
- ADULT_LINK△ 10:49 PM: "but never why you are”
- ADULT_LINK△ 10:49 PM: "why are you bup?”
- BUP 10:49 PM: "that’s like asking for all the answers at once”
- BUP 10:49 PM: "and you dont even know it”
- ADULT_LINK△ 10:49 PM: ”:sBup:”
- Wolfcat 10:50 PM: “When are you Bup?”
- BUP 10:50 PM: "now”
- Xenquility 10:50 PM: "Do you want us dead?”
- BUP 10:50 PM: "no”
- Xenquility 10:50 PM: "Do you want Tyler dead?”
- BUP 10:50 PM: "me personally?”
- BUP 10:50 PM: "no”
- BUP 10:50 PM: "actually not at all even”
- BUP 10:50 PM: "well kinda but not really”
- BUP 10:50 PM: "this is difficult to explain”
- Xenquility 10:51 PM: "Are you worried about the fact the lc/ao people could very well end the world and all the fun in it if they succeed in calling down Luna?”
- /Mr. Circle\ 10:51 PM: "this conversation is the ID equivalent of the extended version of that scene where weasel tells deadpool what his face looks like”
- ADULT_LINK△ 10:51 PM: "lmao circo”
- BUP 10:51 PM: "how many layers are you even on bro”
- otherLiam 10:52 PM: "bro i leave to eat and suddenly yall are just throwin weird shit”
- otherLiam 10:52 PM: "what does hold your interest, BUP?”
- BUP 10:52 PM: "because that could all happen and me and my squad would go”
- BUP 10:52 PM: ”'ok well that was one way of our game ending'”
- ADULT_LINK△ 10:52 PM: “:heckasmug:”
- BUP 10:52 PM: "well game is putting it lightly”
- Xenquility 10:52 PM: "Other than you, have we previously encountered anyone in your Squad?”
- otherLiam 10:53 PM: "squaaaaaad”
- BUP 10:53 PM: "literally everyone you’ve ever met”
- ADULT_LINK△ 10:53 PM: "are you from the other ID”
- BUP 10:53 PM: "is part of someone’s squad”
- BUP 10:53 PM: "and you dont even know it”
- otherLiam 10:53 PM: "calling on the power of an ancient moon goddess #squadgoals”
- ADULT_LINK△ 10:53 PM: "squadfam”
- Xenquility 10:53 PM: "Is that eoeoeoeoeo guy affiliated with you?”
- BUP 10:53 PM: "no”
- Wolfcat 10:53 PM: "low leveled layer fools”
- Xenquility 10:54 PM: "Oooo”
- ARGDov 10:54 PM: "oof wow ok I missed some shit”
- otherLiam 10:54 PM: "we’re just chattin with bup”
- BUP 10:54 PM: "i mean there’s the main squad”
- BUP 10:54 PM: "and the we each separately have our own squaddies”
- BUP 10:54 PM: "to play our games”
- ARGDov 10:55 PM: "huh”
- ARGDov 10:55 PM: "whats the main squad?”
- BUP 10:55 PM: "i am using analogy”
- ARGDov 10:55 PM: "well, ok”
- BUP 10:55 PM: "because i have to be mysterious”
- ARGDov 10:55 PM: "what squaddy are you a part of?”
- ARGDov 10:55 PM: "pfff”
- otherLiam 10:55 PM: ”:ghost: spooky”
- Xenquility 10:55 PM: “Why does everyone have to be mysterious”
- BUP 10:55 PM: "i am the master of my game”
- Xenquility 10:55 PM: "No matter how it’s presented the schtick gets a bit old”
- otherLiam 10:55 PM: "one day we’ll meet someone that gives us a straight answer”
- ARGDov 10:55 PM: "because the other way is no fun”
- otherLiam 10:55 PM: "i have faith”
- ARGDov 10:55 PM: "for them”
- ARGDov 10:55 PM: ”@BUP what game?”
- Xenquility 10:56 PM: “WELL MAYBE THEY SHOULD THINK ABOUT OUR FELLINGS FOR ONCE ;-;”
- Xenquility 10:56 PM: ”(I’m kidding if that wasn’t implied)”
- BUP 10:56 PM: “okay do you remember kingdom hearts”
- ARGDov 10:56 PM: "yes”
- BUP 10:56 PM: "how those two idiot kids played chess”
- Wolfcat 10:56 PM: "yes”
- otherLiam 10:56 PM: "Oh no.”
- ARGDov 10:56 PM: "I dont remember that but whatever”
- otherLiam 10:56 PM: "It’s in the latest one.”
- BUP 10:56 PM: "and then they xanatos gambited half the universe into simple and cleaning their way into death”
- Wolfcat 10:56 PM: "xehanort and eraqus”
- otherLiam 10:57 PM: "Yes.”
- BUP 10:57 PM: "okay i am one of those guys in this situation but there are more kids with bad haircuts playing chess”
- Xenquility 10:57 PM: "lmao any chance we could win the game?”
- BUP 10:57 PM: "and its not actually like kingdom hearts at all”
- ADULT_LINK△ 10:57 PM: "i dont know kingdom hearts”
- otherLiam 10:58 PM: "I get the feeling we’re losing so badly at this point that it’s like in Mario Party when you’re in 4th but can steal a star to decide who wins.”
- BUP 10:58 PM: "not really”
- BUP 10:58 PM: "you saw how things are going in general”
- BUP 10:58 PM: "at some point when lines blur”
- ADULT_LINK△ 10:58 PM: "we just gotta hope BUP isnt Hard DK”
- BUP 10:58 PM: "fun things sneak in”
- Xenquility 10:59 PM: "Any chance you could tell us who eoeoeoeoeo is and/or if we’ve previously encountered him?”
- BUP 10:59 PM: "you know fuck mario party honestly”
- Xenquility 10:59 PM: "Mario party is awesome how dare you”
- ADULT_LINK△ 10:59 PM: "wait you never answered”
- ADULT_LINK△ 10:59 PM: "are you from the other ID”
- ARGDov 10:59 PM: "wait when lines blur”
- ARGDov 10:59 PM: "what do you mean lines blur”
- Xenquility 10:59 PM: "Lines are pretty blurry right now and BUP is pretty fun”
- ARGDov 10:59 PM: "and I thought he said he wasnt?”
- BUP 10:59 PM: "i am from every ID”
- Xenquility 10:59 PM: "Hey yugi”
- ARGDov 10:59 PM: "EVERY ID?”
- BUP 10:59 PM: "ye”
- ARGDov 11:00 PM: "wait do you mean from every one of us as individuals”
- BUP 11:00 PM: "no”
- ARGDov 11:00 PM: "or every iteration of the group across the dimensions”
- BUP 11:00 PM: "lmao”
- BUP 11:00 PM: "kind of”
- BUP 11:00 PM: "think broader”
- BUP 11:00 PM: "but dont actually”
- BUP 11:00 PM: "ive said too much”
- ARGDov 11:00 PM: "ok”
- BUP 11:00 PM: "my spider sense is tingling”
- Xenquility 11:00 PM: "No you haven't”
- ARGDov 11:00 PM: "headache forming”
- ARGDov 11:00 PM: "and why is it tingling?”
- Wolfcat 11:01 PM: "damn you spoiled the end of jid”
- Xenquility 11:01 PM: "EPONAS SONG WE MUST STABALIZE HIM”
- Xenquility 11:01 PM: "no jk”
- ARGDov 11:01 PM: "lets not”
- ARGDov 11:01 PM: "I guess hes gone?”
- ARGDov 11:01 PM: ”….ok then”
- Xenquility 11:01 PM: “how did he spoil the end of jid exactly?”
- BUP 11:01 PM: "what”
- Wolfcat 11:01 PM: "i was talking about the roblox pic”
- ARGDov 11:01 PM: "oh no you’re still here”
- ARGDov 11:01 PM: "shows what I know”
- ADULT_LINK△ 11:01 PM: "we must become powerful”
- otherLiam 11:01 PM: "wut”
- ARGDov 11:01 PM: ”@BUP why are your spidey senses tingling”
- Wolfcat 11:01 PM: “damn”
- BUP 11:01 PM: "from saying too much on that topic”
- ARGDov 11:02 PM: "oh damn”
- ARGDov 11:02 PM: "anyways hmm”
- Xenquility 11:02 PM: "Think you could tell us about eoeoeoeoeo?”
- BUP 11:02 PM: "i cant”
- ARGDov 11:02 PM: "also- why are you here?”
- BUP 11:02 PM: "because i dont know”
- Xenquility 11:02 PM: "fuck”
- Xenquility 11:02 PM: "oh”
- BUP 11:02 PM: "not my purview fucko”
- Wolfcat 11:02 PM: "more like purrview”
- BUP 11:02 PM: "shut up furry”
- Xenquility 11:02 PM: "more like purrvore”
- BUP 11:03 PM: "okay goodbye”
- ARGDov 11:03 PM: "still not answering my question”
- Wolfcat 11:03 PM: "this guy knows whats up”
- ARGDov 11:03 PM: "why are you here?”
- Xenquility 11:03 PM: "something about he likes fun and games and shit”
- Xenquility 11:03 PM: "Because every evil being likes to fuck with us”
- Wolfcat 11:03 PM: "isnt that why we’re all here?”
- Xenquility 11:03 PM: "Can’t blame them we’re the epitome of retardation”
- Wolfcat 11:04 PM: "we are homo ludens”
- otherLiam 11:04 PM: "yall you gotta banter with bup”
- ARGDov 11:04 PM: "we have been”
- Wolfcat 11:04 PM: "no”
- otherLiam 11:04 PM: "else they get bored”
- Wolfcat 11:05 PM: "answer my question”
- Wolfcat 11:05 PM: "answer my question now”
- ARGDov 11:05 PM: "we’ll Im trying to anyways”
- Wolfcat 11:05 PM: "youre not answering my question”
- otherLiam 11:05 PM: "no youve been interviewing him”
- ARGDov 11:05 PM: "I cant just force banter”
- Xenquility 11:05 PM: "Cool mr let’s get bup to raise the stakes”
- BUP 11:05 PM: "like CHILDREN”
- BUP 11:05 PM: "ok what”
- BUP 11:05 PM: "what is it”
- BUP 11:05 PM: "god”
- Xenquility 11:05 PM: "interviews are fun”
- ARGDov 11:05 PM: "lol we are like children its true”
- Wolfcat 11:05 PM: ”@BUP”
- Wolfcat 11:05 PM: “hi bup”
- ARGDov 11:05 PM: "interviews are only fun when they’re with vampires who may rip your head off if you arent careful”
- otherLiam 11:05 PM: "wut”
- BUP 11:06 PM: "that’s true”
- Xenquility 11:06 PM: "Are you assuming he’s not a vampire?”
- BUP 11:06 PM: "that gives me an idea for a game”
- BUP 11:06 PM: "how about you interview me and if i don’t like the question”
- BUP 11:06 PM: "someone dies”
- Wolfcat 11:06 PM: "sounds reasonable”
- Xenquility 11:06 PM: "How about no?”
- otherLiam 11:06 PM: "will it be someone important”
- BUP 11:06 PM: "maybe”
- BUP 11:06 PM: "maybe not”
- otherLiam 11:06 PM: "can i call first dibs on dying”
- BUP 11:06 PM: "no”
- ADULT_LINK△ 11:06 PM: "can i die”
- BUP 11:06 PM: "i have someone in mind”
- ADULT_LINK△ 11:07 PM: "oh damn dibs got called”
- Xenquility 11:07 PM: “That’s ominous”
- Wolfcat 11:07 PM: "damn”
- Wolfcat 11:07 PM: "im starting to realize”
- otherLiam 11:07 PM: "I mean I’d be down if you set rules for what you “don’t like”.”
- otherLiam 11:07 PM: "Otherwise you could just say you don’t like every question.”
- BUP 11:07 PM: "okay then”
- BUP 11:07 PM: "1. yes and no / true false questions”
- BUP 11:07 PM: ”- none of these, i don’t like em”
- BUP 11:07 PM: “2. stop asking my identity”
- BUP 11:07 PM: "3. No asking about Tyler”
- ADULT_LINK△ 11:09 PM: "wait fuck thats a yes/no sorta”
- Xenquility 11:09 PM: "Not really”
- Xenquility 11:09 PM: "I thought it was good”
- otherLiam 11:10 PM: ”(please for the love of god submit these elsewhere for approval)”
- ADULT_LINK△ 11:10 PM: “i mean he could literally answr with "yes” or “no” and refuse to elaborate”
- otherLiam 11:10 PM: “(he’ll kill someone)”
- ADULT_LINK△ 11:10 PM: "man, not asking a question that could be asnwered with a yes/no is hard”
- ARGDov 11:11 PM: "ok fine, better questions than”
- ARGDov 11:11 PM: ”@BUP can you tell us what SKM and his brother have been up to?”
- BUP 11:12 PM: “working with a group of hackers”
- ARGDov 11:12 PM: "what on?”
- BUP 11:12 PM: "computers”
- otherLiam 11:12 PM: "pfft”
- Wolfcat 11:12 PM: ”:hmmm:”
- ARGDov 11:12 PM: “hahhaha”
- ADULT_LINK△ 11:12 PM: "do you have any suggestions for getting dried blood off a nintendo switch”
- ARGDov 11:12 PM: "What are the hackers doing o nthe computers?”
- otherLiam 11:12 PM: "soap and water thorin”
- otherLiam 11:12 PM: "it’s hard plastic, not a fucking couch”
- BUP 11:13 PM: "nail polish remover”
- BUP 11:13 PM: "be careful”
- ADULT_LINK△ 11:13 PM: "hm”
- ADULT_LINK△ 11:13 PM: "aiight, thanks man”
- ADULT_LINK△ 11:13 PM: "i’ll look into getting some nail polish remover i guess”
- Xenquility 11:14 PM: "What are Nocta and crew currently working on?”
- BUP 11:14 PM: "try regular isopropyl rubbing alcohol first”
- BUP 11:14 PM: "nail polish remover can sometime strip color from plastic”
- ADULT_LINK△ 11:14 PM: "oh yikes, yeah i’ll try rubbing alcohol first for sure then”
- ARGDov 11:15 PM: "lmao we’ve lost track of the questions again”
- ARGDov 11:15 PM: "that was fast”
- otherLiam 11:15 PM: "I mean here’s an obvious question. Why are johnisdead.com and lunarchildren.com locked down?”
- BUP 11:15 PM: ”@Xenquility nocta is hiding”
- ARGDov 11:15 PM: “why is he hiding?”
- BUP 11:15 PM: ”@ARGDov”
- BUP 11:15 PM: “because of you all”
- ARGDov 11:15 PM: "wait what did we do to scare him?”
- otherLiam 11:15 PM: "Ooo we got him running scared.”
- otherLiam 11:15 PM: "I mean we played a buncha magic songs at him and are actively trying to dig into his secret safe space”
- Xenquility 11:16 PM: "What’s going on with archives guy?”
- ARGDov 11:16 PM: "eh, Im hoping for specifics”
- BUP 11:17 PM: "archives guy is lost”
- BUP 11:17 PM: "lost to me anyway”
- BUP 11:17 PM: "i’m damn near omniscient but he went deep”
- ARGDov 11:17 PM: "daaamn”
- ARGDov 11:17 PM: "so hes still around”
- ARGDov 11:17 PM: "good to know I guess”
- BUP 11:17 PM: "somewhere”
- ARGDov 11:18 PM: "Im still wondering what we did to scare off nocta”
- BUP 11:18 PM: "well”
- BUP 11:18 PM: "you didnt scare him off”
- BUP 11:18 PM: "what you caused scared him off”
- ARGDov 11:18 PM: "meaning….?”
- Xenquility 11:18 PM: "Elegy”
- BUP 11:18 PM: "that’s part of it”
- ARGDov 11:18 PM: "maybe let him answer before guessing lol”
- ARGDov 11:18 PM: "ok, well, whats the rest of it?”
- BUP 11:19 PM: "hmm”
- otherLiam 11:19 PM: "If we did that, you’d be the only person asking questions.”
- Xenquility 11:19 PM: "Posting the song of time or whatever on their forums probably didnt help either”
- BUP 11:19 PM: "not sure that’s safe to talk about here”
- BUP 11:19 PM: "even for me”
- ARGDov 11:19 PM: "well then y'all should ask some good ones too lol”
- BUP 11:19 PM: "not that i’m scared”
- ARGDov 11:19 PM: "ok,well, noted”
- otherLiam 11:19 PM: "What exactly did the Elegy do?”
- Xenquility 11:19 PM: "What keeps preventing people from talking about the stuff we need to know about?”
- BUP 11:19 PM: "release an entity into that realm”
- BUP 11:19 PM: "dont ask me what because i dont know”
- BUP 11:19 PM: "rather, i dont care”
- ARGDov 11:20 PM: "fair I suppose”
- BUP 11:20 PM: "you can blame slinky”
- ADULT_LINK△ 11:20 PM: "do you have any suggestions for our next move?”
- Xenquility 11:20 PM: "Why are our two greth’s in the past?”
- BUP 11:21 PM: ”@ADULT_LINK△ no”
- BUP 11:21 PM: “@Xenquility because i thought it’d be useful”
- BUP 11:21 PM: "and it was”
- ARGDov 11:22 PM: "wait”
- ARGDov 11:22 PM: "you did that”
- Xenquility 11:22 PM: "For you, or for us?”
- ARGDov 11:22 PM: "damn your powerful”
- BUP 11:22 PM: "you know”
- BUP 11:22 PM: "i am, and i’m really not”
- ARGDov 11:23 PM: "ok, other question- should we be afraid of you?”
- BUP 11:23 PM: "if only you could truly understand”
- Xenquility 11:23 PM: "uh”
- Xenquility 11:23 PM: "dov”
- BUP 11:23 PM: "i think you should be afraid of any stranger willing to tell you what you want to hear”
- ARGDov 11:23 PM: "thats true but I suppose wasnt my point lol”
- BUP 11:23 PM: "it is.”
- ARGDov 11:24 PM: "either way Im sure the point is moot”
- ARGDov 11:24 PM: "hmmm ok other questions”
- ARGDov 11:24 PM: "where is Tyler now? our universes tyler”
- BUP 11:24 PM: "ding ding ding”
- Xenquility 11:24 PM: ”…..”
- Wolfcat 11:24 PM: “welp”
- Xenquility 11:24 PM: "DOV”
- Xenquility 11:24 PM: "BOMB PLANS 3.0”
- ARGDov 11:24 PM: ”?”
- Xenquility 11:25 PM: “3. No asking about Tyler”
- ADULT_LINK△ 11:25 PM: "dov you dunce”
- ARGDov 11:25 PM: "shit”
- ARGDov 11:25 PM: "my bad sorry”
- Wolfcat 11:25 PM: ”:turboass:”
- ADULT_LINK△ 11:25 PM: “welp you just killed someone”
- ARGDov 11:25 PM: "what no I didnt”
- ADULT_LINK△ 11:25 PM: ”:rip:”
- ADULT_LINK△ 11:25 PM: “yeah”
- Xenquility 11:25 PM: "The punishment for asking a question he didn’t like was someone dying”
- ARGDov 11:25 PM: "FUCK”
- ARGDov 11:25 PM: "IM SORRU”
- ADULT_LINK△ 11:25 PM: "https://gyazo.com/a1beaf63b6873604c4424185a1835051”
- Xenquility 11:25 PM: "Kill? yes”
- otherLiam 11:26 PM: "Are you”
- otherLiam 11:26 PM: "fucking”
- ARGDov 11:26 PM: ”@BUP sorry please dont kill someone :c”
- otherLiam 11:26 PM: “serious.”
- ARGDov 11:26 PM: "I FORGOT”
- ARGDov 11:26 PM: "SORRY”
- ADULT_LINK△ 11:26 PM: "dov you’re like”
- ADULT_LINK△ 11:26 PM: "a huge murderer now”
- Wolfcat 11:26 PM: "kill dov in their place”
- otherLiam 11:26 PM: "It’s THREE RULES.”
- ARGDov 11:26 PM: "I WAS TRYING TO THINK OF QUESTIONS”
- ADULT_LINK△ 11:26 PM: "you nearly killed people with bomb plans, you voted yes instantly on the kill vote, and now this”
- Wolfcat 11:27 PM: ”:hmmm:”
- ADULT_LINK△ 11:27 PM: “oh shit is there more?”
- ARGDov 11:27 PM: "no”
- ARGDov 11:27 PM: "the runes didnt get anyone KILLED”
- ARGDov 11:27 PM: "ok fine”
- ARGDov 11:27 PM: "Im out of questions”
- ARGDov 11:27 PM: "you fuckers think of something”
- otherLiam 11:27 PM: "YOU THINK?!”
- BUP 11:27 PM: "desperation makes me smile”
- BUP 11:27 PM: "tbh”
- /Mr. Circle\ 11:27 PM: "the bear jew strikes again”
- ADULT_LINK△ 11:27 PM: "i uh. think the questions are over”
- Xenquility 11:27 PM: "Who just died?”
- Xenquility 11:27 PM: "lmao”
- Wolfcat 11:27 PM: "you’re out of questions”
- Wolfcat 11:27 PM: "im out of time”
- ADULT_LINK△ 11:27 PM: "unless we get to kill more people”
- ARGDov 11:27 PM: "Im an otter actually.”
- otherLiam 11:28 PM: "I have questions but I’m pretty sure you just game over’d us by spamming them.”
- ARGDov 11:28 PM: "too skinny to be a bear”
- BUP 11:28 PM: "I’ll give you a choice”
- BUP 11:28 PM: "how about this”
- /Mr. Circle\ 11:28 PM: "you see, this is a reference to both the homosexual male lifestyle and the 2005 quentin tarantino film "inglourious basterds"”
- BUP 11:28 PM: “I could kill someone you love, but is of little consequence to you now”
- ARGDov 11:28 PM: "clearly you dont know your gay body types well circle”
- BUP 11:28 PM: "Or i could kill someone you hate, but it would set you back far”
- ARGDov 11:28 PM: "shit”
- ARGDov 11:28 PM: "you mean to us as a group”
- Xenquility 11:28 PM: "Alright who do we love?”
- ARGDov 11:29 PM: "Im not picking this”
- Xenquility 11:29 PM: "We love Tyler”
- Xenquility 11:29 PM: "Moonman”
- ADULT_LINK△ 11:29 PM: "the only person from the group that i like. hate”
- Xenquility 11:29 PM: "Greth”
- /Mr. Circle\ 11:29 PM: "kill mugen”
- ADULT_LINK△ 11:29 PM: "woul dbe mugen”
- ADULT_LINK△ 11:29 PM: "i swear to fuck if mugen is neccecarry”
- /Mr. Circle\ 11:29 PM: "WHOM”
- otherLiam 11:29 PM: "Who the fuck is this now”
- Xenquility 11:29 PM: "Let’s balance our options”
- Xenquility 11:29 PM: "List off people we love”
- otherLiam 11:29 PM: "look the choice is obvious here”
- ADULT_LINK△ 11:29 PM: "whom'st dide”
- Wolfcat 11:29 PM: "oh please give him some ideas”
- otherLiam 11:29 PM: "we can’t afford any more setbacks.”
- ARGDov 11:30 PM: "I know who we should pick”
- /Mr. Circle\ 11:30 PM: "i was joking please do not kill mugen”
- otherLiam 11:30 PM: "We already have tons.”
- ARGDov 11:30 PM: "yeah we need to be calculating”
- ADULT_LINK△ 11:30 PM: "hehe dide sounds like died”
- ARGDov 11:30 PM: ”
- ARGDov 11:30 PM: “actually yes”
- ARGDov 11:30 PM: "next time someone asks a bad question”
- ARGDov 11:30 PM: "kill mugen”
- otherLiam 11:30 PM: "Fuck our loved ones, necessary sacrifices.”
- Xenquility 11:30 PM: "I concur”
- ARGDov 11:30 PM: "im inclined to agree with Liam”
- Wolfcat 11:30 PM: "kill someone we love”
- ARGDov 11:30 PM: "although Im worried”
- ARGDov 11:30 PM: "bloods gonna be on my hands now :c”
- Xenquility 11:30 PM: "If we get set back anymore, we’re fucked and all our loved ones die”
- otherLiam 11:30 PM: "YEAH NO SHIT”
- ARGDov 11:30 PM: "oh fuck off Liam”
- BUP 11:30 PM: "well it’s done”
- /Mr. Circle\ 11:31 PM: "dov this is like the eighth death you’re responsible for”
- ARGDov 11:31 PM: "someone else wouldve fucked it up if I hadnt”
- ARGDov 11:31 PM: ”….”
- ARGDov 11:31 PM: “name the other ones”
- otherLiam 11:31 PM: "Do we get to know who’s dead?”
- ADULT_LINK△ 11:31 PM: "are you sure about that”
- /Mr. Circle\ 11:31 PM: "technically maybe more”
- ADULT_LINK△ 11:31 PM: "i’d like to know who we just killed as well”
- ARGDov 11:31 PM: "same”
- otherLiam 11:31 PM: "Yeah but like, which loved one”
- BUP 11:31 PM: "you see it’s funny when you can play with the rules”
- /Mr. Circle\ 11:31 PM: "hold on, someone’s knocking at m”
- ARGDov 11:31 PM: "if its greth Im going to be extremely upset”
- ARGDov 11:31 PM: "NO”
- BUP 11:32 PM: "because to you”
- BUP 11:32 PM: "theyre already dead”
- ADULT_LINK△ 11:32 PM: "lmao fuck off circle”
- ARGDov 11:32 PM: ”……oh SHIT”
- ARGDov 11:32 PM: “PARADOX”
- Xenquility 11:32 PM: "uh”
- ADULT_LINK△ 11:32 PM: "WAIT HOLY FUCK”
- otherLiam 11:32 PM: "Oh ffs we just killed Yuuki.”
- ARGDov 11:32 PM: "YUKI”
- ADULT_LINK△ 11:32 PM: "DID WE JUST KILL YIKI AGAN”
- Xenquility 11:32 PM: "LMAO”
- ADULT_LINK△ 11:32 PM: "YUUKI”
- otherLiam 11:32 PM: "In the past.”
- ARGDov 11:32 PM: "GAAAAAAAH”
- BUP 11:32 PM: "i told you before”
- ADULT_LINK△ 11:32 PM: "that would explain earlier lmao”
- otherLiam 11:32 PM: ”@Wolfcat dov killed your waifu”
- Xenquility 11:32 PM: “Well that was better than I expected”
- ADULT_LINK△ 11:32 PM: "wait have we done this before”
- ARGDov 11:32 PM: "SHHH LIAM”
- ARGDov 11:32 PM: "SHUT UP]”
- /Mr. Circle\ 11:32 PM: "jesus christ that was a masterful setup”
- ADULT_LINK△ 11:32 PM: "is this some time loop shenannigans”
- ARGDov 11:32 PM: "so wait”
- ADULT_LINK△ 11:32 PM: "also hot damn that was really good”
- otherLiam 11:33 PM: "DOV”
- otherLiam 11:33 PM: "FFS”
- Xenquility 11:33 PM: ”(lmao what if it was john)”
- ADULT_LINK△ 11:33 PM: “did bup talk about anyone we disliked earlier?”
- Xenquility 11:33 PM: "The interview is over”
- /Mr. Circle\ 11:33 PM: "JOHN HOLY FUCK”
- otherLiam 11:33 PM: "STOP ASKING QUESTIONS DOV”
- ADULT_LINK△ 11:33 PM: "thats not a question for but thats for the room”
- ARGDov 11:33 PM: "what are you talking about theres nothing there”
- /Mr. Circle\ 11:33 PM: "DOV KILLED JOHN”
- Xenquility 11:33 PM: "big brain”
- otherLiam 11:33 PM: "jesus god”
- Wolfcat 11:33 PM: "god fucking damn it dov”
- ARGDov 11:33 PM: "ok so fuck it”
- Wolfcat 11:33 PM: "She’ll △lways live”
- ARGDov 11:33 PM: "we killed Yuki”
- ARGDov 11:33 PM: "and thats it”
- BUP 11:34 PM: "I killed Yuuki”
- BUP 11:34 PM: "Not directly”
- BUP 11:34 PM: "I mean I didn’t strangle her myself”
- BUP 11:34 PM: "But i made the decision that led to it happening”
- /Mr. Circle\ 11:34 PM: "dov is the whole ass reason we’re in this mess”
- ARGDov 11:34 PM: "no one else”
- ARGDov 11:34 PM: "no one asked any other bad questions”
- ARGDov 11:34 PM: "shhhhh”
- otherLiam 11:34 PM: "Alright so uh”
- ADULT_LINK△ 11:34 PM: "someone shittily photoshop dovs face onto this”
- otherLiam 11:34 PM: "do we get to keep asking questions?”
- ARGDov 11:34 PM: "LIAM”
- ARGDov 11:34 PM: "THATS A YES OR NO QUESTION”
- BUP 11:34 PM: "you’re lucky i didn’t stomp on the mouse instead”
- Xenquility 11:35 PM: "Doug?”
- otherLiam 11:35 PM: "That’s not to him.”
- otherLiam 11:35 PM: "Chill.”
- BUP 11:35 PM: "that wouldve caused real problems waaaaay back”
- ADULT_LINK△ 11:35 PM: "mouse?”
- ADULT_LINK△ 11:35 PM: "wait”
- Xenquility 11:35 PM: "Mouse = doug”
- /Mr. Circle\ 11:35 PM: "PLEASE LEAVE HIM ALONE”
- Xenquility 11:35 PM: "maybe”
- ARGDov 11:35 PM: "letschasethemouse”
- /Mr. Circle\ 11:35 PM: "CURSOR IS A GOOD BOI”
- otherLiam 11:35 PM: "I didn’t do anything silly like ping him.”
- Wolfcat 11:35 PM: "He’s being a bitchass”
- Xenquility 11:35 PM: "Holy shit cursor”
- BUP 11:35 PM: ”@Wolfcat”
- BUP 11:35 PM: “gunna cry?”
- ARGDov 11:35 PM: ”…”
- ADULT_LINK△ 11:35 PM: “i think dov could have just murdered instead of bomb plans
- maybe cum a little?”
- otherLiam 11:35 PM: ”@BUP How can we get the login creds to johnisdead.com or lunarchildren.com?”
- otherLiam 11:35 PM: “There’s a question.”
- Xenquility 11:36 PM: ”(I’m not asking Bup this) Does that mean that Doug will be immediately useful to us?”
- otherLiam 11:36 PM: “Get this back on track.”
- Xenquility 11:36 PM: ”(To clarify I’m asking the group that)”
- ARGDov 11:36 PM: “not necesarily”
- ARGDov 11:36 PM: "he couldve picked him”
- ARGDov 11:36 PM: "which means hes not useful to us atm either”
- Xenquility 11:36 PM: "We don’t love doug”
- Xenquility 11:36 PM: "nescessarily”
- ADULT_LINK△ 11:36 PM: "bup seems to not be linear in time”
- /Mr. Circle\ 11:36 PM: "doug a bitch”
- ADULT_LINK△ 11:36 PM: "since dov just killed yuuki in the past”
- BUP 11:36 PM: "well she was ascended”
- BUP 11:36 PM: "but i told them to do that”
- BUP 11:36 PM: "i needed an excuse for our game”
- otherLiam 11:37 PM: "REMEMBER THE RULES”
- BUP 11:37 PM: "oh you think we’re still playing?”
- BUP 11:37 PM: "you want to risk more people?”
- BUP 11:37 PM: "lmao”
- ADULT_LINK△ 11:37 PM: "nah not really”
- Xenquility 11:37 PM: "P sure it’s over”
- BUP 11:37 PM: "bloodthirsty”
- otherLiam 11:37 PM: "I’ll risk it.”
- ADULT_LINK△ 11:37 PM: "i figured dov murdering someone was the end”
- otherLiam 11:37 PM: "It’s not a risk if you just think before sending.”
- ARGDov 11:37 PM: "pffff”
- Wolfcat 11:37 PM: "You’re risking your own chess pieces”
- ADULT_LINK△ 11:37 PM: "do we really want to risk killing another person when we’ve asked so many fuckin yes/no's”
- ARGDov 11:37 PM: "no we dont”
- otherLiam 11:38 PM: "who the fuck is we”
- BUP 11:38 PM: "my army is larger”
- ADULT_LINK△ 11:38 PM: "the group as a whole, duh”
- ADULT_LINK△ 11:38 PM: "the hell you think i mean by we”
- ARGDov 11:38 PM: "whod have thought that someone with a toad avatar would be so twisted”
- Xenquility 11:38 PM: "I vote we fuck this game and go back to the No-Rule Questions But Bup Probably Won’t Answer system”
- otherLiam 11:38 PM: "Cus i aint asked any dumbass questions”
- ADULT_LINK△ 11:39 PM: "you’ve asked like 2 or 3 yes/no’s since dov killed yuuki”
- ARGDov 11:39 PM: "lol yup”
- BUP 11:39 PM: "this is fun”
- ARGDov 11:39 PM: "ALSO STOP SAYING IT LIKE THAT”
- otherLiam 11:39 PM: "I asked one to the group.”
- BUP 11:39 PM: "i can make a simple game”
- Xenquility 11:39 PM: "Can we all shut up and stop arguing?”
- BUP 11:39 PM: "and turn this place into a battle royale”
- BUP 11:39 PM: "you all turn on each other easily”
- ADULT_LINK△ 11:39 PM: "me lmao”
- Xenquility 11:39 PM: "Bup is obviously enjoying this”
- otherLiam 11:39 PM: "Fuck these guys I’d like to still play.”
- ADULT_LINK△ 11:39 PM: "we playin realm royale now?”
- Xenquility 11:39 PM: "We fought over Erika and now we’re fighting over a mistake”
- Wolfcat 11:39 PM: ”:jack_o_lantern:”
- /Mr. Circle\ 11:39 PM: “where we droppin bois”
- ARGDov 11:39 PM: "ACTUALLY FUCK”
- BUP 11:40 PM: "Erika was a mistake”
- ARGDov 11:40 PM: "why?”
- ARGDov 11:40 PM: "why was she a mistake?”
- ARGDov 11:40 PM: "where is she now anyways?”
- BUP 11:40 PM: "im kidding”
- BUP 11:40 PM: "i dont care”
- ARGDov 11:40 PM: "fuck”
- ARGDov 11:40 PM: "I just realized we couldve asked him about her”
- ARGDov 11:40 PM: "oh well”
- otherLiam 11:40 PM: "We could’ve asked about a lot of things.”
- otherLiam 11:40 PM: "Erika was on my list.”
- otherLiam 11:40 PM: "But I was waiting for you to be done.”
- ARGDov 11:40 PM: "pfff”
- ARGDov 11:40 PM: "well”
- ARGDov 11:40 PM: "Im done now”
- otherLiam 11:41 PM: "We’re ALL done now.”
- Xenquility 11:41 PM: "Dwelling on the past won’t help us in the future. Dov screwed up, we all realise that, and he’s been made fun of. If we keep arguing, we get nowhere”
- otherLiam 11:41 PM: "That’s why I want to keep playing his game.”
- ARGDov 11:41 PM: "ugh ok”
- ADULT_LINK△ 11:41 PM: "aiight i’m gonna be back in a few minutes, i gotta piss and getting around with crutches sucks ass”
- /Mr. Circle\ 11:41 PM: "kill dov next”
- ARGDov 11:41 PM: "lets hope SKM can be a bit more clear whenever he gets in contact with us”
- otherLiam 11:41 PM: "Cus all we got were the answers to your followups.”
- ARGDov 11:41 PM: "in fairness we got some info”
- ARGDov 11:41 PM: "and Yuki was destined to die anyways”
- ARGDov 11:41 PM: "so it couldve been worse”
- BUP 11:42 PM: "was she?”
- otherLiam 11:42 PM: ”@BUP Is continuing to play still an option?”
- ARGDov 11:42 PM: “I mean in our timeline, she’d already gotten killed”
- otherLiam 11:42 PM: "And yeah I know, but we aren’t playing rn.”
- ADULT_LINK△ 11:42 PM: "one thing we’ve learned is that bup does not seem to play linearly in time”
- ARGDov 11:42 PM: "well, not in our timeline”
- ARGDov 11:42 PM: "but anyways”
- ARGDov 11:42 PM: "shed already died for us”
- ARGDov 11:42 PM: "so really”
- ARGDov 11:42 PM: "me askign the wrong question was destined”
- BUP 11:42 PM: "gee”
- ARGDov 11:42 PM: "and out of my control”
- BUP 11:42 PM: "i wonder where you had heard”
- BUP 11:42 PM: "of something like that before”
- ARGDov 11:43 PM: "like what?”
- otherLiam 11:43 PM: “Dov has a doctorate in rationalization.”
- ARGDov 11:43 PM: "Im Jewish”
- ARGDov 11:43 PM: "we are trained to argue”
- Xenquility 11:43 PM: "Did Bup go back in time and take over Yuuki’s account or something”
- ARGDov 11:43 PM: "and I have just argued my way out of blame for death”
- ARGDov 11:43 PM: "so yeah”
- ARGDov 11:43 PM: "Im good”
- otherLiam 11:43 PM: "not really no”
- Xenquility 11:43 PM: "To say the whole "This is inevitable” thing”
- ADULT_LINK△ 11:43 PM: “nah you still killed her”
- otherLiam 11:43 PM: "we’re just ignoring you in favor of bup”
- ARGDov 11:44 PM: "ok but I had no choice in it”
- ARGDov 11:44 PM: "it was destiny”
- ARGDov 11:44 PM: "but anyways”
- ARGDov 11:44 PM: "MOVING ON”
- ADULT_LINK△ 11:44 PM: "i mean”
- ADULT_LINK△ 11:44 PM: "you did”
- otherLiam 11:44 PM: "okay murderer”
- /Mr. Circle\ 11:44 PM: "dov could have decided not to ask but that would have caused problems temporally”
- ADULT_LINK△ 11:44 PM: "it coulda been any of us idiots who did it”
- ADULT_LINK△ 11:44 PM: "but you ended up bein the one who did”
- ARGDov 11:44 PM: "exactly,circle”
- ARGDov 11:44 PM: "not my fault”
- Wolfcat 11:44 PM: "You’re giving bup too much credit”
- Wolfcat 11:44 PM: "assuming he actually planned this from the start”
- otherLiam 11:44 PM: "Hey BUP. How can we play your game again?”
- BUP 11:45 PM: "honestly you all got me laughin”
- BUP 11:45 PM: "plus someone died”
- BUP 11:45 PM: "all in all good night”
- ARGDov 11:45 PM: "so yes”
- ARGDov 11:45 PM: "we should be scared of you”
- ARGDov 11:45 PM: "great.”
- Wolfcat 11:45 PM: "he doesnt have power over time, he has power over coincidence”
- ADULT_LINK△ 11:45 PM: "since from our perspective she was already dead, it doesent really matter when we ended up getting her killed”
- BUP 11:45 PM: "nah im just gonna give link a reward”
- BUP 11:45 PM: "for thinkin with portals”
- ADULT_LINK△ 11:45 PM: "o shit really?”
- BUP 11:45 PM: "https://www.youtube.com/watch?v=xI_fltggv6E”
- /Mr. Circle\ 11:45 PM: "literally why does anyone think it’s a good idea to continue?”
- ADULT_LINK△ 11:45 PM: ”:o”
- ARGDov 11:45 PM: “lmao”
- ADULT_LINK△ 11:45 PM: "oh my fuck”
- ARGDov 11:45 PM: "Liams the only one who thinks so”
- otherLiam 11:46 PM: "I’m less pissed about Yuuki getting killed and more about the game being over and not getting any more info.”
- Xenquility 11:46 PM: "bup is kaiden”
- Xenquility 11:46 PM: "confirmed”
- BUP 11:46 PM: "nah”
- /Mr. Circle\ 11:46 PM: "imagine for a second”
- BUP 11:46 PM: "kaiden was the other option”
- BUP 11:46 PM: "actually you guys like him now”
- ARGDov 11:47 PM: "ahahahhaha”
- BUP 11:47 PM: "but you didnt then”
- /Mr. Circle\ 11:47 PM: "bup being mugen”
- BUP 11:47 PM: "weird how that works”
- ARGDov 11:47 PM: "why do we like him”
- Xenquility 11:47 PM: "We like Kaiden?”
- ARGDov 11:47 PM: "we havent spoken to him much really”
- otherLiam 11:47 PM: "Kaiden’s adorable”
- ADULT_LINK△ 11:47 PM: "cursed idea, circle”
- ADULT_LINK△ 11:47 PM: "cursed”
- BUP 11:47 PM: "but i told you who i was”
- BUP 11:47 PM: "just now”
- BUP 11:47 PM: "sort of”
- otherLiam 11:47 PM: "I don’t think he likes me very much tho”
- ARGDov 11:47 PM: ”…..wait”
- BUP 11:47 PM: “it doesnt reveal much but”
- Xenquility 11:47 PM: "are you”
- Xenquility 11:47 PM: "IIII”
- BUP 11:47 PM: "it also does”
- BUP 11:47 PM: "no”
- ARGDov 11:48 PM: "are you kaiden”
- BUP 11:48 PM: "no”
- Xenquility 11:48 PM: "You the dark lord from the rp or whatever?”
- ARGDov 11:48 PM: "I was kidding so thats a relief”
- otherLiam 11:48 PM: "man it’s a good thing we aren’t playing anymore”
- BUP 11:48 PM: "”You the dark lord from the rp or whatever?””
- BUP 11:48 PM: "kind of!”
- /Mr. Circle\ 11:48 PM: "i know who you are and i am incredibly uncomfortable”
- /Mr. Circle\ 11:48 PM: "i’m gonna go now”
- otherLiam 11:48 PM: "wait wut”
- ARGDov 11:48 PM: "what the hell”
- ARGDov 11:48 PM: ”@/Mr. Circle\ WHO IS HE”
- Xenquility 11:49 PM: “The one Kaiden teamed up with or the one they were against?”
- ARGDov 11:49 PM: "YOU CANT JUST SAY THAT AND LEAVE”
- /Mr. Circle\ 11:49 PM: "he’s me”
- BUP 11:49 PM: "oh”
- BUP 11:49 PM: "you wish”
- BUP 11:49 PM: "nice try”
- ARGDov 11:49 PM: ”…….”
- Xenquility 11:49 PM: “denied lmao”
- /Mr. Circle\ 11:49 PM: "damn i tried tho”
- Wolfcat 11:49 PM: "I’m you”
- ARGDov 11:49 PM: "Ive got a feeling he’s not someone we know”
- BUP 11:49 PM: "oh”
- BUP 11:49 PM: "i am”
- /Mr. Circle\ 11:49 PM: "the baby is he”
- BUP 11:49 PM: "again sort of”
- ARGDov 11:49 PM: ”….of course sort of”
- ARGDov 11:49 PM: “inb4 this is the alternate universe version of me”
- ARGDov 11:49 PM: "No tha would be stupid”
- BUP 11:50 PM: "god you all just want”
- BUP 11:50 PM: "to be me”
- BUP 11:50 PM: "so bad”
- ARGDov 11:50 PM: "Im kidding”
- ARGDov 11:50 PM: "Id hate it if I were you tbh”
- ARGDov 11:50 PM: "Id be disgusted with myself”
- Xenquility 11:50 PM: "wow”
- Xenquility 11:50 PM: "rude”
- ARGDov 11:50 PM: "shame on me”
- Wolfcat 11:50 PM: "oof”
- ADULT_LINK△ 11:50 PM: "i mean”
- Wolfcat 11:50 PM: "cutting deep”
- ARGDov 11:50 PM: "Id want to slit my own wrists”
- Xenquility 11:50 PM: "I mean it makes sense if you’re slightly him”
- /Mr. Circle\ 11:50 PM: ”:THINKING:”
- ADULT_LINK△ 11:50 PM: “your jevil and bup stuff is on brand for me”
- ADULT_LINK△ 11:50 PM: "so”
- Xenquility 11:50 PM: "jk”
- ARGDov 11:50 PM: "and by my own wrists I mean your wrists that is lol”
- ADULT_LINK△ 11:50 PM: "wouldnt be too bad of a thing if you were a me”
- ADULT_LINK△ 11:50 PM: "or if i were a you”
- Wolfcat 11:51 PM: "dov is just obsessed with killing”
- /Mr. Circle\ 11:51 PM: "dov wants to murder you”
- BUP 11:51 PM: "the funny thing is”
- ARGDov 11:51 PM: "I AM HERE”
- ARGDov 11:51 PM: "AND HE IS ME”
- BUP 11:51 PM: "i straight up”
- ADULT_LINK△ 11:51 PM: "idk ¯\_(ツ)_/¯”
- BUP 11:51 PM: "gave you the answer to my identity”
- otherLiam 11:51 PM: "Dov’s just mad he fucked up and killed Yuuki, don’t mind him.”
- Xenquility 11:51 PM: "So if Bupman IA or the "Okay soul contract time” guy”
- BUP 11:51 PM: “i honest to god 100% did”
- Xenquility 11:51 PM: ”*is”
- ARGDov 11:51 PM: “I AM HE AND HE IS ME <a href="https://www.youtube.com/watch?v=I6Uf4sjX8RE%E2%80%9D">https://www.youtube.com/watch?v=I6Uf4sjX8RE”</a>
- BUP 11:51 PM: "you just cant connect the dots”
- ADULT_LINK△ 11:51 PM: ”“didnt like him then, but do now"”
- Wolfcat 11:51 PM: "3?”
- ARGDov 11:51 PM: "nope”
- Wolfcat 11:51 PM: "△”
11/12/19 - Chat with GHOSTBABEL and BUP
- BUP 9:39 AM: “This is good song”
- BUP 9:39 AM: "don’t mind if I jack this account for a sec”
- Slinky 9:40 AM: "ayyy babel”
- BUP 9:40 AM: "I’m not babel”
- Slinky 9:40 AM: "how you doin pal”
- Slinky 9:40 AM: "wait w h a t”
- BUP 9:40 AM: "I am stealin’ their account without permission”
- Slinky 9:40 AM: "oh shit r u sam?”
- BUP 9:40 AM: "I am”
- BUP 9:40 AM: "a bad guy :wink:”
- Wolfcat 9:40 AM: "Sam I am”
- ADULT_LINK△ 9:40 AM: "you talkin bout Nouveau Life™️?”
- ADULT_LINK△ 9:40 AM: "good shit”
- BUP 9:40 AM: "yes”
- Slinky 9:41 AM: "wait wait who is jacking babels acc”
- BUP 9:41 AM: "a bad guy :wink:”
- Slinky 9:41 AM: "okay”
- Slinky 9:41 AM: "quick, answer”
- Slinky 9:41 AM: "Color or Colour”
- BUP 9:43 AM: "coloour”
- Slinky 9:43 AM: "okay its british”
- BUP 9:43 AM: "cooolooooor”
- Xenquility 9:43 AM: "Oh hi”
- Slinky 9:43 AM: "too late fucker”
- BUP 9:43 AM: "I used two oo’s to fuck with you”
- BUP 9:43 AM: "but I guess teenage intelligence is limited”
- Slinky 9:44 AM: "dont say that shit”
- Slinky 9:44 AM: "i only know one british hacker and that is SKM”
- BUP 9:44 AM: "I never said I was British”
- BUP 9:44 AM: "if you think I’m skm”
- BUP 9:44 AM: "I have one thing to say to that”
- Slinky 9:44 AM: "bruh you said colour”
- Slinky 9:44 AM: "no one in the US says colour”
- BUP 9:44 AM: "i said coloour”
- BUP 9:44 AM: ”:wink:”
- Xenquility 9:44 AM: “He could be canadian”
- Xenquility 9:44 AM: ”:)”
- Slinky 9:44 AM: “oh shit do canadians say that too?”
- Xenquility 9:44 AM: "Yeah”
- Xenquility 9:44 AM: "colour”
- Xenquility 9:44 AM: "armour”
- Slinky 9:45 AM: "fuck my plans”
- Xenquility 9:45 AM: "inb4 jeff has hacked babel”
- BUP 9:45 AM: ”>when the ID thinks you’re SKM but they’re actually in danger”
- BUP 9:45 AM: “https://www.youtube.com/watch?v=tkYAdJHN5X4”
- Xenquility 9:45 AM: "Oh”
- Slinky 9:45 AM: "well if we are in danger”
- Xenquility 9:45 AM: "Why are we in danger?”
- BUP 9:45 AM: "Bup”
- Slinky 9:45 AM: "b r u h”
- Xenquility 9:46 AM: "Simpleflips is gonna blj through our wall and shove us in gbj?”
- BUP 9:46 AM: "how dare you.”
- ADULT_LINK△ 9:46 AM: "reveal yourself”
- Slinky 9:46 AM: "BUP”
- ADULT_LINK△ 9:46 AM: ”:BUP:”
- Xenquility 9:46 AM: “Could you just be easy and tell us who you are”
- BUP 9:46 AM: "where’s the game then”
- BUP 9:46 AM: "you all want to play the game, right?”
- Xenquility 9:47 AM: "I mean I guess”
- Xenquility 9:47 AM: "Do we at least know who you are? (As in, do we know of your existence?)”
- BUP 9:47 AM: "B U P”
- Slinky 9:47 AM: "yo canadian hacker”
- Xenquility 9:48 AM: "hey Thorin was the one to invite me to the simple discord”
- Xenquility 9:48 AM: "he was bupping”
- Slinky 9:48 AM: "help us making this logo #🎅art🎅”
- ADULT_LINK△ 9:48 AM: ”:sBup:”
- BUP 9:48 AM: “ᴇxᴄᴜsᴇ ᴍᴇ?”
- Xenquility 9:48 AM: "Oh welcome back”
- BUP 9:48 AM: "oh look it catches on”
- BUP 9:48 AM: "hahaha”
- BUP 9:48 AM: "goodbye for now I guess”
- ADULT_LINK△ 9:48 AM: "later bupper”
- BUP 9:48 AM: ”…”
- Xenquility 9:49 AM: “What is it with these guys and saying "hahaha” all the time”
- Slinky 9:49 AM: “The Bupper”
- Slinky 9:49 AM: "new nickname”
- BUP 9:49 AM: "ᴛʜᴀᴛ’s ᴍʏ ᴛʀɪᴄᴋ. ɪ ᴍᴜsᴛ ᴀᴅᴍɪᴛ ɪᴛ’s sʟɪɢʜᴛʟʏ ᴜɴɴᴇʀᴠɪɴɢ.”
- Slinky 9:49 AM: "yo babel its been a while”
- Xenquility 9:49 AM: "Also we kind of need you now”
- BUP 9:50 AM: "ɪ ᴋɴᴏᴡ ᴡʜᴀᴛ ʏᴏᴜ ᴍᴇᴀɴ, xᴇɴ, ʙᴜᴛ ʙᴇᴄᴀᴜsᴇ ᴏꜰ ᴍʏ ᴄᴜʀʀᴇɴᴛ ʜɪᴅᴇᴏᴜᴛ ᴀʟʟ ɪ ᴛʜɪɴᴋ ᴏꜰ ɪs ᴛʜᴀᴛ ᴛᴇʀʀɪʙʟᴇ ᴄᴏᴜɴᴛʀʏ sᴏɴɢ.”
- Xenquility 9:51 AM: "Which song? "Terrible country song” narrows it down to just about the entire genre”
- BUP 9:51 AM: “ɪᴛ sᴇᴇᴍs ᴀʟʟ ꜰᴀᴄᴛᴏʀs ᴏꜰ ᴛʜɪs ᴘʟᴀʏ ᴀʀᴇ sᴛᴀʀᴛɪɴɢ ᴛʜᴇɪʀ ᴇɴᴅɢᴀᴍᴇ ᴍᴏᴠᴇs. ɪ ʜᴀᴠᴇ ᴡᴏʀᴋ ᴛᴏ ᴅᴏ.”
- BUP 9:51 AM: "https://www.youtube.com/watch?v=eM213aMKTHg”
- BUP 9:51 AM: "ɴᴇᴠᴇʀ ᴍᴀᴋᴇ ᴍᴇ ᴘᴏsᴛ ᴛʜɪs ᴀɢᴀɪɴ.”
- Xenquility 9:52 AM: "Oh god”
- Wolfcat 9:52 AM: "ʜᴀʜᴀʜᴀ”
- Slinky 9:52 AM: "s h i t”
- Xenquility 9:52 AM: "What creature is listening to that”
- Slinky 9:52 AM: "that song is shit”
- ADULT_LINK△ 9:52 AM: "ᶦ ᵃᵐ ᵇᵘᵗ ᵃ ᶫᶦᵗᵗᶫᵉ ᶜʳᵉᵃᵗᶜʰᵉʳ”
- Slinky 9:52 AM: "yo i really hope its skm”
- BUP 10:04 AM: "ɪ ᴀᴍ ɴᴏᴛ ɪɴᴛᴇɴᴛɪᴏɴᴀʟʟʏ ʟɪsᴛᴇɴɪɴɢ ᴛᴏ ᴀɴʏᴛʜɪɴɢ sᴏ ᴀᴛʀᴏᴄɪᴏᴜs.”
- BUP 10:04 AM: "ʏᴏᴜ ʜᴀᴠᴇ ᴀʟʟ ᴅɪsᴄᴏᴠᴇʀᴇᴅ ᴛʜᴇ ᴛᴇᴄʜɴᴏʟᴏɢʏ ᴏꜰ ʀᴀᴅɪᴏ, ʏᴇs?”
- Xenquility 10:04 AM: "No never heard of it”
- Slinky 10:05 AM: "babel”
- Slinky 10:05 AM: "listen to tame impala”
- Slinky 10:05 AM: "you will probably like it”
- BUP 10:06 AM: "ʏᴏᴜ ᴅᴏ ʀᴇᴀʟɪᴢᴇ ᴏɴᴄᴇ ᴏᴜʀ ᴍᴜᴛᴜᴀʟʟʏ ʙᴇɴᴇꜰɪᴄɪᴀʟ ᴘᴀʀᴛɴᴇʀsʜɪᴘ ᴇɴᴅs ɪ ᴡɪʟʟ ʜᴀᴠᴇ ɴᴏ ʀᴇᴀsᴏɴ ɴᴏᴛ ᴛᴏ ᴅᴇsᴛʀᴏʏ ʏᴏᴜ.”
- BUP 10:06 AM: "sʜᴏᴜʟᴅ ʏᴏᴜ sᴜꜰꜰɪᴄɪᴇɴᴛʟʏ ᴀɴɴᴏʏ ᴍᴇ, ᴀɴʏᴡᴀʏ.”
- Xenquility 10:06 AM: "Do you have any reason to destroy us?”
- Slinky 10:07 AM: "lmao”
- Wolfcat 10:07 AM: "I think you’re giving him one”
- Densgivin 10:33 AM: "What happened”
- Slinky 10:34 AM: "someone hacked onto babels acount and he is british or canadian because he is stupid”
- ADULT_LINK△ 10:34 AM: "brutal”
- Slinky 10:34 AM: "also his name is now BUPPER until he reveals his real name”
- Densgivin 10:34 AM: "LOL”
- Slinky 10:35 AM: "at least im calling he like that”
- Jos 10:36 AM: "Reppub”
- Jos 10:36 AM: "It’s you…”
- Jos 10:36 AM: "just jk”
- BUP 10:37 AM: "BUP”
- BUP 10:37 AM: "will do fine”
- Slinky 10:37 AM: "ay bupper”
- BUP 10:37 AM: "I think that’s cute & funny”
- BUP 10:37 AM: "No just BUP”
- Slinky 10:38 AM: "BUP”
- Wolfcat 10:38 AM: "new character”
- Wolfcat 10:38 AM: "Bupboy”
- Slinky 10:38 AM: "sounds like another way of saying SKM”
- Jos 10:38 AM: "BP”
- Jos 10:38 AM: "BU”
- BUP 10:38 AM: "you are not BUP slinky”
- Jos 10:38 AM: "Hello”
- Jos 10:38 AM: "nice to meet ya”
- BUP 10:39 AM: "I truly wish I could say I was skm and fulfill your every theorizing desire but alas I am not”
- BUP 10:39 AM: "I’m just a bad guy :wink:”
- Slinky 10:39 AM: “then….”
- Jos 10:39 AM: "hoax?”
- Slinky 10:39 AM: "AO SKM”
- Slinky 10:39 AM: "im not giving up buddy”
- BUP 10:39 AM: "In fact I like this account”
- BUP 10:39 AM: "I think I will lock out your friend”
- Slinky 10:40 AM: "okay sorry”
- BUP 10:40 AM: "it’s funny”
- Slinky 10:40 AM: "you are not SKM”
- BUP 10:40 AM: "he’s very frantic right now”
- BUP 10:40 AM: "she’s?”
- Slinky 10:40 AM: "tf u mean with she's”
- Slinky 10:40 AM: “babel is an alpha male”
- BUP 10:40 AM: "ghostbabel”
- BUP 10:40 AM: "the owner of this account”
- BUP 10:40 AM: "oh well I don’t like to assume”
- PAKO 10:40 AM: "lost video”
- BUP 10:40 AM: "anyways they seem to have great power”
- ADULT_LINK△ 10:41 AM: "respectable”
- Slinky 10:41 AM: "okay bup”
- Slinky 10:41 AM: "lemme ask you something”
- BUP 10:41 AM: "but sadly it’s not enough to overcome me”
- BUP 10:41 AM: "I am placed higher”
- Wolfcat 10:41 AM: "Dude”
- Wolfcat 10:41 AM: "How HIGH do you have to be”
- Slinky 10:41 AM: "are you the owner of SecretFamilly”
- ADULT_LINK△ 10:41 AM: ”:howHigh:”
- BUP 10:41 AM: “:high:”
- Slinky 10:41 AM: "i probably said the name wrong”
- Wolfcat 10:42 AM: "ɢʜᴏsᴛʙᴀʙᴇ”
- Xenquility 10:42 AM: "Why exactly are you a bad guy?”
- PAKO 10:43 AM: "what happened in the end with tyler?”
- BUP 10:43 AM: "because of stuff like this right?”
- Slinky 10:43 AM: "ɢʜᴏsᴛʙup”
- BUP 10:43 AM: "you were collaborating with this entity”
- BUP 10:43 AM: "and now you are not”
- BUP 10:43 AM: ”:wink:”
- Slinky 10:43 AM: “Holy shit you changed name fast”
- Xenquility 10:43 AM: ”(To be fair the guy himself is kinda a terrible person)”
- Xenquility 10:43 AM: “Have you diddled any kids?”
- Jos 10:44 AM: "the real question is”
- Jos 10:44 AM: "are you just blocking our access to GB and nothing else”
- PAKO 10:44 AM: "start life”
- BUP 10:44 AM: "i don’t know”
- BUP 10:44 AM: "depends on what I feel like doing”
- Xenquility 10:45 AM: "I can respect that”
- Jos 10:45 AM: "ah, arbitrary fun, keep going”
- Xenquility 10:45 AM: "Like playing games?”
- ADULT_LINK△ 10:45 AM: "at the very least i respect your meme taste :sBup:”
- Xenquility 10:45 AM: ”:BUP:”
- Jos 10:45 AM: “amborgesa”
- BUP 10:45 AM: "ooh”
- BUP 10:45 AM: "a game sounds fun”
- BUP 10:45 AM: "what kind of game should we play”
- Xenquility 10:45 AM: "Up to you”
- Jos 10:45 AM: "what about destroying luna”
- BUP 10:45 AM: "pfft”
- BUP 10:45 AM: "pass”
- Xenquility 10:46 AM: "Are you jevil lmao”
- ADULT_LINK△ 10:46 AM: ”:Jefault:”
- Jos 10:46 AM: “what about, saving the timeline?”
- Slinky 10:46 AM: "BUP stands for Brad Ulcher Parker”
- BUP 10:46 AM: "jevil lol”
- BUP 10:46 AM: "what does that even mean”
- BUP 10:46 AM: "like in a literal sense”
- ADULT_LINK△ 10:46 AM: "jester devil”
- BUP 10:47 AM: "oh”
- Slinky 10:47 AM: "lmfao”
- BUP 10:47 AM: "i kinda like that”
- Slinky 10:47 AM: "Toad Jester Devil”
- BUP 10:47 AM: "oh hang on”
- BUP 10:47 AM: "your friend is trying to use that thing you gave them”
- BUP 10:47 AM: "ok back”
- Slinky 10:47 AM: "huh?”
- Xenquility 10:47 AM: "Welcome back”
- Xenquility 10:47 AM: "Helper’s hat”
- Slinky 10:48 AM: "oh the hat”
- Xenquility 10:48 AM: "Anyways at least you have a sense of humor”
- BUP 10:48 AM: "idk i was thinking more like a flash game or sumthin”
- BUP 10:48 AM: "but you guys are so bent on being serious”
- Slinky 10:49 AM: "suck my weenie”
- Xenquility 10:49 AM: "We can play some flash games”
- BUP 10:49 AM: "fine if we play a fun game”
- Xenquility 10:49 AM: "You guys up for monopoly?”
- PAKO 10:49 AM: "what weeine?”
- BUP 10:49 AM: "i’ll make the stakes serious”
- BUP 10:49 AM: "how about that”
- Xenquility 10:49 AM: "Uh”
- Xenquility 10:49 AM: "I’m fine with just normal games but I’m also guessing we have to chose the serious option”
- BUP 10:50 AM: "the good shit”
- Jos 10:50 AM: "tell me about this game”
- Wolfcat 10:50 AM: ”:flushed:”
- PAKO 10:50 AM: “HHAHHHAHAHAJA”
- Xenquility 10:50 AM: "If Ghostbabel ever comes back can we all agree to call him unit 344”
- Slinky 10:50 AM: "why”
- Jos 10:50 AM: “what about unit420”
- Slinky 10:50 AM: "ghostbabel is cooler”
- PAKO 10:51 AM: "babel”
- Xenquility 10:51 AM: "unit 344 was his wyndstrom name”
- Jos 10:51 AM: ”@BUP what game are we talking about”
- Xenquility 10:51 AM: “and I like bupman”
- Slinky 10:51 AM: "i know it was his specimen number lel”
- Slinky 10:51 AM: "yo bupman”
- BUP 10:51 AM: "idk”
- BUP 10:51 AM: "pick a good game”
- BUP 10:51 AM: "something fun”
- BUP 10:51 AM: "monopoly is the most boring shit of all time”
- BUP 10:51 AM: "garbage tier board game tbh”
- Jos 10:52 AM: "russian monopoly”
- Jos 10:52 AM: "you share everything”
- Slinky 10:52 AM: "MineSweeper”
- Wolfcat 10:52 AM: "captain :b:oad”
- PAKO 10:52 AM: ”.ussrmonopoly”
- Jos 10:52 AM: “nah alright so”
- ADULT_LINK△ 10:52 AM: "romhacked mario64 online”
- Xenquility 10:52 AM: "YES”
- Xenquility 10:52 AM: "GOD YES”
- Xenquility 10:52 AM: "I would kill for some mario64 online right now”
- Wolfcat 10:53 AM: "Oh?”
- Slinky 10:53 AM: "marioK64 is neat”
- Wolfcat 10:53 AM: "Sounds like something a traitor would say”
- Wolfcat 10:53 AM: “:thinking::thinking::thinking::thinking::thinking::thinking::thinking::thinking::thinking::thinking::thinking:”
- ADULT_LINK△ 10:53 AM: "oof mario kart 64 is fun”
- Wolfcat 10:53 AM: "Anyone find it strange how Xen was the one who recorded the call? And in perfect GM quality?”
- Wolfcat 10:53 AM: ”:thinking::thinking::thinking::thinking::thinking:”
- Xenquility 10:54 AM: “"Perfect GM quality"”
- Wolfcat 10:54 AM: "our gms arent very good”
- BUP 10:54 AM: ”^”
- Slinky 10:54 AM: “are you guys talking about meta shit when a character is around, rude”
- Xenquility 10:54 AM: "Sometimes you have to take things into your own hands”
- Xenquility 10:54 AM: ” -wolfjack”
- Wolfcat 10:54 AM: “im kiddign dont spite me”
- Xenquility 10:54 AM: ”;)”
- Slinky 10:54 AM: “how do you feel about that bup?”
- Jos 10:55 AM: "come at me”
- BUP 10:55 AM: "dude”
- PAKO 10:55 AM: "ups”
- BUP 10:55 AM: "the pokespam”
- BUP 10:55 AM: "why”
- Slinky 10:55 AM: "i like bup”
- Slinky 10:55 AM: "i also hate the pokespam”
- BUP 10:56 AM: "you shouldn't”
- BUP 10:56 AM: "I’m thinking of erasing this mofo”
- Xenquility 10:56 AM: "Hey Bup I have a question”
- PAKO 10:56 AM: "idk that”
- PAKO 10:56 AM: "sorry”
- Slinky 10:56 AM: "dont say shit about babel”
- Slinky 10:56 AM: "u wanna throw hands bitch?”
- PAKO 10:56 AM: "who”
- Xenquility 10:56 AM: "wait nvm”
- Xenquility 10:56 AM: "Anyone got an idea for a game?”
- BUP 10:58 AM: "y'all suggested it and now I’m sitting her squattin”
- Slinky 10:58 AM: "AHEM whtcg AHEM”
- BUP 10:58 AM: "setting up an emu for a romhack seems like a lot of effort tbh”
- Xenquility 10:58 AM: "Yeah but in mario64 you might get to see your dad again”
- Xenquility 10:58 AM: "He’s in the castle somewhere”
- BUP 10:58 AM: "what the fuck”
- PAKO 10:58 AM: "uh”
- Slinky 10:58 AM: "xen he is gonna kill babel the fuck”
- Wolfcat 10:58 AM: "you boys seriously about to play vidya with a character”
- Slinky 10:59 AM: "we are”
- Slinky 10:59 AM: "well”
- Wolfcat 10:59 AM: “:smh:”
- Slinky 10:59 AM: "xen is”
- Xenquility 10:59 AM: "I was making a joke about him being a bup lmao”
- PAKO 10:59 AM: "wadafuq”
- Wolfcat 10:59 AM: "i knew he was a traitor”
- Xenquility 10:59 AM: "No I’m not”
- Xenquility 10:59 AM: "Everything is great.”
- PAKO 10:59 AM: "yes he was a fucking traitor”
- BUP 10:59 AM: "yo i was talking about pako”
- BUP 10:59 AM: "not babel”
- Slinky 10:59 AM: "oh pako”
- BUP 10:59 AM: "babel is kawaii”
- Xenquility 10:59 AM: "Exactly stop yelling at me”
- PAKO 11:00 AM: "i never talk with bup”
- Slinky 11:00 AM: "pako ur gonna die my lad xddddd”
- BUP 11:00 AM: "also i def confirmed this stupid mofo (babel) has been trollin”
- PAKO 11:00 AM: "why”
- Slinky 11:00 AM: "trollin who”
- PAKO 11:00 AM: "why i going to die?”
- Slinky 11:01 AM: "bup said he/she uwu is gonna destroy yo”
- Wolfcat 11:01 AM: "i miss spingirl”
- Wolfcat 11:01 AM: "welcome back spingirl”
- PAKO 11:01 AM: "thank you @bup to want to destroy me”
- Jos 11:02 AM: "actually if babel is here, she is already attacking you on another front you are not aware to”
- BUP 11:02 AM: "im not going to kill you relax”
- Jos 11:02 AM: "he*”
- BUP 11:02 AM: "i was mad you were posting so much pokespam in here”
- PAKO 11:02 AM: "ah ok”
- BUP 11:02 AM: "babel is def a girl tho”
- Xenquility 11:02 AM: "Hot”
- PAKO 11:02 AM: "I did not know that sorry”
- Slinky 11:02 AM: "no she isnt”
- Slinky 11:02 AM: "FUCK”
- BUP 11:03 AM: "ok cuck”
- Xenquility 11:03 AM: "I knew the way she acted around me wasn’t coincidental”
- ADULT_LINK△ 11:03 AM: "whore”
- ADULT_LINK△ 11:03 AM: ”?”
- Slinky 11:03 AM: “babel is my mother and she is not a girl”
- Slinky 11:03 AM: "i can confirm”
- BUP 11:03 AM: "i can confirm that maybe they don’t identify as female”
- PAKO 11:03 AM: "i’ve a charizard:fire: :fire”
- Wolfcat 11:04 AM: "no wonder they always looked down on us”
- Wolfcat 11:04 AM: "typical stacey”
- Xenquility 11:04 AM: "dominatrix”
- Xenquility 11:04 AM: "not exactly my cup of tea but”
- Slinky 11:04 AM: ”:okay:”
- Slinky 11:04 AM: “how do you dare calling babel a dominatrix”
- Wolfcat 11:05 AM: "is he wrong?”
- Xenquility 11:05 AM: "didn’t she prey on kids too?”
- Wolfcat 11:05 AM: "why you always callin people pedos”
- Slinky 11:05 AM: ”…d-did she?…”
- BUP 11:05 AM: “i don’t think that factoid was ever confirmed”
- PAKO 11:05 AM: "pedos:regi: :regi:”
- BUP 11:05 AM: "just speculated”
- Xenquility 11:06 AM: "close enough”
- BUP 11:06 AM: "they are def a troll”
- Xenquility 11:06 AM: "Like a literal troll or an internet troll?”
- Slinky 11:06 AM: "HOMESTUCK TROLL”
- PAKO 11:06 AM: ”:person_walking: :dash: this are pedos”
- Slinky 11:06 AM: “lmao”
- PAKO 11:07 AM: "fuck”
- PAKO 11:07 AM: "hahahah is that”
- Wolfcat 11:07 AM: "I think "preyed on kids” means they like fucked with kids”
- Wolfcat 11:07 AM: “not like literally”
- Xenquility 11:07 AM: "ik”
- Slinky 11:07 AM: "plot twist”
- Wolfcat 11:08 AM: "but i dunno 979 deeplore”
- ADULT_LINK△ 11:08 AM: ”:honl:”
- ADULT_LINK△ 11:08 AM: “:turboass:”
- Slinky 11:08 AM: "bbabel is both a homestuck troll and a real troll with long nose”
- PAKO 11:08 AM: "ooh”
- BUP 11:08 AM: "maybe that is your prize”
- BUP 11:08 AM: "for our game”
- PAKO 11:08 AM: ”:hando:”
- PAKO 11:08 AM: “:dork:”
- BUP 11:09 AM: "if you win I will discover and spill this fool’s entire true deeplore”
- PAKO 11:09 AM: ”:grethpoint:”
- Xenquility 11:09 AM: “hell yes”
- BUP 11:09 AM: "but if i win”
- BUP 11:09 AM: "well”
- BUP 11:09 AM: "hmmm”
- Slinky 11:09 AM: ”………”
- BUP 11:09 AM: “what would be that good?”
- Xenquility 11:09 AM: "you can smash babel”
- BUP 11:09 AM: "that sounds fun!”
- Xenquility 11:09 AM: "as in sexual intercourse not murder”
- BUP 11:09 AM: "but i’m not sure i can”
- Wolfcat 11:09 AM: "that’d piss babel off”
- BUP 11:09 AM: "i did say they are pretty stronk”
- Wolfcat 11:09 AM: "maybe the only winning move is not to play”
- Xenquility 11:09 AM: "Just tie them down with some bdsm shit”
- BUP 11:09 AM: "i know!”
- Xenquility 11:09 AM: "They’re a dominatrix anyways”
- Wolfcat 11:10 AM: "and send pics”
- BUP 11:10 AM: "I will take someone hostage”
- BUP 11:10 AM: "but I won’t say who”
- Slinky 11:10 AM: "oh fucking nice”
- Xenquility 11:10 AM: "why”
- BUP 11:10 AM: "because the stakes are high”
- BUP 11:10 AM: "and that makes the game interesting”
- BUP 11:10 AM: "however”
- PAKO 11:10 AM: ”:ghost:”
- BUP 11:10 AM: “in return”
- Slinky 11:10 AM: "so xen, play and win bc i dont wanna play the: uh where is this dude game again”
- PAKO 11:10 AM: ”:ghost: babel”
- BUP 11:10 AM: “if you lose, i will also let this character go”
- BUP 11:10 AM: "after i spill their secrets”
- ADULT_LINK△ 11:10 AM: "i uh”
- ADULT_LINK△ 11:10 AM: i think i’m gonna go to sleep”
- Slinky 11:11 AM: "oh”
- ADULT_LINK△ 11:11 AM: "its 8:10 AM now”
- Slinky 11:11 AM: "the secrets?”
- PAKO 11:11 AM: "is the shortname”
- Xenquility 11:11 AM: "wait so if we win we get Babel’s secrets and the guy back?”
- Slinky 11:11 AM: "gm and gn thorin”
- ADULT_LINK△ 11:11 AM: "i stayed up a liiiiiiiitle late”
- ADULT_LINK△ 11:11 AM: "o/ nighto frens”
- Xenquility 11:11 AM: "I AM BECOME JEFFUMS”
- ADULT_LINK△ 11:11 AM: "identity theft”
- BUP 11:11 AM: "wait maybe i phrased that wrong”
- Slinky 11:11 AM: "OH NO”
- Slinky 11:11 AM: "NOW I HAVE TWO DADS”
- BUP 11:12 AM: "if you lose you win you get babel back after i spill their secrets”
- PAKO 11:12 AM: ”:two_men_holding_hands:”
- BUP 11:12 AM: “if you lose i will let them go anyway”
- PAKO 11:12 AM: "our fathers slinky”
- BUP 11:12 AM: "you don’t get their secrets”
- Slinky 11:12 AM: "so no hostage?”
- BUP 11:12 AM: "but i move on somewhere else”
- BUP 11:12 AM: "let’s put it that way”
- Xenquility 11:12 AM: "So basically if we lose you leave”
- PAKO 11:12 AM: "uuhh”
- BUP 11:12 AM: "not at all :wink:”
- Wolfcat 11:12 AM: "sounds like a win win”
- Xenquility 11:12 AM: "I am so confused but okay”
- BUP 11:13 AM: "don’t overthink it”
- BUP 11:13 AM: "oh I have a good idea”
- BUP 11:13 AM: "can anyone livestream?”
- BUP 11:13 AM: "how about a speedrun”
- PAKO 11:14 AM: "nop”
- Xenquility 11:14 AM: "of what”
- PAKO 11:14 AM: "a speedrun in what game?”
- BUP 11:14 AM: "let’s see, what would be appropriate?”
- PAKO 11:15 AM: "minecraft”
- Xenquility 11:15 AM: "Refunct”
- PAKO 11:15 AM: "the world record speedrun is 0.47seconds”
- BUP 11:16 AM: "pfft i don’t expect any world record breaking speedruns”
- BUP 11:16 AM: "I’ll set a time limit of reasonable expectation”
- Xenquility 11:16 AM: "Is that a yes to refunct?”
- PAKO 11:16 AM: "but try at least”
- BUP 11:17 AM: "refunct looks cute”
- BUP 11:17 AM: "what about breath of the wild?”
- BUP 11:17 AM: "i think that would be fun”
- BUP 11:17 AM: "i am willing to discuss this”
- BUP 11:17 AM: "I like having fun.”
- BUP 11:17 AM: "it would be interesting because i could also set the parameter for completion”
- BUP 11:17 AM: "like just ‘killing ganon’ would be kinda boring since some people can do that in like 30 mins”
- Slinky 11:19 AM: "Stream in twich tho”
- Slinky 11:19 AM: "I can’t watch discord strens”
- Wolfcat 11:19 AM: "Collect all Koroks”
- BUP 11:19 AM: "I was thinking more like, acquire the Master Sword and walk to a certain point in the game”
- Slinky 11:20 AM: "Yo wolf”
- Wolfcat 11:20 AM: "Yo stinky”
- Slinky 11:20 AM: "And btw stream the speedrun on twich pls :(“
- Xenquility 11:21 AM: "k so who here is good at botw”
- ARGdov 11:21 AM: "morning all”
- ARGdov 11:21 AM: "have I missed much”
- Xenquility 11:21 AM: "Morning Dov”
- Slinky 11:21 AM: "Mornin”
- Xenquility 11:21 AM: "Babel may be dying”
- ARGdov 11:21 AM: "well, shitt”
- Xenquility 11:21 AM: "Some guy has taken over is account named bup”
- ADULT_LINK△ 11:21 AM: "yall botw speedrunning is nuts”
- Xenquility 11:21 AM: "Bup is probably evil but he seems cool”
- Xenquility 11:21 AM: "Likes to have fun”
- ARGdov 11:21 AM: "ok so bup isnt a new player, cool”
- BUP 11:22 AM: "they call me the jevil”
- BUP 11:22 AM: "OOoooooOOooOooOo”
- ARGdov 11:22 AM: "hai”
- Wolfcat 11:22 AM: "i elect”
- Wolfcat 11:22 AM: "thorin”
- BUP 11:22 AM: "https://www.youtube.com/watch?v=tkYAdJHN5X4”
- ARGdov 11:22 AM: "well, good to meet you BUP”
- Slinky 11:22 AM: "I can do ANYTHING”
- ARGdov 11:22 AM: "Im ARGdov. My one claim to fame is fucking things up for the group spectacularly one time and thats it”
- ADULT_LINK△ 11:22 AM: "i’d love to try to speedrun something but i hve to sleep”
- ADULT_LINK△ 11:22 AM: "ive been up all night”
- Xenquility 11:23 AM: "Ay was it Thorin or Circle that played the hell out of botw?”
- ADULT_LINK△ 11:23 AM: "circo streamed it”
- BUP 11:23 AM: "I assume this will take time to prepare anyways for someone”
- Slinky 11:23 AM: "Yo BUP 1v1 ultrafigth kyanta”
- ARGdov 11:24 AM: "holy fuck”
- ADULT_LINK△ 11:24 AM: "what fuckin mc speedrun is 47 seconds”
- ARGdov 11:24 AM: "I just jumped up and looked at Circles new timeline thing”
- ARGdov 11:24 AM: "this is a fucking headache”
- PAKO 11:24 AM: "yeah 47 seconds”
- Slinky 11:24 AM: "YEAH RIGHT?”
- Xenquility 11:24 AM: "Idk what the hell it is”
- Slinky 11:24 AM: "It hurts to watch”
- ADULT_LINK△ 11:24 AM: "thats 47 minutes ya doof”
- Xenquility 11:24 AM: "For some reason people started assuming the mad Tyler was from ao”
- Xenquility 11:24 AM: ”(For literally no reason)”
- PAKO 11:25 AM: “47 seconds with hacks”
- PAKO 11:25 AM: "8 min is the world record without hacks”
- Slinky 11:25 AM: ”:hand: :hando:”
- PAKO 11:25 AM: “https://youtu.be/C2uQOkrvgvs”
- ARGdov 11:26 AM: ”@/Mr. Circle\ you’re probs busy atm but when you can maybe elaborate on this crazy diagram you made with the timelines”
- PAKO 11:26 AM: “is a canadian guy”
- Slinky 11:26 AM: ”:hand: :jack_o_lantern: :hando:”
- Slinky 11:26 AM: “Your arg, hand it over”
- ARGdov 11:27 AM: "ok, so”
- ARGdov 11:27 AM: "Im thinking what circles thinking is um”
- ARGdov 11:27 AM: "well its complicated but I think I understand it”
- Slinky 11:28 AM: "I dont”
- Xenquility 11:28 AM: "COUGH That timeline is wrong COUGH”
- ARGdov 11:28 AM: "I mean, I wouldnt be surprised”
- ADULT_LINK△ 11:28 AM: "yall just havent woken your 3rd eye”
- ADULT_LINK△ 11:28 AM: ”:hylotl_eyes:”
- ARGdov 11:28 AM: “but Im trying to grasp onto SOMETHING to make sense of everything thats gone down”
- Slinky 11:29 AM: "I can’t wake it up yet”
- Slinky 11:29 AM: "I’m too young”
- BUP 11:29 AM: "it’s funny because none of it is simple and yet at the same time the entire thing makes sense and is simple”
- BUP 11:29 AM: "BUP”
- Slinky 11:29 AM: "BUP”
- Xenquility 11:29 AM: "My understanding is: Tyler wanted to end his suffering, so the bad guys told him something like, "Hey if you get these internet detectives to fuck off we’ll let you live” So then he tried to do that”
- Xenquility 11:29 AM: “But they didn’t kill him”
- BUP 11:29 AM: ”.yt bup”
- Wolfcat 11:29 AM: “BUP”
- Wolfcat 11:29 AM: "BUP”
- Wolfcat 11:29 AM: ” UP”
- ARGdov 11:29 AM: “ok that would make sense”
- Xenquility 11:30 AM: "And apparently Erika is canon”
- Slinky 11:30 AM: "BrapBoy @Wolfcat”
- ARGdov 11:30 AM: "but whats up with the video acknowledhing that this is an ARG, and acknowledging the 4th wall”
- Wolfcat 11:30 AM: "You must clear your thinking”
- Wolfcat 11:30 AM: "Compartamentalize”
- Xenquility 11:30 AM: "I mean”
- ARGdov 11:30 AM: "i.e it thanks Jad and Nintendo for "giving me so much to play with"”
- ADULT_LINK△ 11:30 AM: "dov”
- ADULT_LINK△ 11:30 AM: "dov”
- ARGdov 11:30 AM: "yes”
- ARGdov 11:30 AM: "yes”
- Slinky 11:30 AM: "That’s all Tyler trying to end the arg”
- ADULT_LINK△ 11:30 AM: "the video was AO tyler acting out of character”
- Slinky 11:30 AM: "Btw”
- Slinky 11:30 AM: "Anyone has it?”
- Xenquility 11:30 AM: "In character, we’re to assume everything is real. Calling all a "Stupid joke” would be the easiest way to get us off their trail”
- Slinky 11:30 AM: “I need to watch it”
- ARGdov 11:30 AM: "ok how do we know that?”
- Slinky 11:31 AM: "The intro fog deleted”
- Xenquility 11:31 AM: "WHERE THE HELL ARE YOU GETTING AO FROM”
- ADULT_LINK△ 11:31 AM: "meaning it was OG tyler playing the role of AO tyler breaking his character”
- ADULT_LINK△ 11:31 AM: "idk it seems fuckin obvious!”
- ARGdov 11:31 AM: "so OG Tyler, whos been kidnapped and taken to the AO timeline”
- Slinky 11:31 AM: "ANYONE HAS THE VID WHERE TYLER BREAKS 4TH”
- ARGdov 11:31 AM: "was forced to pretend to be AO Tyler 'breaking character’, and ending the ARG”
- ADULT_LINK△ 11:31 AM: "well”
- ARGdov 11:31 AM: "to throw….someone off track”
- ADULT_LINK△ 11:32 AM: "idk about our tyler being forced to be ao tyler”
- ARGdov 11:32 AM: "well I mean”
- Wolfcat 11:32 AM: "Ha ha ha ha.”
- Xenquility 11:32 AM: "As far as I can guess ao Tyler is dead”
- ADULT_LINK△ 11:32 AM: "fuck”
- Xenquility 11:32 AM: "Which is why they needed ours”
- ARGdov 11:32 AM: "it followed up with him being like "FUCK NO I WAS SUPPOSED TO BE FREE"”
- ADULT_LINK△ 11:32 AM: "i need to stop and get my ass to sleep”
- Wolfcat 11:32 AM: "thinkin about beans sorry”
- ARGdov 11:32 AM: "so ok maybe he was coerced into it idk”
- Slinky 11:32 AM: "Yo wolf”
- BUP 11:32 AM: "damn so like i feel like big moments in these chats these days have accompanying music but i dont”
- ARGdov 11:32 AM: "thats not the important thing”
- ADULT_LINK△ 11:32 AM: "o shit someone say beans”
- ARGdov 11:32 AM: "beans”
- BUP 11:32 AM: "BEANS”
- Slinky 11:32 AM: "Beans?”
- ARGdov 11:32 AM: "also how do we know Erika is canon?”
- Wolfcat 11:32 AM: "what do you want slinky”
- Xenquility 11:32 AM: "Beans are more important than jid”
- Xenquility 11:32 AM: "Erika’s tribute video”
- Slinky 11:33 AM: "you archive everything rite?”
- ADULT_LINK△ 11:33 AM: "she posted new content”
- Wolfcat 11:33 AM: "ill update the timeline later”
- Xenquility 11:33 AM: "Featured all new footage”
- Xenquility 11:33 AM: "With Greth”
- Slinky 11:33 AM: "No wait”
- ARGdov 11:33 AM: "there’s footage in it we dont recognize, thats all. that doesnt have to mean anything. we could just be forgetting it exists”
- Wolfcat 11:33 AM: "someone said they archived the intro to the silentdork vid”
- Wolfcat 11:33 AM: "i dont have it myself”
- Xenquility 11:33 AM: "And she left the discord as soon as we found her channel”
- Slinky 11:33 AM: "Ahhh”
- Slinky 11:33 AM: "Almost”
- Slinky 11:33 AM: "I’m so close to watching it”
- ADULT_LINK△ 11:33 AM: "b e a n”
- ADULT_LINK△ 11:33 AM: "ah fuck my foots starting to hurt fuck this shit i’m goin to sleep”
- ADULT_LINK△ 11:33 AM: "nighto 4 real this time”
- ADULT_LINK△ 11:33 AM: "beans”
- Wolfcat 11:34 AM: "there were some vids that arent properly archived”
- Slinky 11:34 AM: "Beans!”
- Wolfcat 11:34 AM: "erika is apparently a SUPERFAN”
- BUP 11:35 AM: "who is that smonkin”
- Xenquility 11:35 AM: ”
- f Erika’s video doesn’t have any new footage then we’ve missed a good 3 and a half minutes of footage”
- ADULT_LINK△ 11:36 AM: “dunno just found a beans image and added it to my folder”
- Wolfcat 11:36 AM: "erika”
- Wolfcat 11:36 AM: "more like”
- Wolfcat 11:36 AM: "hairika”
- ADULT_LINK△ 11:36 AM: "i keep misreading erika as etika and that makes me sad”
- Slinky 11:36 AM: ”
- Yo is Erika the girl on her pfp?
- Slinky 11:36 AM: “Like the girl on her yt pfp?”
- Wolfcat 11:36 AM: ”:edit1::edit2:”
- PAKO 11:38 AM: “https://youtu.be/GWAlYC8NZzU”
- ARGdov 11:40 AM: "I did just watch the video again cause I wasnt focusing too much on it before”
- ARGdov 11:40 AM: "and yeah ok this is new”
- ARGdov 11:40 AM: "this has been”
- ARGdov 11:40 AM: "such a fucking mindfuck”
- BUP 11:43 AM: "okay well i will retreat for now”
- BUP 11:43 AM: "i hope we can play our game soon”
- ARGdov 11:43 AM: "see ya BUP”
- PAKO 11:44 AM: "https://youtu.be/WRzIuC2MKOU”
- Jos 11:50 AM: ”@Upd8”
- Jos 11:50 AM: “https://youtu.be/r1w5VBYl6cc”
- Jos 11:50 AM: "Wait
- Jos 11:50 AM: "Why did youtube just warned me
- Jos 11:50 AM: "Fuck you youtube
- Eevee Reborn 11:55 AM: "There was a whole begining to that video that’s gone now”
- ARGdov 11:56 AM: "shit yeah what the hell”
- ARGdov 11:56 AM: "the whole "out of character” bits gone”
- ((…))
- ADULT_LINK△ 6:40 PM: “yall ever do bomb boosts”
- BUP 6:59 PM: "bomboost”
- Xenquility 7:00 PM: "Hey bup”
- ADULT_LINK△ 7:01 PM: "https://www.youtube.com/watch?v=JEtHpCfi_DE”
- Wolfcat 7:01 PM: "you guys should speedrun Buphead”
- BUP 7:30 PM: "no matter how hard you try”
- BUP 7:30 PM: "you will never be this good”
- BUP 7:30 PM: "https://www.youtube.com/watch?v=-_n52JJpwe8”
- ADULT_LINK△ 7:31 PM: "damn that musta taken like. a lot of tries to get that set up and timed”
- Xenquility 7:33 PM: "Thorin you willing to do the run?”
- ADULT_LINK△ 7:34 PM: "uhhh”
- ADULT_LINK△ 7:34 PM: "i havent touched botw in a while”
- ADULT_LINK△ 7:34 PM: "my switch still has my freinds blood on it from the car crash too”
- ADULT_LINK△ 7:34 PM: "i havent gotten around to cleaning that off or really touching the switch at all”
- Xenquility 7:37 PM: "Does anyone here actually play botw then?”
- BUP 7:38 PM: "oh well”
- Xenquility 7:38 PM: "What does "oh well” mean”
11/14/19 - Chat with The Producer
- ReturnedFaith 11:59 AM: “hello Internet Coomtectives”
- ReturnedFaith 11:59 AM: "I heard you’re all quite the murderous lot”
- Slinky Stinks△ 12:00 PM: "we arent actually the coomtectives”
- Slinky Stinks△ 12:00 PM: "more like detectives”
- Xenquility 12:00 PM: "We mean well”
- Slinky Stinks△ 12:00 PM: "the murderous lot?”
- Slinky Stinks△ 12:00 PM: "nani?”
- ReturnedFaith 12:00 PM: "someone died last night, didn’t they?”
- ReturnedFaith 12:00 PM: "or technically not last night”
- Slinky Stinks△ 12:01 PM: "okay CANONMOMENT”
- ReturnedFaith 12:01 PM: "I guess "murder” is subjective in this case”
- Slinky Stinks△ 12:01 PM: “yeah last nigth a friend of us died”
- ReturnedFaith 12:02 PM: "yeah”
- ReturnedFaith 12:02 PM: "I was watching”
- ReturnedFaith 12:02 PM: "rest in peace kaiden”
- Slinky Stinks△ 12:02 PM: "oh nice”
- Xenquility 12:02 PM: "Kaiden?”
- Slinky Stinks△ 12:02 PM: "Wait WHAT”
- ReturnedFaith 12:02 PM: "im kidding”
- Slinky Stinks△ 12:02 PM: "ffs my heart”
- ReturnedFaith 12:02 PM: "yuuki was "killed” “"again”“”
- Slinky Stinks△ 12:03 PM: "alrigth yea”
- ReturnedFaith 12:03 PM: "but in reality it was something that could not be avoided “
- MonikaBOT 12:03 PM: "Do you understand reality?”
- ReturnedFaith 12:03 PM: "since it already had happened”
- ReturnedFaith 12:03 PM: "hello monika”
- Xenquility 12:03 PM: "Dov will love you”
- Slinky Stinks△ 12:03 PM: "i mean yeah, thats how time loops work”
- Xenquility 12:03 PM: "You one of SKM’s lot?”
- Slinky Stinks△ 12:03 PM: "if a thing happens there is no way to stop it as it is gonna happen”
- ReturnedFaith 12:03 PM: "im not really sure if id call it time in this case”
- ReturnedFaith 12:03 PM: "but i guess it kinda is”
- ReturnedFaith 12:03 PM: "no, im not affiliated with SKM”
- Slinky Stinks△ 12:04 PM: "alrigth”
- ReturnedFaith 12:04 PM: "I’m a member of BUP’s group”
- Xenquility 12:04 PM: "Of course”
- Xenquility 12:04 PM: "Well, welcome”
- Slinky Stinks△ 12:04 PM: "nice”
- Slinky Stinks△ 12:04 PM: "welcome”
- ReturnedFaith 12:04 PM: "but dont worry”
- ReturnedFaith 12:04 PM: "im not going to kill anyone”
- SayoriBOT 12:04 PM: "Can we change the topic to something more wholesome please?”
- Xenquility 12:05 PM: "What are your motives then?”
- ReturnedFaith 12:05 PM: "I don’t have that sort of power, though I guess I could put in a request if I really wanted”
- Slinky Stinks△ 12:05 PM: "put a request?”
- Slinky Stinks△ 12:05 PM: "wildest office in the paralellos”
- ReturnedFaith 12:05 PM: "my motives are”
- ReturnedFaith 12:05 PM: "I am bored and just wanna chat”
- Slinky Stinks△ 12:06 PM: "well then”
- Slinky Stinks△ 12:06 PM: "lets chat”
- ReturnedFaith 12:06 PM: "it’s not a very organized office, though”
- Xenquility 12:06 PM: "That’s nice to hear”
- Xenquility 12:06 PM: "What exactly do you produce?”
- Slinky Stinks△ 12:06 PM: "okay i really got a stupid question”
- Slinky Stinks△ 12:06 PM: "nvm”
- ReturnedFaith 12:07 PM: "ask”
- Slinky Stinks△ 12:07 PM: "i migth kill someone with this”
- Slinky Stinks△ 12:07 PM: "no thanks”
- /Mr. Circle\ 12:07 PM: "This guy doesn’t donkey kong”
- ReturnedFaith 12:07 PM: "also I produce a variety for things for BUP”
- ReturnedFaith 12:07 PM: "as I said, I don’t have the power to kill”
- ReturnedFaith 12:08 PM: "but BUP does”
- ReturnedFaith 12:08 PM: ”:diddy:”
- Slinky Stinks△ 12:08 PM: “do you make beats?”
- ReturnedFaith 12:08 PM: "to some extent”
- Xenquility 12:09 PM: "So you really don’t want to bring down the moon OR kill anyone?”
- ReturnedFaith 12:09 PM: "I’m not a music producer, though I have made one or two short tracks in the past”
- Slinky Stinks△ 12:09 PM: "migth i ask you the name of those tracks, really like music, i migth know them”
- ReturnedFaith 12:09 PM: "bringing down the moon would be an unfortunate ending”
- ReturnedFaith 12:09 PM: "its not my wish”
- Xenquility 12:09 PM: "Nice to finally have someone who isn’t either being hunted by moon people, is a moon person, or wants to kill anyone”
- Slinky Stinks△ 12:10 PM: "tru”
- Xenquility 12:10 PM: "Have we interacted with you before?”
- ReturnedFaith 12:10 PM: "they dont have names, I simply create and ship them as I do other things that are needed”
- Slinky Stinks△ 12:11 PM: "neat”
- Slinky Stinks△ 12:11 PM: "you seem chill dude”
- ReturnedFaith 12:11 PM: "and yes, you have”
- Slinky Stinks△ 12:11 PM: "wait”
- ReturnedFaith 12:11 PM: "I am a good guy”
- ReturnedFaith 12:11 PM: ”:wink:”
- Slinky Stinks△ 12:11 PM: “ffs”
- Xenquility 12:11 PM: "I’m guessing you won’t be able to tell us when we interacted with you”
- ReturnedFaith 12:11 PM: "right now”
- Xenquility 12:11 PM: ”(Other than right now)”
- ReturnedFaith 12:11 PM: “right then”
- Xenquility 12:12 PM: ”(other than today)”
- ReturnedFaith 12:12 PM: “tomorrow”
- Xenquility 12:12 PM: ”(That isn’t in the future)”
- ReturnedFaith 12:12 PM: “two tomorrow’s yesterday”
- Xenquility 12:12 PM: "That’s still tomorrow”
- Slinky Stinks△ 12:12 PM: "oh yea timefucks”
- Slinky Stinks△ 12:12 PM: "this is my jam”
- ReturnedFaith 12:12 PM: "what is today but yesterday’s tomorrow?”
- Xenquility 12:13 PM: "Today”
- Slinky Stinks△ 12:13 PM: ”:cmonbruh:”
- ReturnedFaith 12:13 PM: “time shit is confusing, i know”
- ReturnedFaith 12:13 PM: "but only when you don’t have all of the details”
- Slinky Stinks△ 12:14 PM: "exactly”
- Xenquility 12:14 PM: "Hey, we don’t have any punishments for asking questions anymore, right?”
- Slinky Stinks△ 12:14 PM: "like fucking dr strange must be the wokest nigga in the galaxy”
- ReturnedFaith 12:14 PM: "no”
- Xenquility 12:14 PM: "Sweet”
- Slinky Stinks△ 12:14 PM: "he knows ALL the time shit”
- ReturnedFaith 12:14 PM: "unless BUP decides to return and starts going mental”
- ReturnedFaith 12:14 PM: "but I can’t answer very much”
- ReturnedFaith 12:14 PM: "well, I can, but I’d rather not”
- Slinky Stinks△ 12:15 PM: "are you like that super chill dude in the office that hates the boss but loves his mates?”
- Xenquility 12:15 PM: "Did you just insinuate he hates bup”
- Xenquility 12:15 PM: "DEATH”
- ReturnedFaith 12:15 PM: "I guess”
- ReturnedFaith 12:15 PM: "oops”
- Slinky Stinks△ 12:15 PM: "lmao”
- Slinky Stinks△ 12:15 PM: "dw”
- ReturnedFaith 12:15 PM: "I’m kinda more like the temp”
- Slinky Stinks△ 12:16 PM: "cool”
- Slinky Stinks△ 12:16 PM: "you seem cool”
- ReturnedFaith 12:16 PM: "we’ve all been very busy lately”
- Xenquility 12:17 PM: "Ay quick question, what time is it for you?”
- ReturnedFaith 12:17 PM: "especially myself”
- Slinky Stinks△ 12:17 PM: "yo i bet his time is like”
- Slinky Stinks△ 12:17 PM: "no time”
- ReturnedFaith 12:17 PM: "it is around noon”
- Slinky Stinks△ 12:17 PM: "oh”
- Xenquility 12:17 PM: "So est”
- Slinky Stinks△ 12:17 PM: "here is almost evening”
- Xenquility 12:17 PM: "All I can find from arg at 11:28 is him talking about gay body types lmao”
- ReturnedFaith 12:17 PM: "sounds like him”
- Slinky Stinks△ 12:17 PM: "shithappens.com”
- Xenquility 12:17 PM: "What were you quoting?”
- ReturnedFaith 12:18 PM: "that was my mistake”
- ReturnedFaith 12:18 PM: "i was attempting to copy something else”
- Xenquility 12:18 PM: "Ah okay”
- ReturnedFaith 12:18 PM: "or was it?”
- ReturnedFaith 12:18 PM: "ooh”
- ReturnedFaith 12:18 PM: ”(still have to be a little mysterious)”
- Slinky Stinks△ 12:18 PM: “ooooooh”
- Slinky Stinks△ 12:18 PM: "oh rigth you are supposed to be a spooky tech guy”
- ReturnedFaith 12:19 PM: ”(regulations, you know)”
- Xenquility 12:19 PM: “So, have we previously interacted with everyone on BUP’s team?”
- Slinky Stinks△ 12:19 PM: "xen you already know the answer”
- Xenquility 12:19 PM: "I do?”
- ReturnedFaith 12:19 PM: "not everyone”
- Slinky Stinks△ 12:20 PM: "oh”
- Slinky Stinks△ 12:20 PM: "fuck you are the less predecible guy ive met”
- Slinky Stinks△ 12:20 PM: "congrats”
- ReturnedFaith 12:20 PM: "thanks i suppose”
- Slinky Stinks△ 12:20 PM: "i thougth you were gonna say some confusing time shit lol”
- ReturnedFaith 12:21 PM: "you will come to remember them in time”
- ReturnedFaith 12:21 PM: "does that work”
- Slinky Stinks△ 12:21 PM: "are there a lot more of BUP guys?”
- ARGdov 12:21 PM: "oh so this mut be the new person”
- ARGdov 12:21 PM: "hello”
- Slinky Stinks△ 12:21 PM: "ayy dov”
- ARGdov 12:21 PM: "heyo”
- ReturnedFaith 12:21 PM: "theres about sevenish?”
- ReturnedFaith 12:21 PM: "but thats not like an exact number”
- ARGdov 12:21 PM: ”…theres 7 of you”
- ARGdov 12:21 PM: “wow ok then”
- ReturnedFaith 12:21 PM: "some come and go”
- Azura 12:22 PM: "What tf is going on in here”
- Xenquility 12:22 PM: "Is Bup that broker of nokturnal guy from the Kaiden RP video”
- ReturnedFaith 12:22 PM: "hello azura”
- Slinky Stinks△ 12:22 PM: "ay azura this is producer”
- ReturnedFaith 12:22 PM: "Bup is Bup”
- Azura 12:22 PM: "Hewwo,,,”
- ReturnedFaith 12:22 PM: "if I tell you more about Bup he will smite me”
- ReturnedFaith 12:22 PM: "then i will be out of a job”
- Xenquility 12:22 PM: "Azura is a massive coomer”
- ReturnedFaith 12:22 PM: "so I’ve heard”
- Azura 12:23 PM: "HEY NOW”
- Azura 12:23 PM: "Dont slander me”
- Slinky Stinks△ 12:23 PM: "smite like… litterally smite?”
- ReturnedFaith 12:23 PM: "I imagine hearing that there are about seven of us is quite the headache”
- ReturnedFaith 12:23 PM: "but it’s really not that complicated”
- ReturnedFaith 12:23 PM: "or I guess kinda it is”
- Xenquility 12:23 PM: "I mean, if we already know who you guys are it can’t be that bad”
- ARGdov 12:23 PM: "so like”
- ARGdov 12:23 PM: "actually nah Im not gonna ask”
- ARGdov 12:23 PM: "Im not gonna get a straight answer”
- ReturnedFaith 12:24 PM: "lose your bloodthirst?”
- ARGdov 12:24 PM: "pffff”
- Slinky Stinks△ 12:24 PM: "yo dov did you really did a bomb plans 3.0 last nigth”
- ARGdov 12:24 PM: "great to see word about thats gone around”
- ARGdov 12:24 PM: "I did not”
- ReturnedFaith 12:24 PM: "word gets around fast in the "office"”
- Xenquility 12:24 PM: "It’’s canon Dov was right”
- ARGdov 12:24 PM: "if anything this was bomb plans 2.0 cause the runes thing couldve got a lot worse”
- Xenquility 12:24 PM: "Dov was destined to do it”
- ARGdov 12:25 PM: "and yeah”
- ReturnedFaith 12:25 PM: ”-looks into the camera-”
- ARGdov 12:25 PM: “I couldnt have not done it because it had already happened, in a way”
- Xenquility 12:25 PM: "Kill switch and runes add up to 1”
- ARGdov 12:25 PM: "hey now!”
- ARGdov 12:25 PM: "the kill switch was the right call”
- ARGdov 12:25 PM: "also”
- Slinky Stinks△ 12:25 PM: ”-seinfield theme starts playin’-”
- ARGdov 12:25 PM: “I didnt end up being the only vote”
- Xenquility 12:25 PM: ”:)”
- ARGdov 12:25 PM: “the thing glitched temporarily so no one else could vote but it got fixed quickly so others could”
- ReturnedFaith 12:26 PM: "let him who is without sin cast the first stone”
- ARGdov 12:26 PM: "granted for like 5 mintues it seemed like I’d offed Luna or whoever”
- ReturnedFaith 12:26 PM: "unless it is argdov”
- Slinky Stinks△ 12:26 PM: "lmao”
- ARGdov 12:26 PM: "pfff”
- Slinky Stinks△ 12:26 PM: "oh oh i know what to do”
- ARGdov 12:26 PM: "just as well that Ive never read the new testament”
- Slinky Stinks△ 12:26 PM: "Vibe check!”
- Slinky Stinks△ 12:26 PM: ”-hands you a toad-”
- ARGdov 12:26 PM: “take toad”
- ARGdov 12:26 PM: ”?”
- ReturnedFaith 12:26 PM: “give it to Bup”
- ReturnedFaith 12:26 PM: "they love toads”
- Slinky Stinks△ 12:27 PM: "t h e y ?”
- ARGdov 12:27 PM: "yes I had a feelin”
- ReturnedFaith 12:27 PM: "wait wrong toad probably”
- ARGdov 12:27 PM: "true”
- ARGdov 12:27 PM: "we’re talking about froglike beings”
- Slinky Stinks△ 12:27 PM: "yea”
- ARGdov 12:27 PM: "that damn toad profile picture threw me off I gotta say”
- ReturnedFaith 12:27 PM: "yeah I dont think ghost will want to keep that once they regain control”
- Slinky Stinks△ 12:28 PM: "yo dov drop the toad already he is tired”
- ARGdov 12:28 PM: "oh sorry”
- ARGdov 12:28 PM: "lets toad go”
- ARGdov 12:28 PM: "by froggo”
- ReturnedFaith 12:28 PM: "splat”
- Slinky Stinks△ 12:28 PM: "i hope ghost changes his password after this”
- ReturnedFaith 12:28 PM: "it wouldnt matter”
- Xenquility 12:28 PM: "Excuse me ghost is a strong independent woman”
- ARGdov 12:28 PM: "actually yeah Im wondering what ghostbabels up to now”
- ReturnedFaith 12:28 PM: "oh right”
- Slinky Stinks△ 12:28 PM: "i bet his pasword was something like: 12345BABEL”
- Xenquility 12:28 PM: "56709IDIDDLEDKIDS”
- ARGdov 12:29 PM: "pfff”
- ARGdov 12:29 PM: "I hope not, he was smarter than that”
- ReturnedFaith 12:29 PM: "howd you guess mugen’s password”
- Xenquility 12:29 PM: "gg”
- ARGdov 12:29 PM: ”….how do you know who Mugen is”
- Slinky Stinks△ 12:29 PM: “howd u know mugen”
- Xenquility 12:29 PM: "HE IS MUGEN”
- ReturnedFaith 12:29 PM: "I’ve interacted with him on several occasions”
- Xenquility 12:29 PM: "BUM BUM BUM”
- Slinky Stinks△ 12:29 PM: "lmao”
- ARGdov 12:29 PM: "wait what”
- Slinky Stinks△ 12:29 PM: "i told ya fucking mugen did moon rituals”
- ReturnedFaith 12:29 PM: "he frequents our office”
- ARGdov 12:29 PM: "why on earth would you speak to him hes not in the group anymore and he sucks”
- ReturnedFaith 12:29 PM: "delivering pizza”
- ARGdov 12:29 PM: ”.ahahahahha”
- ReturnedFaith 12:29 PM: “im kidding”
- ARGdov 12:30 PM: "yeah I gathered”
- Slinky Stinks△ 12:30 PM: "plot twist bup is mugen”
- ReturnedFaith 12:30 PM: "I havent spoken with him in some time”
- ARGdov 12:30 PM: "plot twist Bup is nobody we’ve met before”
- Xenquility 12:30 PM: "Plot twist Bup can’t actually kill anyone which is why he chose Yuuki”
- SayoriBOT 12:30 PM: "Can we change the topic to something more wholesome please?”
- Xenquility 12:30 PM: "because she’s already dead”
- ARGdov 12:30 PM: "oh piss of sayori”
- Slinky Stinks△ 12:30 PM: "omae wa mou”
- ARGdov 12:30 PM: "I mean, he might not be able to”
- ARGdov 12:30 PM: "but I wouldnt want to risk that again”
- Slinky Stinks△ 12:31 PM: "bros im trying to get the source code of a HS character infobox but it is massive”
- Slinky Stinks△ 12:31 PM: "mine is CSS becuase im fucking useless”
- Slinky Stinks△ 12:31 PM: "and it isnt even code”
- ARGdov 12:31 PM: "also intereting thing I just noticed”
- ARGdov 12:31 PM: ”@ReturnedFaith is there any particular meaning behind your proper discord username?”
- ARGdov 12:31 PM: “its "Returned Faith"”
- ReturnedFaith 12:33 PM: "yeah”
- ReturnedFaith 12:33 PM: "because again”
- ReturnedFaith 12:33 PM: "I gotta be at least a little mysterious”
- ARGdov 12:33 PM: "fair I suppose”
- Xenquility 12:33 PM: "what if these guys were like”
- Xenquility 12:33 PM: "Hope and her friends from the Truth arc”
- ARGdov 12:33 PM: "but Im taking the clues I can find”
- ARGdov 12:33 PM: "ahahaha”
- ARGdov 12:33 PM: "that would be something”
- Slinky Stinks△ 12:33 PM: "yeah sorry about me dont reading the wiki yet”
- ARGdov 12:33 PM: "we dont even know what happened to them”
- Slinky Stinks△ 12:33 PM: "who was hope exactly?”
- Xenquility 12:33 PM: "Exactly”
- ARGdov 12:34 PM: "Ill explain in PM: "s”
- Wolfcat 12:34 PM: "argdov is a meanie”
- Xenquility 12:34 PM: "which was why they are definitely them”
- SayoriBOT 12:34 PM: "Do we have a meanie in the server? If so, please stop.”
- ReturnedFaith 12:34 PM: "BUP is usually pretty chill but he can be strict at times”
- Slinky Stinks△ 12:34 PM: "i mean he vibin”
- Slinky Stinks△ 12:34 PM: "but he killin too”
- Wolfcat 12:34 PM: "s_feed :bottle:”
- SayoriBOT 12:34 PM: "Ptoo ptoo! This isn’t food, you meanie!”
- Wolfcat 12:34 PM: "s_feed :baby_bottle:”
- SayoriBOT 12:34 PM: "Hey! I’m not a baby!”
- Wolfcat 12:34 PM: "be quiet”
- ARGdov 12:34 PM: "Im not a meanie :c”
- SayoriBOT 12:34 PM: "Cease your bulli, you meanie!”
- Xenquility 12:35 PM: "dov is the antithesis of a meanie”
- ARGdov 12:35 PM: "no you”
- SayoriBOT 12:35 PM: "Cease your bulli, you meanie!”
- ARGdov 12:35 PM: "shh”
- Wolfcat 12:35 PM: "You’re not a meanie”
- SayoriBOT 12:35 PM: "Cease your bulli, you meanie!”
- Wolfcat 12:35 PM: "You’re just a murderer”
- ARGdov 12:35 PM: "OH PLEASE”
- ARGdov 12:35 PM: "THIS WHOLE GROUP HAS BEEN RESPONSIBLE FOR MORE THAN A FEW DEAGTHS”
- Xenquility 12:35 PM: "stop bullying dov”
- Slinky Stinks△ 12:35 PM: "i didnt kill anyone”
- Xenquility 12:35 PM: "SLINKY”
- ARGdov 12:35 PM: "remember when we fucking drowned a man in a fucking stormdrain”
- Xenquility 12:35 PM: "YOU PLAYED THE ELEGY TWICE”
- Slinky Stinks△ 12:35 PM: "BUT I DIDNT KILL ANYONE”
- ARGdov 12:36 PM: "remember when we accidentally got someone hit with a rock and then they died?”
- ARGdov 12:36 PM: "remember when someone submitted the song of healing during the truth arc?”
- ReturnedFaith 12:36 PM: "hey”
- ReturnedFaith 12:36 PM: "helper got better”
- ARGdov 12:36 PM: "he did”
- ReturnedFaith 12:36 PM: "at least”
- ARGdov 12:36 PM: "in fact plenty of people have gotten better”
- ARGdov 12:36 PM: "and Yukis not gone”
- Xenquility 12:36 PM: "I mean”
- ARGdov 12:36 PM: "shes just been "condemned to a lfietime of stockholm syndrome” presumably trapped in the depths of AO”
- Xenquility 12:37 PM: “that’s debatable”
- ARGdov 12:37 PM: "which is kind of awful but shes not totally gone”
- Slinky Stinks△ 12:37 PM: "gonna do some quick homework brb”
- ARGdov 12:37 PM: "actually who in this game HAS been totally been killed?”
- ARGdov 12:37 PM: "like, with no digital spirit lingerin on”
- Slinky Stinks△ 12:37 PM: "john”
- Xenquility 12:37 PM: "Anyways we can’t exactly do anything about yuuki so we should probably focus on literally anything else”
- ARGdov 12:37 PM: "uh not true, actually”
- ARGdov 12:37 PM: "tenebris took over John”
- Xenquility 12:37 PM: "Actually John’s body is still around”
- DensO Burton 12:37 PM: "Mugen”
- ARGdov 12:37 PM: "his soul, that is”
- Xenquility 12:38 PM: "He’s a deuro”
- ARGdov 12:38 PM: "and so it might still be out there somewhere”
- ReturnedFaith 12:38 PM: "johns is both here and gone at the same time on multiple levels”
- ARGdov 12:38 PM: "once someone is digitized it seems like they dont just fade away”
- Xenquility 12:42 PM: "Nice to finally see a guy we know about”
- ARGdov 12:42 PM: "weve not spoken to him in fucking ages as well”
- ARGdov 12:42 PM: "like, since 2016”
- Slinky Stinks△ 12:43 PM: "also wasn’t skm like super chill too?”
- ARGdov 12:43 PM: "he was p great”
- ARGdov 12:43 PM: "he called regiminis "regimipiss"”
- ARGdov 12:43 PM: "he was a salty bro”
- Xenquility 12:43 PM: "He’s the only guy I’ve seen in jid that has canonically said, "XD"”
- ARGdov 12:44 PM: "ahahhaha”
- ARGdov 12:44 PM: "he said "XD” therefore he must be p great”
- ARGdov 12:44 PM: “but yeah no he was good”
- Slinky Stinks△ 12:44 PM: "XD”
- ARGdov 12:44 PM: "I wonder what hes been up to”
- ARGdov 12:44 PM: "like he’s still involved in this shit to an extent”
- ARGdov 12:44 PM: "and hes apparently working with a team of hackers now”
- ARGdov 12:44 PM: "which Im glad to hear. He was working almost entirely on his own when we last spoke to him”
- Slinky Stinks△ 12:45 PM: "i mean he broke into tylers hoese bc someone gavehis mask to him”
- ARGdov 12:46 PM: "true”
- Slinky Stinks△ 12:47 PM: "finished homework woo”
- ARGdov 12:47 PM: "nice”
- ARGdov 12:47 PM: "Im just starting rip”
- ARGdov 12:47 PM: "also does the producer not have permissions to chat or has he just gone quiet?”
- Slinky Stinks△ 12:48 PM: "idk”
- Xenquility 12:48 PM: "Gone quiet”
- ReturnedFaith 12:48 PM: "XD”
- ReturnedFaith 12:48 PM: "Yes sorry im here”
- ARGdov 12:48 PM: "ah ok”
- Slinky Stinks△ 12:48 PM: "fuck yea”
- ReturnedFaith 12:48 PM: "SKM always was a fun one”
- ARGdov 12:48 PM: "hes a good guy”
- Jos 12:49 PM: "Skm used LOL XD LMAO”
- ARGdov 12:49 PM: "Ive no clue what the fuck hes been up to recently”
- Xenquility 12:49 PM: "Wow what a way to steal the "XD” award from SKM”
- Slinky Stinks△ 12:49 PM: “okay prod, so you seem to know a lot of info about all this”
- ARGdov 12:49 PM: "I guess he escpaed whatever occured at the lunar spire”
- Slinky Stinks△ 12:49 PM: "how”
- ReturnedFaith 12:49 PM: "I’ve been watching it for a long time”
- Jos 12:49 PM: "Hello guys irs ya boy SKM XDDD the forums are broke again LOL patrem being annoying about it”
- Jos 12:49 PM: "Rhats skm”
- ReturnedFaith 12:49 PM: "though ill admit i have no idea where SKM is currently”
- /Mr. Circle\ 12:50 PM: "skm is not the only one to have uttered the forbidden emoji”
- Slinky Stinks△ 12:50 PM: "so lets say you have about the same info that we have”
- ARGdov 12:50 PM: "BUP said SKMs working with some hackers”
- Jos 12:50 PM: "How do i know he is cannon?”
- ARGdov 12:50 PM: "when I asked what on he said "on their computers"”
- ReturnedFaith 12:50 PM: "thats right”
- ReturnedFaith 12:50 PM: "Hina”
- /Mr. Circle\ 12:50 PM: "hina616 has also XD'd”
- ReturnedFaith 12:50 PM: "poor little Hina”
- /Mr. Circle\ 12:50 PM: "oh fuck you beat me to it”
- Slinky Stinks△ 12:51 PM: "Who*”
- Slinky Stinks△ 12:51 PM: "woo was hina?”
- ReturnedFaith 12:51 PM: "quiet, gamejacker”
- /Mr. Circle\ 12:51 PM: "meta”
- ReturnedFaith 12:51 PM: "Hina was a Lunar Child”
- Slinky Stinks△ 12:51 PM: "meta”
- Slinky Stinks△ 12:51 PM: "alrite”
- Jos 12:52 PM: "How do I know you are cannon Producer”
- ReturnedFaith 12:52 PM: "I guess you don't”
- Slinky Stinks△ 12:52 PM: "meta”
- ARGdov 12:52 PM: "I dont remember hina”
- ARGdov 12:52 PM: "but then I cant keep track of everything”
- ReturnedFaith 12:53 PM: "she is rather forgettable”
- Slinky Stinks△ 12:53 PM: "neat”
- ReturnedFaith 12:54 PM: "in the grand scheme of things, that is”
- ReturnedFaith 12:54 PM: "out of the rest of them, she was probably the most memorable”
- Xenquility 12:55 PM: "Oh producer”
- Xenquility 12:55 PM: "Are you and bup male or female”
- ARGdov 12:55 PM: "rip”
- Slinky Stinks△ 12:56 PM: "are you assuming they are Gender Binary?”
- Xenquility 12:56 PM: "Yes”
- Slinky Stinks△ 12:56 PM: "TRIGGERED”
- /Mr. Circle\ 12:56 PM: "That’s a Funny Joke”
- ReturnedFaith 12:56 PM: "I’m not sure about BUP, but for myself”
- ReturnedFaith 12:56 PM: "I prefer male”
- ARGdov 12:57 PM: ”…..”
- ARGdov 12:57 PM: “wow”
- otherLiam 12:57 PM: "who’s this now”
- Xenquility 12:57 PM: "Male ocol”
- ARGdov 12:57 PM: "thats an old fucking joke”
- Xenquility 12:57 PM: ”*cool”
- Slinky Stinks△ 12:57 PM: “- Go apeshit i guess”
- ARGdov 12:57 PM: "someone who works with BUP”
- otherLiam 12:57 PM: "oh cool”
- Xenquility 12:57 PM: "If Bup is female I’m sticking to my theory about them being Hope and her friends lmao”
- ARGdov 12:57 PM: "yup”
- Slinky Stinks△ 12:57 PM: "yeah he is super chill”
- Xenquility 12:57 PM: "This guy doesn’t want to kill anyone he’s great”
- ARGdov 12:58 PM: "he hasnt threatened to kill anyone so thats a plus”
- otherLiam 12:59 PM: "i mean bup didnt really threaten either. more like just laid out the consequences for losing”
- Slinky Stinks△ 12:59 PM: ”- It is I, dave strider homesuck free Vector PNG 2019”
- Sheena0 12:59 PM: “is there a consequence if we win tho?”
- ReturnedFaith 12:59 PM: "He is more experienced”
- ReturnedFaith 12:59 PM: "but I dont really have as many responsibilities”
- ReturnedFaith 12:59 PM: "so I’m free to be a bit more loose”
- ReturnedFaith 12:59 PM: "but I will have to get back to work soon”
- otherLiam 1:00 PM: "what exactly is your work?”
- ReturnedFaith 1:00 PM: "Producing”
- Slinky Stinks△ 1:00 PM: "yea he produces”
- ReturnedFaith 1:00 PM: "providing BUP and others with whatever they need”
- /Mr. Circle\ 1:00 PM: "this guy produces”
- otherLiam 1:01 PM: "what do they need now?”
- ARGdov 1:01 PM: "they need the d”
- ReturnedFaith 1:01 PM: "things”
- ARGdov 1:01 PM: "like I said”
- ReturnedFaith 1:01 PM: "but no really”
- ARGdov 1:01 PM: "the d”
- ReturnedFaith 1:01 PM: "they need a lot of stuff”
- ReturnedFaith 1:01 PM: "including the d”
- ARGdov 1:01 PM: "I, too am in need of….things”
- ReturnedFaith 1:01 PM: "and stuff?”
- Slinky Stinks△ 1:01 PM: "CONFIRMED”
- ARGdov 1:01 PM: "welp Im glad we have one thing in common then”
- Slinky Stinks△ 1:01 PM: "bup needs the d”
- otherLiam 1:01 PM: "dov stop bein horny on main”
- ARGdov 1:02 PM: "pffff”
- ARGdov 1:02 PM: "trust me this isnt me being horny”
- /Mr. Circle\ 1:02 PM: "dov only has main to be horny on”
- ReturnedFaith 1:02 PM: "if they require the d, then Im afraid I must provide”
- ARGdov 1:02 PM: "that as well”
- ARGdov 1:02 PM: "welp”
- Xenquility 1:02 PM: "Oh god”
- Xenquility 1:02 PM: "Hot”
- Slinky Stinks△ 1:02 PM: "prod, provide your d”
- Xenquility 1:02 PM: "Can I join you guys”
- ARGdov 1:02 PM: "if they need a lot of things they must be preparing for something”
- ReturnedFaith 1:02 PM: "I dont work for you, traitor”
- otherLiam 1:02 PM: ”(also sorry for goin off on you yesterday dov)”
- ARGdov 1:02 PM: “(its cool lol)”
- /Mr. Circle\ 1:02 PM: "may we please have d?”
- Slinky Stinks△ 1:03 PM: ”(Nigga who u called traitor)”
- Xenquility 1:03 PM: “If you guys are providing d Ill join”
- ARGdov 1:03 PM: "man ok I did not intend to derail this with shitposting lol”
- Slinky Stinks△ 1:03 PM: "so”
- ARGdov 1:03 PM: "either way, like I just said”
- Slinky Stinks△ 1:03 PM: "do we provide the d?”
- Ross the Claus 🎄 1:03 PM: "heard something about someone producing a d”
- ARGdov 1:03 PM: "they need things (potentially including the d) to do…something”
- ARGdov 1:03 PM: "potentially a ritual?”
- ARGdov 1:03 PM: "who knows”
- Slinky Stinks△ 1:04 PM: "now its when the d means: DESTRUCTIVE LASERGUN”
- otherLiam 1:04 PM: "man who knows anything”
- Ross the Claus 🎄 1:04 PM: "Ritual involving the d. Sounds about right for this arg”
- ARGdov 1:04 PM: "I love performing rituals with my d”
- otherLiam 1:05 PM: "we dunno who these guys are, what theyre tryin to do or if we should even be trying to stop them”
- Slinky Stinks△ 1:05 PM: "nah girl i cant go out with u tonigth, i gotta perform theritual with my d”
- ARGdov 1:05 PM: "shh”
- otherLiam 1:05 PM: "hell maybe we want them to succeed”
- ARGdov 1:05 PM: "I dont trust anyone who has the kind of power BUP currently has”
- otherLiam 1:05 PM: "maybe them doing their thing will fuck with our other enemies”
- Slinky Stinks△ 1:05 PM: "nah m8”
- Xenquility 1:05 PM: "I wanna get :BUP:ed with their d”
- ARGdov 1:05 PM: "Im not trusting anyone except for potentially SKM”
- otherLiam 1:05 PM: "who knows”
- ReturnedFaith 1:05 PM: "since you asked nicely”
- ReturnedFaith 1:05 PM: ((A distorted D image is posted))
- Slinky Stinks△ 1:05 PM: "producer has 10 times less the power that bup has”
- Sheena0 1:06 PM: "i kinda feel we need to figure them out first then go to understanding their reason”
- Xenquility 1:06 PM: "THE D”
- Xenquility 1:06 PM: "YES”
- Slinky Stinks△ 1:06 PM: "THE D”
- ARGdov 1:06 PM: "Im still thinking about this”
- otherLiam 1:06 PM: "Producer is now my favorite”
- ARGdov 1:06 PM: "why would I have a different discord account to be horny on lol”
- otherLiam 1:06 PM: "“main” isnt your discord account, it’s the chat you’re in”
- ReturnedFaith 1:07 PM: "now i need to get back to work”
- ARGdov 1:07 PM: "ah fair”
- ReturnedFaith 1:07 PM: "for real”
- ARGdov 1:07 PM: "well Im in other groups”
- ReturnedFaith 1:07 PM: "bye for now”
- ARGdov 1:07 PM: "but rest assured”
- Slinky Stinks△ 1:07 PM: "wait prod”
- otherLiam 1:07 PM: "have fun producer”
- ReturnedFaith 1:07 PM: "whats up traitor”
- ARGdov 1:07 PM: "if I was being horny on main you’d all tell me to leave”
- otherLiam 1:07 PM: "ooo shit”
- ARGdov 1:07 PM: "anyways, bye producer”
11/15/19 - Chat with The Producer
- The Producer 1:51 PM: “whats up”
- The Producer 1:51 PM: "the producer, comin at you again because i forgot my email address”
- Xenquility 1:51 PM: "lmao”
- The Producer 1:51 PM: "see this is why im at the bottom of the totem pole”
- The Producer 1:52 PM: "weed boys light up”
- The Producer 1:52 PM: "and yes Bup does enjoy ”“”“"fun”“”“"”
- Xenquility 1:53 PM: "Do dimension travelling bad guys still smoke weed”
- The Producer 1:53 PM: "everyone has time to smoke weed”
- Xenquility 1:53 PM: "Yknow why do these guys have to have fun by killing people”
- Xenquility 1:53 PM: "couldn’t they just get addicted to heroine or something”
- The Producer 1:53 PM: "also im not a bad guy”
- The Producer 1:53 PM: "only bup is a bad guy”
- Xenquility 1:53 PM: ”(I know)”
- The Producer 1:53 PM: “:wink:”
- The Producer 1:53 PM: "im addicted to herobrine”
- Xenquility 1:54 PM: "herobrine is my dad”
- Xenquility 1:54 PM: "give me admin or he’ll ban you”
- The Producer 1:54 PM: "damn”
- Xenquility 1:54 PM: "he knows bill gates”
- The Producer 1:54 PM: "another spooky possessed minecraft admin”
- The Producer 1:54 PM: "just kidding”
- The Producer 1:54 PM: "perhaps its best if we leave that whole debacle in the past”
- Xenquility 1:55 PM: "Hey why did Bup have to do SKM like that”
- The Producer 1:55 PM: "that wasnt Bup’s doing”
- Xenquility 1:55 PM: "Oh shit”
- The Producer 1:55 PM: "technically it wasnt any of ours”
- Xenquility 1:55 PM: "Any idea whose it was?”
- Xenquility 1:55 PM: "inb4 we cause it in the future”
- The Producer 1:56 PM: "something nasty did it”
- The Producer 1:56 PM: "dark forces mixed with one of our members”
- Xenquility 1:56 PM: "sounds kinky”
- Xenquility 1:56 PM: "what type of dark forces?”
- The Producer 1:58 PM: "dark forces we’re all familiar with”
- The Producer 1:58 PM: "things that come and go”
- The Producer 1:58 PM: "Noise”
- The Producer 1:58 PM: "id answer more clearly but that’s not in the cards atm”
- Xenquility 1:58 PM: "to which one”
- The Producer 1:58 PM: "yes”
- The Producer 1:58 PM: "he came down with a bad case of the D”
- Xenquility 1:59 PM: ”:PROVIDETHED:”
- Xenquility 1:59 PM: “wait”
- The Producer 1:59 PM: "my bad”
- Xenquility 1:59 PM: "did you have to provide him the D this time”
- The Producer 1:59 PM: "unfortunately he gave it to himself”
- Xenquility 1:59 PM: "woah”
- Xenquility 1:59 PM: "can you get him to record it next time”
- The Producer 1:59 PM: "a very talented man”
- Xenquility 1:59 PM: "I need it for science”
- Slinky Stinks△ 2:00 PM: ”:regi:”
- Xenquility 2:00 PM: “:dad3:”
- The Producer 2:00 PM: "if only we had an artist here to depict such a thing”
- Xenquility 2:00 PM: "we have a coomer to depict such things”
- Xenquility 2:00 PM: "if that counts”
- The Producer 2:00 PM: "one talented in manly copulation”
- The Producer 2:00 PM: "no coomers allowed”
- The Producer 2:00 PM: "company policy”
- Xenquility 2:01 PM: "fine by me”
- The Producer 2:01 PM: "coompany policy”
- Xenquility 2:01 PM: "I hope these conversations get archived”
- The Producer 2:02 PM: "they always do”
- Xenquility 2:02 PM: "hell yes”
- The Producer 2:02 PM: "i just have to be careful not to mention erratas or my bosses w”
- Xenquility 2:02 PM: "anyways any chance you could tell us why it was useful for :dad: and :moonman: to be in the past”
- The Producer 2:03 PM: "not sure”
- The Producer 2:03 PM: "that’s Bup’s forte”
- The Producer 2:03 PM: "but good luck getting any info out of them”
- Xenquility 2:03 PM: "the only way he gives us stuff is if we gamble with people’s lives”
- Xenquility 2:03 PM: "and even then we might not get a straight answer”
- Xenquility 2:03 PM: "sorry why do you work with this dude again”
- The Producer 2:04 PM: "a baby’s gotta do what a baby’s gotta do”
- Xenquility 2:04 PM: "do you make minimum wage”
- The Producer 2:04 PM: ”*gots to do”
- The Producer 2:04 PM: “sorry”
- Xenquility 2:04 PM: "cause if not you should sue”
- The Producer 2:08 PM: "Bup can often be a hanful”
- The Producer 2:08 PM: "and also a handful”
- The Producer 2:08 PM: "and also a mouthfull”
- The Producer 2:08 PM: "but I trust him”
- Xenquility 2:08 PM: "insulting the boss? I’m reporting you to hr”
- The Producer 2:08 PM: "no wait”
- The Producer 2:08 PM: "i dont want to get docked again”
- The Producer 2:08 PM: "my payment i mean”
- Xenquility 2:09 PM: "where can we sign up to work interdimensional office jobs sound great”
- The Producer 2:09 PM: "you all have the capacity to”
- Xenquility 2:09 PM: "the capacity to sign up?”
- The Producer 2:10 PM: "well”
- The Producer 2:10 PM: "not sign up for this specific organization”
- The Producer 2:10 PM: "but you could become a wide-eyed up and coming spooky entrepreneur based on your own merits”
- Xenquility 2:12 PM: "sounds cool”
- Xenquility 2:12 PM: "How exactly would that work?”
- The Producer 2:15 PM: "first you must enter a deep sleep where you can tap into your inner dreams”
- The Producer 2:15 PM: "then you must make a sacrifice”
- The Producer 2:15 PM: "not one of blood but one of time”
- Slinky Stinks△ 2:15 PM: "Did you say”
- Slinky Stinks△ 2:15 PM: "Dream”
- The Producer 2:15 PM: "then you must do a bunch of other stupid esoteric bullshit and boom suddenly youre the CEO of bigdicks spookyboys r us”
- Slinky Stinks△ 2:16 PM: "Cool where I can put my curriculum”
- Xenquility 2:16 PM: "i wanna be the ceo of bigdicks spookyboyrs r us”
- Xenquility 2:16 PM: "what does this "other stupid esoteric bullshit” entail?”
- The Producer 2:16 PM: “no education requirements… required”
- Slinky Stinks△ 2:16 PM: "Who shall I contact then”
- Xenquility 2:17 PM: "does doing all this shit turn you evil or is it just normally done by evil people”
- The Producer 2:18 PM: "moral requirements are also not required”
- The Producer 2:18 PM: "also i should specify that all of this is me attempting to describe very non-descript things”
- The Producer 2:18 PM: ”dont take it too literally
- The Producer 2:18 PM: "or do”
- The Producer 2:18 PM: "unless…?”
- Xenquility 2:19 PM: "so is basically a "find your own inner CEO” scam”
- Slinky Stinks△ 2:20 PM: “Piramyd scheme”
- Slinky Stinks△ 2:20 PM: ”:funkyface:”
- The Producer 2:23 PM: “Damn”
- The Producer 2:23 PM: "im starting to realize”
- The Producer 2:23 PM: "maybe this is a △ scheme”
- Xenquility 2:25 PM: "yes”
- Xenquility 2:25 PM: "come to the light side”
- Xenquility 2:25 PM: "we have uh”
- Xenquility 2:25 PM: "things”
- Slinky Stinks△ 2:25 PM: "And uh”
- The Producer 2:25 PM: "does it pay more than over here”
- Slinky Stinks△ 2:25 PM: "Phisical bodies?”
- The Producer 2:25 PM: "aka more than 0”
- Xenquility 2:25 PM: "Probably yes”
- Xenquility 2:25 PM: "Actually yes'”
- Xenquility 2:25 PM: "minimum wage is like 14 dollars in canada”
- The Producer 2:26 PM: ”>canada”
- Xenquility 2:26 PM: “lower in the US but their dollar is worth more so it balances out”
- The Producer 2:26 PM: "ill stay here thanks”
- Xenquility 2:26 PM: "aw”
- Xenquility 2:26 PM: "but if you come here you get to be hunted by your previous coworkers for all of eternity”
- Xenquility 2:26 PM: "it’s funner than it sounds”
- Slinky Stinks△ 2:27 PM: ”>14$”
- The Producer 2:27 PM: “damn”
- The Producer 2:27 PM: "theyll get The Hunter on my ass”
- Xenquility 2:27 PM: "Ooo”
- Xenquility 2:27 PM: ”“The Hunter"”
- ARGdov 2:27 PM: "I cant believe BUP and co are running an instagram pyramid scheme”
- The Producer 2:27 PM: "we sell knives”
- Slinky Stinks△ 2:27 PM: "Fuk”
- Xenquility 2:27 PM: "that sounds like the name of an edgy teenager named Hunter”
- ARGdov 2:28 PM: "man my mom bought knives from one of those people”
- ARGdov 2:28 PM: "seemingly completely unaware of how fishy theyre business strategy is”
- ARGdov 2:28 PM: "granted they are very good knives”
- The Producer 2:28 PM: "id rather they send The Hunter than The Coomer”
- Xenquility 2:28 PM: "hey”
- Xenquility 2:28 PM: "you said no coomers allowed”
- The Producer 2:29 PM: "im kidding, we don’t have either of those people”
- The Producer 2:29 PM: "you caught me”
- ARGdov 2:29 PM: "wasnt the hunter one of the skeksis in the dark crystal”
- ARGdov 2:29 PM: "sorry Im just joking”
- The Producer 2:30 PM: "we’re not that strict”
- The Producer 2:30 PM: "theres just a few rules we need to abide by”
- ARGdov 2:30 PM: "like what”
- The Producer 2:30 PM: "tbh we’re much less organized than those other guys”
- ARGdov 2:30 PM: "1: be fucking obtuse and vague to everyone outside of the company”
- The Producer 2:30 PM: "Id rather have The Coomer sent after me instead of The Operator any day”
- Xenquility 2:30 PM: "hey”
- Xenquility 2:30 PM: "you said no operator’s allowed”
- ARGdov 2:30 PM: "I mean yeah fair”
- ARGdov 2:30 PM: "the operators spoopy”
- ARGdov 2:30 PM: "glad slendermans not real”
- ARGdov 2:30 PM: "what the fuck was that”
- Xenquility 2:31 PM: ”?”
- ARGdov 2:31 PM: “some reaction popped up”
- ARGdov 2:31 PM: "it POPPED AGAIN AND I MISSED IT”
- Slinky Stinks△ 2:31 PM: "Oh fuck marble hornets”
- ARGdov 2:31 PM: "ok its "WOW"”
- Xenquility 2:31 PM: "wow”
- Slinky Stinks△ 2:31 PM: "That series is great”
- Xenquility 2:31 PM: "who reacted with it?”
- ARGdov 2:31 PM: "dunno who posted it but I can guess”
- ARGdov 2:31 PM: "Im guessing Producer”
- ARGdov 2:31 PM: "idk”
- ARGdov 2:31 PM: "I keep missing”
- Xenquility 2:32 PM: "tf they just used :dream:”
- ARGdov 2:32 PM: "yea”
- The Producer 2:32 PM: "no sorry i was away”
- Slinky Stinks△ 2:32 PM: "Prolly just wolfposting”
- ARGdov 2:32 PM: "oh yeah prolly”
- ARGdov 2:32 PM: "anyhow”
- The Producer 2:33 PM: "also
- The Producer 2:33 PM: "”1: be fucking obtuse and vague to everyone outside of the company””
- The Producer 2:33 PM: "yes”
- ARGdov 2:33 PM: "how long has your organization even been around?”
- ARGdov 2:33 PM: "thats not surprising lol”
- ARGdov 2:33 PM: "2: do whatever BUP says”
- ARGdov 2:33 PM: "3: if there is somehow an issue with these two contradicting one another, check with BUP”
- ARGdov 2:33 PM: "4: see rule one”
- Xenquility 2:34 PM: "5: ???”
- Xenquility 2:34 PM: "6: profit”
- The Producer 2:34 PM: "we’ve been around since the beginning”
- The Producer 2:34 PM: "but as ive said, some have come and gone”
- ARGdov 2:34 PM: "since the begining”
- ARGdov 2:34 PM: "so since before all this nonsense started”
- ARGdov 2:34 PM: "granted”
- ARGdov 2:34 PM: "this has been going on in some capacity since the 80s, seeing thats when the MC formed”
- ARGdov 2:34 PM: "so not really helpful”
- Slinky Stinks△ 2:35 PM: "Hm”
- The Producer 2:35 PM: "7. dont be helpful”
- ARGdov 2:35 PM: "well thats basically rule 1”
- Slinky Stinks△ 2:35 PM: "What if u disobey?”
- The Producer 2:36 PM: "ill get smote”
- Xenquility 2:36 PM: "bup can smite people wtf”
- The Producer 2:36 PM: "i dont really wish to disobey though”
- Slinky Stinks△ 2:36 PM: "Fuking zeus”
- The Producer 2:36 PM: "as i said, i trust bup”
- ARGdov 2:36 PM: "you get cut”
- ARGdov 2:36 PM: "literally”
- ARGdov 2:36 PM: "figuratively”
- ARGdov 2:36 PM: "painfully”
- ARGdov 2:36 PM: "permanently”
- The Producer 2:36 PM: "that doesnt necessarily mean you should though”
- ARGdov 2:36 PM: "or something”
- ARGdov 2:36 PM: "so you’ve been around for awhile”
- The Producer 2:37 PM: "bup will cut”
- ARGdov 2:37 PM: "but are only making yourselves known now”
- The Producer 2:37 PM: "theyre really good at scissoring”
- Xenquility 2:37 PM: "hot”
- The Producer 2:38 PM: "i cant say too much more though or they’ll get on my ass about it”
- Xenquility 2:38 PM: "if bup is good at scissoring does that confirm they’re female”
- The Producer 2:38 PM: "like i said i dont wanna assume for them”
- The Producer 2:38 PM: "they identify as toad”
- Xenquility 2:39 PM: "I mean I don’t want to discriminate but it’s kinda hard for a man to scissor”
- otherLiam 2:39 PM: "Clearly you aren’t trying hard enough.”
- The Producer 2:39 PM: ”^”
- otherLiam 2:39 PM: “Also hi.”
- The Producer 2:40 PM: "hello coomerLiam”
- Xenquility 2:40 PM: "woah”
- Xenquility 2:40 PM: "harsh”
- otherLiam 2:40 PM: ”?”
- otherLiam 2:40 PM: “is that like a racial slur”
- Xenquility 2:40 PM: "yes”
- The Producer 2:40 PM: "this server claims this is the internet coomtectives right”
- Xenquility 2:40 PM: "producer is a huge racist”
- The Producer 2:40 PM: "my apologies”
- otherLiam 2:40 PM: "i prefer zoomerLiam”
- The Producer 2:40 PM: "i meme with extreme prejudice”
- ARGdov 2:41 PM: "nice”
- Xenquility 2:41 PM: "bigotry makes the memes grow fonder”
- The Producer 2:41 PM: "and my dick grow harder”
- Xenquility 2:41 PM: ”;)”
- otherLiam 2:42 PM: “So why follow BUP?”
- The Producer 2:42 PM: "we have share the same goal”
- Xenquility 2:42 PM: "since when does bup have a goal”
- otherLiam 2:42 PM: "I don’t suppose you’d tell us what that is.”
- The Producer 2:42 PM: "refer to rules 1 and 7”
- Xenquility 2:43 PM: "what if we say finding it out will severely deter us from living?”
- Xenquility 2:43 PM: "the truth will blow our mind or something”
- The Producer 2:43 PM: "well I dont want that”
- Xenquility 2:44 PM: "damnit”
- otherLiam 2:44 PM: "wat rules”
- The Producer 2:44 PM: "also refer to rule 34”
- The Producer 2:44 PM: "haha lol xd”
- The Producer 2:44 PM: "theres another XD for you”
- Xenquility 2:44 PM: "also could you tell me where your office is located because I keep imagining some stereotypical office building floating in a rift between dimensions and it’s hurting my brain”
- Xenquility 2:44 PM: "or some sort of general area”
- Xenquility 2:44 PM: "like what planet”
- The Producer 2:44 PM: "no that sounds about right”
- Xenquility 2:45 PM: "fuck yes”
- Xenquility 2:45 PM: "how do you get wifi”
- otherLiam 2:45 PM: "so how exactly do you “produce” stuff? is it just magic or do you sometimes have to just go to the store”
- The Producer 2:47 PM: "i walk down to the spook store”
- The Producer 2:47 PM: "sometimes use my spook heelies”
- Xenquility 2:47 PM: "is that inbetween dimensions too”
- The Producer 2:47 PM: "yeah”
- The Producer 2:47 PM: "its like a inter dimensional 7/11”
- Xenquility 2:47 PM: "also are there any villains that aren’t inherently "spooky"”
- Xenquility 2:47 PM: "like just average joes”
- Xenquility 2:47 PM: "that happen to be evil”
- Slinky Stinks△ 2:48 PM: "”its like a inter dimensional 7/11””
- Slinky Stinks△ 2:48 PM: "I’m in”
- The Producer 2:51 PM: "Id argue that Bup isn’t really that spooky”
- The Producer 2:51 PM: "I mean he’s toad”
- Xenquility 2:51 PM: "true”
- pakospooky 2:51 PM: "IIIII”
- pakospooky 2:51 PM: "coming”
- The Producer 2:52 PM: "oof”
- The Producer 2:52 PM: "Pako posting forbidden things”
- pakospooky 2:52 PM: "what?”
- pakospooky 2:52 PM: "how forbidden?”
- The Producer 2:52 PM: "refer to rules 1, 7, and also rules 8 - 99 which all ready "be spookey be spookey be spookey"”
- The Producer 2:52 PM: "anyways the boys are sending me out to pick up some spook donuts”
- The Producer 2:52 PM: "see you all later”
- Xenquility 2:53 PM: "seeya broski”
11/14/15 - Chat with IsocelesAssassin
- IsocelesAssassin 11:45 PM: “Hello”
- Xenquility 11:45 PM: "Yo”
- IsocelesAssassin 11:45 PM: "I know you all were looking forward to speaking to SKM”
- IsocelesAssassin 11:45 PM: "but unfortunately our mutual friend will be a no-show tonight”
- Xenquility 11:46 PM: "Is he okay?”
- IsocelesAssassin 11:46 PM: "I’m not entirely sure”
- IsocelesAssassin 11:46 PM: "Strange forces beyond my comprehension are at play”
- Xenquility 11:47 PM: "Have you heard of this Bup guy before?”
- IsocelesAssassin 11:49 PM: "it’s my understanding that these same forces are responsible for our ɢʜᴏsᴛʟʏ ꜰʀɪᴇɴᴅ being locked out of their account as of late”
- Xenquility 11:49 PM: "Well, looks like he’ll be more of a nuisance than we thought”
- IsocelesAssassin 11:49 PM: "uh”
- IsocelesAssassin 11:49 PM: "like toad Bup?”
- Xenquility 11:49 PM: ”(That’s what he’s going by)”
- Xenquility 11:49 PM: “(He’s the one who took over Ghosty’s account)”
- IsocelesAssassin 11:50 PM: "I have nothing on this guy”
- Xenquility 11:50 PM: "Anything new on the stopping-the-world-from-ending front?”
- IsocelesAssassin 11:51 PM: "Our comrades are still hard at work on getting you all deeper”
- IsocelesAssassin 11:51 PM: "That’s our main concern at the moment”
- IsocelesAssassin 11:51 PM: "I was actually looking forward to seeing SKM return tonight”
- IsocelesAssassin 11:51 PM: "he is quiet elusive, even for us”
- Xenquility 11:53 PM: "Absence makes the heart grow fonder”
- Xenquility 11:53 PM: "or something”
- IsocelesAssassin 11:53 PM: "The man prides himself on his privacy, what can I say”
- Xenquility 11:53 PM: "Can’t really blame him with all of what’s going on”
- Xenquility 11:53 PM: ”(Not like it’s really helping him evade the new baddies)”
- IsocelesAssassin 11:54 PM: “Though "subtle” is probably the last word I would describe him as before meeting this current incarnation of him”
- IsocelesAssassin 11:54 PM: “These "new baddies” seem to be a completely different breed entirely”
- IsocelesAssassin 11:54 PM: “if they’re truly responsible for what’s been happening these past few days”
- Xenquility 11:55 PM: "Apparently we’ve interacted with most of them before”
- otherLiam 11:55 PM: "They’re certainly more confident. What exactly have they been doing?”
- IsocelesAssassin 11:56 PM: "I know little to nothing about them other than the fact that they have the ability to completely steal Ghost’s account and one of them is apparently named fucking "Bup"”
- otherLiam 11:56 PM: "Well, what’s been happening these past few days that you think to attribute to them?”
- IsocelesAssassin 11:57 PM: "Ghost losing their account”
- IsocelesAssassin 11:57 PM: ”(which they have told me plenty about, believe me)”
- IsocelesAssassin 11:57 PM: “And SKM just”
- IsocelesAssassin 11:57 PM: "not being here”
- IsocelesAssassin 11:57 PM: "I’ll admit I have no hard proof that they are responsible for the latter, but”
- IsocelesAssassin 11:57 PM: "something about it just seems obvious to me”
- IsocelesAssassin 11:57 PM: "I’m not sure why”
- IsocelesAssassin 11:57 PM: "Like their inherent powers are at play here”
- otherLiam 11:59 PM: "What, exactly, is the big deal about losing a Discord account?”
- otherLiam 11:59 PM: "Can’t he just make another one?”
- Xenquility 11:59 PM: "lmao”
- Xenquility 11:59 PM: "Actually that’s a good question”
- IsocelesAssassin 11:59 PM: "I can’t see why not”
- ARGdov 11:59 PM: "its a bit worrying SKMs not around yeah”
- IsocelesAssassin 11:59 PM: "But you know Ghost.”
- IsocelesAssassin 11:59 PM: "It’s more of a pride thing for them”
- ARGdov 11:59 PM: "probably”
- Xenquility 11:59 PM: "You know anything about this eoeoeoeo guy?”
- IsocelesAssassin 12:00 AM: "I don’t know Ghost’s exact inner workings, but I don’t think it would be that much trouble for them to create an alternate account.”
- otherLiam 12:00 AM: "Yeah, about that. How crazy powerful does someone have to he to outhack Ghost? Isn’t he like, made of data?”
- IsocelesAssassin 12:00 AM: "This is a classic SKM blunder”
- IsocelesAssassin 12:00 AM: "Looking at these things in purely technical terms”
- IsocelesAssassin 12:00 AM: "I believe what we are dealing with in this case ascends above simple "hacking"”
- ADULT_LINK 12:01 AM: "bup stealing ghosts account aint cool but”
- ADULT_LINK 12:01 AM: "i gotta say his meme tastes are :ok_hand:”
- otherLiam 12:02 AM: "Worth mentioning the one calling himself “BUP” says he’s the leader of his group. There’s also one calling himself “The Producer”.”
- ARGdov 12:02 AM: "yeah thats a thing SKM did all the time”
- ARGdov 12:02 AM: "looked at DROWNED as just an AI”
- ARGdov 12:02 AM: "etc.”
- IsocelesAssassin 12:02 AM: "By "eoeoeoeo” I’m assuming you’re referring to ᛇᛇᛇᛇ?”
- ARGdov 12:02 AM: “its ontologically flawed”
- Xenquility 12:02 AM: "Yeah”
- ARGdov 12:02 AM: "and yes thats who”
- Xenquility 12:02 AM: "That guy”
- otherLiam 12:03 AM: "We keep seeing mention of that. No clue what it is tho.”
- IsocelesAssassin 12:03 AM: "Yeah we have no clue what’s up with all of these ᛇ characters”
- IsocelesAssassin 12:03 AM: "As I’ve said, most of our efforts have been going towards constructing something to get you all inside”
- Xenquility 12:04 AM: "ETA?”
- ARGdov 12:04 AM: "inside AO? thats still getting worked on?”
- ARGdov 12:04 AM: "damn”
- ARGdov 12:04 AM: "well, if we can get in there, maybe we can help Yuki”
- otherLiam 12:04 AM: "Yuuki’s dead my dude.”
- ARGdov 12:04 AM: "it would make up for the recent/not so recent fuck up”
- ARGdov 12:04 AM: "her spirits stuck around”
- ARGdov 12:04 AM: "we know that already”
- Xenquility 12:04 AM: "We do?”
- ARGdov 12:05 AM: "Im next to positive if you check the wiki you’ll see this”
- ARGdov 12:05 AM: "in fact”
- IsocelesAssassin 12:05 AM: "Half the work is goes into properly communicating with one another”
- otherLiam 12:05 AM: "pretty sure that got axed too, seeing as it’s now IIII account”
- ARGdov 12:05 AM: "BUP didnt say she died”
- IsocelesAssassin 12:05 AM: "Us - you guys and myself - we have it easy”
- ARGdov 12:05 AM: "she said we’d "doomed her to a life of stockholm syndrome"”
- IsocelesAssassin 12:05 AM: "As we are intrinsically linked”
- Xenquility 12:05 AM: "Who isn’t?”
- IsocelesAssassin 12:05 AM: "My other comrades don’t have it so easy”
- IsocelesAssassin 12:05 AM: "I don’t want to say why exactly because doing so would put them in jeopardy”
- otherLiam 12:06 AM: "Well… can we “intrinsically link” your other comrades the same way we linked you, by playing songs?”
- IsocelesAssassin 12:06 AM: "I’ve tried that in the past”
- IsocelesAssassin 12:06 AM: "It’s not that simple”
- IsocelesAssassin 12:06 AM: "But again, explaining why would reveal their positions, so that is all I will say”
- otherLiam 12:09 AM: "Fair enough. Is there anything we can be doing to help your progress on either front?”
- ADULT_LINK 12:09 AM: "lmao”
- IsocelesAssassin 12:09 AM: "Just have patience”
- IsocelesAssassin 12:09 AM: "It will be completed in due time”
- IsocelesAssassin 12:09 AM: "In the meantime, it seems Yuuki has calmed down”
- ADULT_LINK 12:10 AM: "dov do you just wanna try to help yuuki to make up for retroactively getting her killed”
- IsocelesAssassin 12:10 AM: "But some damage was already done to Astral Observatory”
- Xenquility 12:10 AM: "She’s alive?”
- otherLiam 12:10 AM: "That’s… a way to say that.”
- IsocelesAssassin 12:10 AM: "She’s dead”
- Xenquility 12:10 AM: "Oh.”
- otherLiam 12:10 AM: "No, awhile back her spirit was going berzerk in AI”
- IsocelesAssassin 12:10 AM: "But her spirit was contained on the site for some time”
- otherLiam 12:10 AM: "AO*”
- Xenquility 12:11 AM: "I know that much”
- IsocelesAssassin 12:11 AM: "It’s hard to say for sure, but I believe her spirit is still there”
- Xenquility 12:11 AM: "But has her spirit been axed was my main question”
- otherLiam 12:11 AM: "Well, it was here.”
- ARGdov 12:11 AM: ”@ADULT_LINK I mean, its certainly a part of it”
- IsocelesAssassin 12:11 AM: “It’s strange, how these things work”
- ARGdov 12:11 AM: "but Im worried about hern onetheless”
- otherLiam 12:12 AM: "Dunno what happened to that account now though.”
- IsocelesAssassin 12:12 AM: "Similarly to how I described the Ocarina powers”
- IsocelesAssassin 12:12 AM: "It seems as though spirits can be "tethered” to certain locations”
- IsocelesAssassin 12:12 AM: “Though they have the ability to extend their reach manifest to us in other places”
- IsocelesAssassin 12:12 AM: "Yuuki is still very much a prisoner”
- IsocelesAssassin 12:12 AM: "She was just able to pull back the curtain a bit and ask for help, it seems”
- otherLiam 12:13 AM: "When Yuuki communicated with us, she gave us a bunch of links to songs. Do you have any idea the significance of them? I’ve been checking the comments for communications frequently but no luck.”
- otherLiam 12:13 AM: "Not like, Zelda songs, just regular music.”
- IsocelesAssassin 12:14 AM: "no idea”
- IsocelesAssassin 12:14 AM: "They likely meant something special to her.”
- otherLiam 12:14 AM: "I used one of them when we got pulled to Watch2Gether and it seemed to do something.”
- IsocelesAssassin 12:14 AM: "Though in my experience, these spirits often speak in esoteric riddles”
- Xenquility 12:15 AM: ”(Of course they do)”
- IsocelesAssassin 12:15 AM: “There’s really no telling and you must approach these things on a case by case basis”
- ARGdov 12:15 AM: "right”
- Xenquility 12:15 AM: "How’s Moony?”
- IsocelesAssassin 12:17 AM: "I haven’t spoken with him in a while”
- IsocelesAssassin 12:17 AM: "Really the only contact I have is with the hackers”
- Xenquility 12:18 AM: "Bup kinda time dicked him”
- otherLiam 12:18 AM: "You, uh… may want to.”
- otherLiam 12:18 AM: "He’s doin the time warp with our Greth.”
- ARGdov 12:19 AM: "by the hackers Im guessing you mean SKM and co/”
- IsocelesAssassin 12:19 AM: "How exactly do you mean?”
- IsocelesAssassin 12:19 AM: "I’m quite familiar with time dicking myself”
- otherLiam 12:19 AM: "He’s in 2016.”
- Xenquility 12:19 AM: "Yeah”
- ARGdov 12:19 AM: “yup”
- Xenquility 12:19 AM: "Both Greth's”
- IsocelesAssassin 12:20 AM: "You said this was Bup’s doing?”
- otherLiam 12:20 AM: "Like they’re acting as though they’re in 2016 and this chat is their only window into this time.”
- Xenquility 12:20 AM: "Indeed”
- otherLiam 12:20 AM: "Is it?”
- otherLiam 12:20 AM: "I didn’t know that.”
- Xenquility 12:20 AM: "He said that he, "Thought it would be useful"”
- Xenquility 12:20 AM: ”“And it was"”
- IsocelesAssassin 12:20 AM: "Then it’s likely there’s little we can do about it”
- otherLiam 12:20 AM: "Hm.”
- IsocelesAssassin 12:20 AM: "I’ll have Ghost look into things further once they calm down”
- ADULT_LINK 12:21 AM: "ngl im still wonderin if wolf using his old skype avatar means anything”
- IsocelesAssassin 12:21 AM: "2016 though”
- IsocelesAssassin 12:21 AM: "Time was fucked that year”
- Xenquility 12:21 AM: "Last we heard, Moonman was getting dms from Yugi on 11/11”
- ADULT_LINK 12:21 AM: "he said something about like. "why arent we on skype anyways” but like”
- ADULT_LINK 12:21 AM: “probably was a joke”
- ADULT_LINK 12:21 AM: "but with all the shit thats been going down recently, frankly i trust nothing”
- ARGdov 12:22 AM: "so much is going on Ive kind of lost track of whats going on tbh”
- ARGdov 12:22 AM: "its been a mess”
- ARGdov 12:22 AM: "that recent video premiere didnt help much either”
- otherLiam 12:22 AM: "yeah that was… meta.”
- otherLiam 12:22 AM: "Actually let’s try to settle this.”
- Xenquility 12:22 AM: "The whole, "Everyone involved in this has been a waste of my fucking time” part kind of messed with my brain”
- Xenquility 12:22 AM: “Hey IA, you know anything about Tyler basically telling us to fuck off in video form?”
- Xenquility 12:22 AM: ”(Before yelling about how “This was supposed to be the end” and shit)”
- IsocelesAssassin 12:23 AM: “Moonman spoke to Yugi?”
- ADULT_LINK 12:23 AM: "some people *cough* insisting erika isnt/wasnt canon has been something i’ve been thinkin about”
- Xenquility 12:24 AM: "Apparently yeah”
- IsocelesAssassin 12:24 AM: "Yugi’s another one I haven’t heard from in a long time.”
- IsocelesAssassin 12:24 AM: "Also”
- IsocelesAssassin 12:24 AM: "I believe this has happened once or twice before”
- IsocelesAssassin 12:24 AM: "These forces attempting to convince us none of this is real”
- IsocelesAssassin 12:24 AM: "That it’s all a game”
- IsocelesAssassin 12:24 AM: "Something we of course all believed before”
- IsocelesAssassin 12:24 AM: "well”
- IsocelesAssassin 12:24 AM: "over half of us got killed, to be frank”
- Xenquility 12:25 AM: "Oh jesus christ”
- IsocelesAssassin 12:26 AM: "So yeah”
- IsocelesAssassin 12:26 AM: "I wouldn’t believe any of it”
- IsocelesAssassin 12:26 AM: "The whole "This is over” shtick”
- Xenquility 12:26 AM: “Awesome because that’s the answer I wanted to hear”
- Xenquility 12:26 AM: "Doesn’t happen often”
- IsocelesAssassin 12:27 AM: "No clue”
- ARGdov 12:28 AM: "well yeah”
- ARGdov 12:28 AM: "someone tried to act like it was a game for some reason”
- Xenquility 12:28 AM: "Pffffft”
- ARGdov 12:28 AM: "it was off and its worrying”
- IsocelesAssassin 12:30 AM: "I need to go now”
- otherLiam 12:30 AM: "alright. be safe.”
- IsocelesAssassin 12:30 AM: "Sorry for the sudden leave, but I have things I need to take care of”
- Xenquility 12:30 AM: "Stay safe broski.”
- Xenquility 12:30 AM: "Thanks for the answers”
- IsocelesAssassin 12:30 AM: "All of you as well”
11/16/19 - Chat with The Producer
- The Producer 2:46 PM: “Would you like to hear my battle theme”
- otherLiam 2:47 PM: "You’re a boss fight now?”
- The Producer 2:47 PM: ((An audio file titled “el_producer.mp3” is posted - a midi version of “Hips Don’t Lie” by Shakira.))
- otherLiam 2:47 PM: "Oh man your hips don’t lie.”
- Xenquility 2:48 PM: "That’s some sexy music right there”
- otherLiam 2:48 PM: "Producer identity confirmed: Shakira”
- The Producer 2:49 PM: "that is all”
- The Producer 2:49 PM: "I need to get back to”
- The Producer 2:49 PM: "producing”
- The Producer 2:49 PM: "im working on something large at the moment”
- Xenquility 2:51 PM: "I would say sounds could but we’re probably gonna be on the ass end of that production”
- ARGdov 2:52 PM: "Hmm well see I guess”
11/17/19 - Chat with The Producer
- The Producer 4:15 PM: “you can do it whelp”
- The Producer 4:15 PM: "you can claw em gnaw em stone em beat em”
- Xenquility 4:15 PM: "Ay it’s P dog”
- The Producer 4:15 PM: "ill do this with my mind you just obey me”
- ARGdov 4:15 PM: ”?”
- otherLiam 4:15 PM: “uhhh”
- The Producer 4:15 PM: "hello”
- ARGdov 4:15 PM: "is he quoting a song”
- Slinky Stinks△ 4:15 PM: "Ay prodddd”
- otherLiam 4:15 PM: "hey producer, meet erika. erika, producer.”
- ARGdov 4:16 PM: "he is”
- ARGdov 4:16 PM: "https://genius.com/Ace-composer-gang-plank-galleon-lyrics”
- Xenquility 4:16 PM: "damnit dov”
- The Producer 4:16 PM: "literally who”
- Xenquility 4:16 PM: "I was gonna post that”
- pakospooky 4:16 PM: ”@Erika_XP💚 <a href="https://youtu.be/A7P40vNkVr4">https://youtu.be/A7P40vNkVr4</a> where did you get that?”
- otherLiam 4:16 PM: “i am uncertain which of you is more antagonistic”
- Xenquility 4:16 PM: "WHERE DID YOU GET THATTTTTTTT”
- Slinky Stinks△ 4:16 PM: "Yo prod”
- Xenquility 4:16 PM: "inb4 doug”
- ARGdov 4:16 PM: "lol”
- pakospooky 4:16 PM: “WHERE???”
- Xenquility 4:16 PM: "pakoplans”
- otherLiam 4:16 PM: "pako chill dawg”
- Slinky Stinks△ 4:16 PM: "Inb4 pako AO doug”
- Xenquility 4:16 PM: "how’s the production business my guy”
- The Producer 4:16 PM: "its quite lively”
- Slinky Stinks△ 4:17 PM: "Are u gonna send us another sick beat now?”
- ARGdov 4:17 PM: "I can imagine”
- The Producer 4:17 PM: "im enjoying my cup or morning spook joe”
- Slinky Stinks△ 4:17 PM: "Spook Joe?”
- Xenquility 4:17 PM: "are there other people in your field or are you the only person who produces shit between paralellos's”
- The Producer 4:17 PM: "no i dont have any songs to send right now”
- Slinky Stinks△ 4:17 PM: "OH NO”
- The Producer 4:17 PM: "but ill make one specifically for you guys”
- ARGdov 4:17 PM: "aww”
- ARGdov 4:17 PM: "well thats sweet”
- ARGdov 4:17 PM: "considering who you work for”
- The Producer 4:17 PM: "i wont give it to you all until the time is right, however”
- Slinky Stinks△ 4:17 PM: "Ty dude!”
- ARGdov 4:18 PM: "deal.”
- The Producer 4:18 PM: "ill call it”
- The Producer 4:18 PM: "uhh”
- Xenquility 4:18 PM: "what if it turns out producer is actually insanely evil and is the reincarnation of tenebris”
- The Producer 4:18 PM: "what should i call it”
- Slinky Stinks△ 4:18 PM: "Kill switch”
- ARGdov 4:18 PM: "as for which one is more antagonistic”
- ARGdov 4:18 PM: "I mean compared to BUP neither is”
- The Producer 4:18 PM: "ok ill call it kill switch”
- Xenquility 4:18 PM: "see”
- Xenquility 4:18 PM: "he is”
- Slinky Stinks△ 4:18 PM: "15 minute song of just TTS: YES, YES, YES, YES”
- spookypako 4:19 PM: "Is it possible that Erika is Tyler’s friend / girlfriend?”
- Xenquility 4:19 PM: "call it: Kill?, yes”
- ARGdov 4:19 PM: "no.”
- ARGdov 4:19 PM: "definitely not”
- The Producer 4:19 PM: "Boyfriend”
- ARGdov 4:19 PM: "Carla lives in Australia, and they havent dated for….several years”
- spookypako 4:19 PM: "ups”
- ARGdov 4:19 PM: "she was also a member of the LC”
- spookypako 4:19 PM: "seriously?”
- Xenquility 4:19 PM: "Former”
- Xenquility 4:19 PM: "if I recall”
- Xenquility 4:19 PM: "Ay Producer”
- Xenquility 4:19 PM: "Any idea how erika got a hold of never-before-seen-exclusive-vip footage”
- The Producer 4:21 PM: "you’ll just have to ask them”
- Xenquility 4:21 PM: "or are we just stupid and forgetting that we’ve seen it”
- The Producer 4:21 PM: "as for many years this has been going on for, its no surprise that some stuff has slipped through the cracks”
- Slinky Stinks△ 4:21 PM: "EL PRODUSER!!!”
- The Producer 4:21 PM: "el traitor”
- Slinky Stinks△ 4:21 PM: "mexican music plays”
- Xenquility 4:21 PM: "also why is slinky the traitor”
- The Producer 4:22 PM: "i guess traitor isn’t exactly accurate”
- The Producer 4:22 PM: "how about "elegy boy"”
- spookypako 4:22 PM: "Is it possible that some character gave her images and videos, but she can’t tell who gave them?”
- Xenquility 4:22 PM: "alright that sounds good”
- Slinky Stinks△ 4:22 PM: "Elegy boy sounds neat”
- Jos 4:23 PM: "what about about to fuck up boy”
- The Producer 4:23 PM: "a perpetual state of aboutting to fuck up
- sounds good”
- Jos 4:23 PM: "exactly”
- Slinky Stinks△ 4:24 PM: "Neat”
- spookypako 4:26 PM: "guys who is the guy at left”
- Slinky Stinks△ 4:26 PM: "Hm?”
- spookypako 4:26 PM: "fuck”
- spookypako 4:26 PM: "wait”
- The Producer 4:29 PM: "we will never know who is the guy at left”
- Slinky Stinks△ 4:29 PM: "F”
- Xenquility 4:29 PM: "some say he is still at the left to this day”
- Slinky Stinks△ 4:29 PM: "Others say he is now at the right”
- spookypako 4:29 PM: ”:joy: :joy:”
- Xenquility 4:30 PM: “they’re fucking wrong”
- spookypako 4:30 PM: "my phone is trolling me sorry”
- The Producer 4:30 PM: "thats horseshoe theory for you”
- The Producer 4:30 PM: "or spooky horseshoe theory as we call it here”
- spookypako 4:31 PM: "who is the guy in the left in the window”
- The Producer 4:31 PM: "our office has quite the diverse range of spooky politicial opinions”
- Slinky Stinks△ 4:31 PM: "Do you know who is "spuu kinjo’”?”
- Xenquility 4:31 PM: “Pretty sure that’s just tyler in his house”
- Xenquility 4:31 PM: "can’t really tell though”
- The Producer 4:32 PM: "joe spooky mama”
- Slinky Stinks△ 4:32 PM: "Nope”
- Xenquility 4:32 PM: "the spooky producer”
- The Producer 4:32 PM: "i have the second eye”
- The Producer 4:32 PM: "you cannot fool me”
- The Producer 4:32 PM: "i mean third eye”
- The Producer 4:32 PM: "fuck”
- Xenquility 4:32 PM: "the spooky second eye”
- Slinky Stinks△ 4:32 PM: "Spuu kinjo’ mama”
- spookypako 4:32 PM: "but who is recording?”
- spookypako 4:32 PM: "uhum”
- The Producer 4:33 PM: "the camera, obviously”
- spookypako 4:33 PM: "very funny”
- spookypako 4:33 PM: ”…”
- Xenquility 4:33 PM: “it’s their second eye not the camera”
- The Producer 4:33 PM: "they have google eye”
- The Producer 4:33 PM: "spooky google eye”
- Xenquility 4:33 PM: "google cardboard”
- Xenquility 4:33 PM: "or glass or whatever it was”
- Xenquility 4:33 PM: "waoah”
- Xenquility 4:33 PM: "briefcase”
- Xenquility 4:33 PM: "that’s somewhat relevant to this isnt it”
- The Producer 4:35 PM: "briefcases are quite handy for delivering and transporting goods”
- The Producer 4:35 PM: "im a fan”
- spookypako 4:35 PM: "dewalk closed”
- spookypako 4:35 PM: "cross here”
- Xenquility 4:35 PM: "what if”
- Xenquility 4:35 PM: "producer is the white dude with the briefcase”
- Slinky Stinks△ 4:35 PM: "That’s producer”
- The Producer 4:35 PM: "its me”
- Xenquility 4:35 PM: "from start life”
- Xenquility 4:35 PM: "BUM BUM BUM”
- spookypako 4:36 PM: "bumb”
- The Producer 4:36 PM: "im not that tiny faceless mongoloid”
- Slinky Stinks△ 4:36 PM: "Prod”
- Xenquility 4:36 PM: "woah”
- Slinky Stinks△ 4:36 PM: "Are you a little mannequin?”
- Xenquility 4:36 PM: "mongoloid was my word”
- Xenquility 4:36 PM: "how dare you”
- The Producer 4:36 PM: "OI”
- The Producer 4:36 PM: "sorry”
- Slinky Stinks△ 4:36 PM: "Mongoloid is racist”
- The Producer 4:36 PM: "im racist”
- Xenquility 4:36 PM: "and im raceless”
- Xenquility 4:36 PM: "is it okay to be racist if you’re racist to all races”
- The Producer 4:37 PM: "apparently pako needs a new bum”
- spookypako 4:37 PM: "HAHAHA”
- The Producer 4:37 PM: "my condolences”
- Slinky Stinks△ 4:37 PM: "F”
- spookypako 4:37 PM: ”:joy: :joy:”
- Xenquility 4:37 PM: “Pako’s ass has been blasted”
- The Producer 4:37 PM: "im racist towards non spookys”
- Xenquility 4:37 PM: "so you’re racist towards yourself”
- spookypako 4:37 PM: "nonon”
- Xenquility 4:37 PM: "cause uh”
- The Producer 4:37 PM: "aw”
- Slinky Stinks△ 4:37 PM: "Prod, are the Spooks like a different race”
- Slinky Stinks△ 4:37 PM: "Like”
- The Producer 4:37 PM: "you guys dont think im spooky”
- Xenquility 4:37 PM: "you’re not spooky or something”
- Slinky Stinks△ 4:37 PM: "Elfs? For example?”
- Xenquility 4:37 PM: "we appreciate it”
- Xenquility 4:37 PM: "spooky is overrated”
- Xenquility 4:38 PM: "all the annoying guys are spooky”
- Xenquility 4:38 PM: "but luckily”
- Xenquility 4:38 PM: "you are”
- Xenquility 4:38 PM: "https://www.youtube.com/watch?v=39Bnk6VU53Y”
- spookypako 4:38 PM: "hd lol”
- The Producer 4:38 PM: "well im glad i could at least be "Refreshing like a spring breeze…"”
- The Producer 4:39 PM: "like finally taking off the gas mask and getting a big ol whiff”
- Xenquility 4:39 PM: "woah”
- Xenquility 4:39 PM: "gas mask”
- Xenquility 4:39 PM: "producer is skm”
- The Producer 4:39 PM: "he wishes”
- spookypako 4:39 PM: "oh yeah”
- Xenquility 4:39 PM: "why do all of you guys hate on skm”
- spookypako 4:39 PM: "no you wishes”
- Xenquility 4:39 PM: "skm is great”
- The Producer 4:39 PM: "nah skm is pretty cool”
- The Producer 4:39 PM: "kinda sketchy though”
- Xenquility 4:40 PM: "no offense but”
- The Producer 4:40 PM: "keeps himself busy”
- The Producer 4:40 PM: "thats for sure”
- Xenquility 4:40 PM: "you’re one to talk”
- The Producer 4:40 PM: "twoshey”
- Xenquility 4:40 PM: "TWOSHEY”
- Xenquility 4:40 PM: "EXCUSE ME”
- Slinky Stinks△ 4:40 PM: "TWOSHEY”
- Slinky Stinks△ 4:40 PM: "HAHAHA”
- Slinky Stinks△ 4:40 PM: "r/boneappletea”
- The Producer 4:40 PM: "its pronounced "toosh"”
- Xenquility 4:40 PM: "touché thankyouverymuch”
- The Producer 4:41 PM: "haha… laugh now…”
- The Producer 4:41 PM: "you, wont be… laughing… soon,,,”
- Xenquility 4:41 PM: "one flaw in that joke”
- The Producer 4:41 PM: "am i spooky enough now”
- Xenquility 4:41 PM: "spooks always use capitals”
- The Producer 4:41 PM: "HAHAHA”
- The Producer 4:41 PM: "HEEHEE”
- Xenquility 4:41 PM: "I meant the first letter of a sentence”
- The Producer 4:41 PM: "shit”
- Slinky Stinks△ 4:41 PM: "Hohoho hehehe”
- Slinky Stinks△ 4:41 PM: "HELLO THERE OLDY CHUM”
- Xenquility 4:42 PM: "also the dots make you sound like a prepubescent girl trying to write ben drowned fanfics”
- Slinky Stinks△ 4:42 PM: "IM NOT A GNELF”
- Xenquility 4:42 PM: "i mean”
- Slinky Stinks△ 4:42 PM: "IM NOT A GNOBLIN”
- Xenquility 4:42 PM: "non fanfic”
- The Producer 4:42 PM: "maybe i am”
- Xenquility 4:42 PM: "definitely real”
- Slinky Stinks△ 4:42 PM: "IM A GNOME”
- spookypako 4:42 PM: "Skm.png (147×148)”
- Slinky Stinks△ 4:42 PM: "AND YOU’VE BEEN GNOOOOOMED”
- spookypako 4:42 PM: "ups”
- The Producer 4:42 PM: "deep down inside, arent we all prepubsescent ben drowned fan girls?”
- Slinky Stinks△ 4:42 PM: "We are”
- Xenquility 4:42 PM: "TOUCHE”
- The Producer 4:42 PM: "toosh”
- ARGdov 4:43 PM: "I mean”
- Slinky Stinks△ 4:43 PM: ”>producer being meta”
- Xenquility 4:43 PM: “ill woop your toosh if you spell is twoshey again”
- ARGdov 4:43 PM: "Were all still here”
- ARGdov 4:43 PM: "So yes we all our secretly BEN fangirls”
- Xenquility 4:43 PM: "does tenebris know about all his fans”
- The Producer 4:43 PM: "we all our”
- Xenquility 4:43 PM: "nigth”
- Xenquility 4:43 PM: "nigth”
- Xenquility 4:43 PM: "nigth”
- spookypako 4:44 PM: "nightmind”
- Slinky Stinks△ 4:44 PM: "Suck”
- Slinky Stinks△ 4:44 PM: "My”
- Slinky Stinks△ 4:44 PM: "Dick”
- Xenquility 4:44 PM: "no thank you pokephile”
- The Producer 4:44 PM: "Dickth”
- Xenquility 4:44 PM: "and now pedophile”
- spookypako 4:44 PM: "i”
- spookypako 4:44 PM: "dony”
- spookypako 4:44 PM: "wanna”
- Xenquility 4:44 PM: "gerth”
- The Producer 4:44 PM: "more like i pony wanna”
- Xenquility 4:44 PM: "gerth vlogs”
- The Producer 4:44 PM: "alright lunch break over”
- Xenquility 4:44 PM: "more like i pako wanna”
- The Producer 4:44 PM: "i have consumed my spook soup”
- spookypako 4:44 PM: "hahaha”
- The Producer 4:44 PM: "ill speak with you all some other time”
- Xenquility 4:45 PM: ”*some other spooky time”
- The Producer 4:45 PM: “^^^”
- Xenquility 4:45 PM: "anyways seeya p dog”
10/29/19 - Chat with Greth
- pциїsнёd gяєтн 3:33 AM: “busy in here”
- otherLiam 3:33 AM: "oh ffs WHAT.”
- pциїsнёd gяєтн 3:33 AM: ”???”
- pциїsнёd gяєтн 3:33 AM: “what”
- jos 3:33 AM: "hello greth”
- otherLiam 3:34 AM: "is this real greth”
- pциїsнёd gяєтн 3:34 AM: "uhm”
- pциїsнёd gяєтн 3:34 AM: "ok”
- pциїsнёd gяєтн 3:34 AM: "ok”
- pциїsнёd gяєтн 3:34 AM: ”@CircleHunter”
- pциїsнёd gяєтн 3:34 AM: “listen so”
- pциїsнёd gяєтн 3:34 AM: "I’m going to do it”
- otherLiam 3:35 AM: "Do what?”
- pциїsнёd gяєтн 3:35 AM: "I’m kind of nervous but”
- Xenquility 3:35 AM: "Hey ih”
- Xenquility 3:35 AM: "Whatever he told you to do”
- Xenquility 3:35 AM: "Just think it over first”
- otherLiam 3:36 AM: "fucking”
- pциїsнёd gяєтн 3:36 AM: "what”
- pциїsнёd gяєтн 3:36 AM: "no”
- pциїsнёd gяєтн 3:36 AM: "I’m talking about driving up there”
- otherLiam 3:36 AM: "Driving where?”
- pциїsнёd gяєтн 3:36 AM: "the lake near the fishery”
- pциїsнёd gяєтн 3:36 AM: "to find what was buried”
- jos 3:37 AM: "I don’t wanna guess too much… something buried… a item… the suitcase?”
- otherLiam 3:37 AM: "hang on”
- otherLiam 3:37 AM: "Do you remember anything from last night?”
- otherLiam 3:37 AM: ”@CircleHunter pls explain what the hell”
- jos 3:39 AM: “traitor”
- jos 3:39 AM: "hiding info”
- pциїsнёd gяєтн 3:40 AM: "what are you guys talking about”
- otherLiam 3:40 AM: "Greth, whatever Circle told you to do
- otherLiam 3:40 AM: "I’d advise you to not do that.
- pциїsнёd gяєтн 3:40 AM: "no”
- pциїsнёd gяєтн 3:40 AM: "it wasnt circle specifically”
- pциїsнёd gяєтн 3:40 AM: "just the internet detectives?”
- pциїsнёd gяєтн 3:40 AM: "there’s something hidden near a lake by the fishery and it turns out i am closest”
- pциїsнёd gяєтн 3:40 AM: "it’s a drive but”
- Xenquility 3:41 AM: "It’s not worth the risk”
- otherLiam 3:41 AM: "Greth, we’re the internet detectives. We never told you to do that.”
- pциїsнёd gяєтн 3:41 AM: "i have never met you before”
- pциїsнёd gяєтн 3:41 AM: "but there’s always people in and out of these groups”
- otherLiam 3:42 AM: "Right, sorry. Hi. I’m Liam.”
- otherLiam 3:42 AM: "Greth, do you remember anything from last night?”
- pциїsнёd gяєтн 3:43 AM: "yeah”
- pциїsнёd gяєтн 3:43 AM: "i got a call on skype”
- pциїsнёd gяєтн 3:43 AM: "and rushed home to talk to ID about it”
- otherLiam 3:43 AM: "Greth, what’s today’s date?”
- pциїsнёd gяєтн 3:43 AM: "then three of us were chosen by J to be a circle”
- Xenquility 3:43 AM: "J?”
- jos 3:45 AM: "was jemery?”
- pциїsнёd gяєтн 3:46 AM: "July 29th”
- jos 3:46 AM: "uh”
- pциїsнёd gяєтн 3:46 AM: “2016”
- jos 3:46 AM: "Over here it’s like 3 months ahead”
- otherLiam 3:46 AM: "That’s what I thought.”
- jos 3:46 AM: "i repeat, 3 months and 3 years”
- jos 3:46 AM: "for some reason”
- Xenquility 3:46 AM: "Well”
- jos 3:47 AM: "3 were choosen, at 3 months and 3 years”
- jos 3:47 AM: "wow”
- Xenquility 3:47 AM: "III”
- otherLiam 3:47 AM: "Which 3 were chosen, Greth?”
- jos 3:48 AM: "Greth, Circle, are my guesses”
- pциїsнёd gяєтн 3:48 AM: "Me, Spanosa, and Velvet”
- jos 3:48 AM: "Velvet”
- otherLiam 3:50 AM: "What exactly is a “circle”?”
- jos 3:50 AM: "group of people with a certain secret purpose”
- otherLiam 3:50 AM: "Ah, then this is old school ID stuff.”
- jos 3:50 AM: "like the secret circle of a company”
- jos 3:50 AM: "wait I hear about that kind of circle, long ago”
- otherLiam 3:51 AM: "What happened in that skype call you wanted to talk to ID about?”
- Xenquility 3:52 AM: "Hey Greth, I know you have no idea who I am, but I take it that you have an interest in esotericism?”
- pциїsнёd gяєтн 3:57 AM: "Uh we’re here aren’t we”
- Xenquility 3:58 AM: ”?”
- Xenquility 3:58 AM: “Who’s where?”
- otherLiamt 4:00 AM: "He means us, the ID.”
- otherLiam 4:00 AM: "We’re here.”
- otherLiam 4:00 AM: "And yeah we are but not all of us were there for that convo.”
- otherLiam 4:00 AM: "And we haven’t updated the timelines yet.”
10/29/19 - Chat with Moonman
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:45 PM: "where did this chat from”
- jos 2:46 PM: "Hello”
- otherLiam 2:46 PM: "im sorry what”
- jos 2:46 PM: "moonman?”
- otherLiam 2:46 PM: "nope.”
- otherLiam 2:46 PM: "“Venom Greth”.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:46 PM: "that's my discord handle”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:46 PM: "moonman”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:46 PM: "who are you?”
- otherLiam 2:46 PM: "Just some interested people. My name’s Liam.”
- jos 2:46 PM: "Jos, nice to meet you, and i am as lost as you lol”
- otherLiam 2:47 PM: "If you don’t mind, could you tell me the date?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:47 PM: "July 29th, 2016”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:47 PM: "weird question”
- otherLiam 2:47 PM: "Yeah, sorry, things’ve been weird lately.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:47 PM: "is this some youshouldnthavedonethat shit”
- otherLiam 2:47 PM: "Kinda, yeah.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:48 PM: "okay well”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:48 PM: "I thought I made it pretty clear last night”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:48 PM: "or was that two nights ago now?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:48 PM: "we stay up too late.”
- otherLiam 2:48 PM: "Moonman, do you know a guy called “Nocta”?”
- jos 2:49 PM: "the thing is, is that things are pretty unestable these days... for some reason i dont know”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:50 PM: "maybe?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:50 PM: "idk is this about the song”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:50 PM: "i already apologized”
- otherLiam 2:51 PM: "Song?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:51 PM: "yeah when I posted the song of healing”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:51 PM: "everyone got fucking mad”
- otherLiam 2:51 PM: "Nah we aren’t mad about that.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:51 PM: "are you sure?”
- jos 2:51 PM: "I'm not”
- otherLiam 2:51 PM: "We weren’t really around for it though - what happened?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "idk the other night we were working on yshdt.net and submitting songs”
- jos 2:52 PM: "I mean, maybe the heat of the moment but it's ok”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "I had some fucked logic theory about how posting song of healing was a good idea”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "anyways i thought it was my idea”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "as soon as i posted it i felt different and knew i had screwed up”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "lo and behold drama shitstorm ensued and now”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "well I need time away from ID”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:52 PM: "it's up to the three now anyways”
- otherLiam 2:56 PM: "You’re not part of the three?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:56 PM: "no”
- otherLiam 2:56 PM: "Who are the three, then?”
- Slinky stinks 2:56 PM: "Uh”
- Slinky stinks 2:56 PM: "Bonjour”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:56 PM: "Velvet, Spanosa, and Mugen”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:56 PM: "a mistake if you ask me”
- otherLiam 2:57 PM: "I’d agree.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:57 PM: "I don't see anyone from Skype in here except Thorin and Circ and I don't they'd post that in there”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:57 PM: "but yeah”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:57 PM: "I can't believe tbh”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:57 PM: "oh wait Eve and scout are offline”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:57 PM: "oh well”
- Slinky stinks 2:58 PM: "A pleasure to meet you, I'm slinky :moony:”
- otherLiam 2:58 PM: "Yeah we’re kinda new. Do you know a person named Kaiden, by chance?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 2:59 PM: "doesn't sound familiar”
- otherLiam 3:00 PM: "Alright. So, the timelines haven’t been updated in awhile. Last I checked we were messing with YSHDT which was in like, a time loop again. is that right?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 3:00 PM: "3 day loop yeah”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 3:00 PM: "but like I said I'm not involved anymore”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 3:00 PM: "for now”
10/29/19 - Chat with Moonman and Greth
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:13 PM: "okay”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:13 PM: "still not sure i was added here but”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:13 PM: "hi scout”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:13 PM: "and liam since”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:13 PM: "i see you typing”
- otherLiam 10:15 PM: "yeah heya.”
- Xenquility 10:15 PM: "Yo”
- otherLiam 10:16 PM: "this is a bit to ask but we’re kinda trying to figure out how you got added here, too. if you don’t mind, could you give a quick list of the currently-active ID’s?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:17 PM: "everybody except me as far as i am aware”
- otherLiam 10:17 PM: "So, scout, Mugen, Yugi, IA, etc?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:18 PM: "Mhm”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:18 PM: "or as mugen would say”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:18 PM: "'waffle'”
- otherLiam 10:20 PM: "Alright. And do you remember what day you played the Song of Healing? (no judgement, just tryin to get the timeline straight.)”
- pциїsнёd gяєтн 10:20 PM: "it was around midnight”
- pциїsнёd gяєтн 10:20 PM: "on uh”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:21 PM: "i think the 27th”
- Dense 10:22 PM: "Hey greth”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:22 PM: "henlo”
- otherLiam 10:22 PM: "Interesting. How are you feeling right now?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:23 PM: "honestly”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:23 PM: ((A photo of Jake the Snake Roberts is posted))
- Xenquility 10:23 PM: "Relatable”
- Dense 10:23 PM: "Tyler kissinda snake”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:23 PM: ((A photo of Jake the Snake Roberts is posted))
- otherLiam 10:24 PM: "that’s a fuckin mood right there”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:24 PM: "sorry this is some group specific memeing”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:24 PM: "i have a tendency to post jake the snake”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:24 PM: "like wwf legend jake the snake roberts”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:24 PM: "i too am a snake on his redemption arc”
- otherLiam 10:26 PM: "So Greth, what’s the purpose of this “circle” Jeremy/Jarilo wanted made?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:26 PM: "i dont know im not in it”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:26 PM: "i should make clear im not salty about that”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:26 PM: "i left skype shortly before that”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:26 PM: "i'm more salty about ID breaking down in skype drama over something dumb i did on the site”
- ARGdov 10:27 PM: "yeah thats nothing new, sounds like it checks out”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:28 PM: "ID basically broke down into an ID controlled by Tyler”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:28 PM: "and an ID controlled by Mugen”
- otherLiam 10:28 PM: "Holy yikes.”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:28 PM: "and then a third group with me a few boys”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:28 PM: "and i didnt like it”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:28 PM: "most of us were in all three”
- otherLiam 10:28 PM: "Who are your boys?”
- Xenquility 10:29 PM: "Who was with you?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:29 PM: "so me leaving seemed to bring the groups back into 1”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:29 PM: "i dont want to create further drama”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:29 PM: "i didnt even know there was a discord ultra secret group”
- Xenquility 10:30 PM: "No worries about drama dudeski”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:30 PM: "well i know some people probably wont wanna be named but”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:30 PM: "Yugi was there everyone knew that”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:30 PM: "he was the only spanish memer and we clicked so he actively wasnt in the other two until i left”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:30 PM: "thats partly why i did”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:30 PM: "I didnt want Yugi to be deprived”
- ARGdov 10:31 PM: "man I feel bad for those who were stuck with mugen”
- ARGdov 10:31 PM: "interesting that Tyler apparently didnt lose his memory tho”
- Xenquility 10:31 PM: "?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:32 PM: "a few people tried to not shitpost on him but most people did”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:32 PM: "but he was in the circle or whatever so some of them reasoned they needed to appease him”
- otherLiam 10:33 PM: "sounds like this “circle” is doing more harm than good if it’s dividing everyone up”
- ARGdov 10:33 PM: "yeah”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:33 PM: "that was my opinion but again i didnt even know until after we had splintered into three skype chats”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:33 PM: "so i just left”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:33 PM: "and apparently everything is somewhat normal”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:33 PM: "I know some new people joined who had gotten in through Mugen's skype link”
- Dense 10:35 PM: "Hehe”
- Xenquility 10:36 PM: "Hows Tyler? Haven't been keeping up in ages”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "no idea”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "not on skype”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "tyler wasnt around much”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "the group that tyler controlled wasnt really actively controlled by him”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "it was just the original skype chat”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "Mugen left that chat after i posted the song”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:36 PM: "and that's when it all went downhill”
- Xenquility 10:38 PM: "Any clue what the song did?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:38 PM: "the site had been extremely active that night”
- Dense 10:38 PM: "-king nothing plays in the background-”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:38 PM: "we had made a ton of progress and it was really late”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:38 PM: "and we probably coulda kept going but after the healing song”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:38 PM: "it went offline”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:38 PM: "as far as i know it might still be offline”
- otherLiam 10:39 PM: "Earlier you mentioned that when you posted the SoH you “thought it was your idea” and you “felt different”. Can you go into any more detail on that?”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:39 PM: "you ever fap to some weird shit convinced this is your life now”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:39 PM: "and then right after you finish you have existential regret”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:39 PM: "it was like that”
- otherLiam 10:40 PM: "So, utterly convinced it was a good idea then immediately aware that it was gross and bad.”
- Dense 10:40 PM: "JKJS oh god”
- ADULT_LINK 10:41 PM: "oh god that feeling sucks”
- otherLiam 10:41 PM: "Actually, would you mind checking YSHDT? I would but I’m in the middle of the desert rn.”
- ADULT_LINK 10:41 PM: "discords like barely chuggin along”
- Xenquility 10:42 PM: "Aw shit. Web browser is screwing with me. Anyone able to remind me what happend last November 11? Kinda sped through my research”
- Dense 10:43 PM: "Uhhh november 11”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:47 PM: "uhhh lemme get uhhh”
- 𝖁𝖊𝖓𝖔𝖒 𝕲𝖗𝖊𝖙𝖍 10:47 PM: "nov 11”
11/20/19 - Chat with BUP and The Producer
- Slinky Stinks△ 5:54 AM: “https://youtu.be/2RtI5UEZlzU”
- Xenquility 7:04 AM: "Hey the lunarchildren forums are now password protected too”
- Slinky Stinks△ 7:13 AM: "Holy fuck”
- BUP 10:28 AM: "wow”
- Slinky Stinks△ 10:28 AM: "BUP”
- Slinky Stinks△ 10:28 AM: "ITS SPOOKY MONTH”
- Wolfcat 10:43 AM: "bupboy”
- Wolfcat 10:43 AM: "or girl”
- Wolfcat 10:43 AM: "the bupess”
- BUP 11:31 AM: ”@The Producer”
- BUP 11:31 AM: “dont you think you’re being a bit too open”
- ADULT_LINK△ 11:32 AM: "bupperoo”
- ADULT_LINK△ 11:32 AM: "ooh can i get that green role jos has?”
- ADULT_LINK△ 11:32 AM: "looks nice”
- The Producer 11:36 AM: "hey, i havent really revealed anything”
- The Producer 11:36 AM: "i figured why not throw them a spook bone”
- ARGdov 11:36 AM: "ahahaha I just watched that Toad video”
- ARGdov 11:36 AM: "such a beautfiul singing voice”
- ADULT_LINK△ 11:36 AM: ”:thumb: danke”
- BUP 11:36 AM: “mmmok”
- ARGdov 11:36 AM: "my ears were bleeding yet I mad am assive grin on my face”
- ARGdov 11:36 AM: "and yeah”
- ARGdov 11:36 AM: "hes been as cryptic as Im sure company policy demands”
- The Producer 11:37 AM: "even if I had revealed something its likely they wouldnt have been able to pick up on it anyways”
- The Producer 11:37 AM: ”(no offense)”
- The Producer 11:37 AM: “oh right i did reveal company policy”
- The Producer 11:37 AM: "they think we’re a floating office in the parallelos now”
- ARGdov 11:38 AM: "I mean, probably not for a few months until we sit down and go over our notes for the first time”
- The Producer 11:38 AM: ”(sorry guys its not that exciting)”
- ARGdov 11:38 AM: “I mean, we were meming about that”
- ARGdov 11:38 AM: "I doubt you’d have something like that, this isnt a damn Iris Wildthyme novel”
- ARGdov 11:38 AM: "unfortunately”
- The Producer 11:38 AM: "that the fuck have you just said to me”
- The Producer 11:38 AM: "also fuck i told them about the D”
- ARGdov 11:39 AM: "yup”
- ARGdov 11:39 AM: "you produce the d, somehow”
- ARGdov 11:39 AM: "despite what I said yesterday”
- ARGdov 11:39 AM: ”“one does not produce the d”
- ARGdov 11:39 AM: "one gives the d”
- ARGdov 11:39 AM: "or recieves the d”
- ARGdov 11:39 AM: "or, if they are fun”
- ARGdov 11:39 AM: "does both"”
- ARGdov 11:39 AM: "also Iris Wildthyme is awesome, and thats the only thing you need to know about her”
- ARGdov 11:39 AM: "oh also that she looks like this”
- The Producer 11:41 AM: "is that a doctress who”
- ARGdov 11:41 AM: "shes a spin off character in the doctor who expanded universe”
- The Producer 11:41 AM: ”“doctor who expanded universe"”
- ARGdov 11:42 AM: "like the spin off books and audio dramas”
- ADULT_LINK△ 11:42 AM: "dweu”
- ARGdov 11:42 AM: "shes a mysterious figure who travels through space, time, and the various dimensions in a double decker bus thats exactly the right size on the inside that its meant to be, fucking around, drinking too much, and having a good time”
- ARGdov 11:42 AM: "also her main companion is a living stuffed panda whos also an art critic””
- ARGdov 11:42 AM: "basically shes awesome”
- The Producer 11:43 AM: ”:mugen:”
- ARGdov 11:43 AM: “and her adventures are whacky and would totally include an office block floating in space”
- ARGdov 11:43 AM: "was this just an excuse to ramble about some doctor who related thing? duh”
- The Producer 11:44 AM: "truthfully I cannot judge given my own interests”
- ARGdov 11:44 AM: "Ooog”
- ARGdov 11:44 AM: "what are yours?”
- The Producer 11:44 AM: "spook shows on spook television”
- The Producer 11:44 AM: "you’ve probably never heard of them”
- ARGdov 11:44 AM: "probably not”
- ARGdov 11:44 AM: "but they sound neato Im sure”
- ARGdov 11:44 AM: "trans dimensional tv”
- ARGdov 11:44 AM: "anyways, Im a massive Whovian”
- ARGdov 11:44 AM: "come to me with all your doctor who questions”
- The Producer 11:46 AM: "I got a who question”
- ARGdov 11:49 AM: "yes?”
- ARGdov 11:49 AM: "pulls out massive scarf and gets out the tardis wiki”
- The Producer 11:50 AM: "Who cares”
- The Producer 11:50 AM: "gottem”
- ARGdov 11:51 AM: "https://tenor.com/view/rbd-anahi-glaring-mad-angry-gif-15178189”
- ARGdov 11:51 AM: "what you just say to me”
- The Producer 11:51 AM: "im sorry that was mean”
- ARGdov 11:51 AM: "Im messing its good lol. I know you were kidding”
- ARGdov 11:51 AM: "unless you werent…?”
- The Producer 11:52 AM: "unless…?”
- ADULT_LINK△ 11:52 AM: "lmao”
- The Producer 11:52 AM: "ok i gotta go before bup rides my ass again”
- The Producer 11:52 AM: "i mean like in a "get to work” kinda way”
- ARGdov 11:52 AM: “unless you werent”
- ARGdov 11:52 AM: "in which case ITS ABOUT TO GO DOWN”
- ARGdov 11:52 AM: "anyways, enjoy your work”
- BUP 12:13 PM: "pfft i havent said shit”
- BUP 12:13 PM: "he is makin excuses”
- Wolfcat 12:20 PM: "damn”
11/19/19 - Chat with The Producer
- The Producer 10:09 AM: “AAUUUUAUAUUUGUUUGH”
- Wolfcat 10:10 AM: "u good”
- The Producer 10:10 AM: "I’m stretching”
- The Producer 10:10 AM: "i had a long hard night of”
- The Producer 10:10 AM: "producing”
- The Producer 10:10 AM: "not the D this time”
- Wolfcat 10:10 AM: ”:regional_indicator_d:”
- The Producer 10:12 AM: “It is nearing completion”
- The Producer 10:12 AM: "at least this particular piece of the puzzle”
- The Producer 10:12 AM: "there is still much work to do”
- Wolfcat 10:13 AM: "ok broducer”
- The Producer 10:14 AM: "ok gamejacker”
- Wolfcat 10:14 AM: "hey now”
- Wolfcat 10:14 AM: "thats all in the past”
11/18/19 - Chat with The Producer
- The Producer 11:28 AM: “https://www.youtube.com/watch?v=Ewbx4OW3YEY”
- Slinky Stinks△ 11:28 AM: "Ay prod”
- The Producer 11:31 AM: "ello mates”
- The Producer 11:31 AM: "still alive im assuming?”
- DensO Burton 11:32 AM: "He y”
- Slinky Stinks△ 11:32 AM: "Yeet”
- The Producer 11:33 AM: "faring better than your counterparts, then”
- Slinky Stinks△ 11:33 AM: "I guess so lol”
- The Producer 11:34 AM: "I mean when the alternative is being dead, the bar is pretty low”
- The Producer 11:34 AM: "but still”
- The Producer 11:34 AM: "gg”
- DensO Burton 11:35 AM: "Lol”
- Slinky Stinks△ 11:36 AM: "lmao”
- The Producer 12:10 PM: "times are a'changing”
- The Producer 12:10 PM: "twisting”
- The Producer 12:10 PM: "turning”
- The Producer 12:10 PM: "falling behind”
- The Producer 12:10 PM: "what we’re attempting to pull off here is what’s known as a pro gamer move”
- The Producer 12:10 PM: "so to speak”
- The Producer 12:10 PM: "all will make sense in due time”
- ARGdov 12:11 PM: ”…are you trying to hack reality?”
- smelly 12:42 PM: “:NOO:”
- The Producer 12:59 PM: ”“hack” “"reality”“ but sure”
- The Producer 12:59 PM: "there are some vital pieces you are all missing”
- The Producer 12:59 PM: "later on the truth will be available to you, but you must earn it”
- The Producer 12:59 PM: "then I will tell you everything”
- The Producer 12:59 PM: "well, ”“"everything”“"”
- The Producer 12:59 PM: "i would elaborate but the very nature of these things would reveal too much”
- The Producer 12:59 PM: "anyways, back to work”
- ARGdov 1:14 PM: "Its always about us getting to “the truth” isnt it”
- Mr. Circle 1:20 PM: "You will never reach the truth”
- The Producer 1:22 PM: "history always repeats, dont it?”
- The Producer 1:22 PM: "anyway, maybe you should refer to your notes”
- The Producer 1:22 PM: "3/3/15”
- Mr. Circle 1:23 PM: "That's”
- Mr. Circle 1:23 PM: "A long ass time ago”
11/21/19 - Chat with The Producer
- The Producer 10:07 AM: “como se llama”
- The Producer 10:07 AM: "bonita”
- The Producer 10:07 AM: "mi casa”
- The Producer 10:07 AM: "su casa”
- The Producer 10:07 AM: ”(shakira shakira)”
- Slinky Stinks△ 10:09 AM: “Lmao”
- Slinky Stinks△ 10:09 AM: "You are a good Shakira fan as I see”
- Xenquility 10:12 AM: "Ay p dog”
- Xenquility 10:12 AM: I missed you”
- The Producer 10:13 AM: "hello”
- The Producer 10:13 AM: "have you found the secret yet”
- Xenquility 10:13 AM: "Uh”
- Xenquility 10:13 AM: "I haven’t been on for like 3 days”
- The Producer 10:13 AM: "I see”
- Slinky Stinks△ 10:13 AM: "What secret exactly?”
- The Producer 10:14 AM: "I guess they didn’t tell you”
- The Producer 10:14 AM: "Hm”
- Slinky Stinks△ 10:14 AM: "My autism hits hard”
- The Producer 10:14 AM: "Guess they didn’t tell you”
- Slinky Stinks△ 10:14 AM: "Did I miss something”
- Xenquility 10:14 AM: "Secret?”
- The Producer 10:14 AM: "Guess you weren’t informed”
- Slinky Stinks△ 10:14 AM: "Wait who did you inform”
- The Producer 10:14 AM: "I guess they didn’t tell you”
- The Producer 10:14 AM: "I see”
- Slinky Stinks△ 10:14 AM: "Yo prod”
- Slinky Stinks△ 10:14 AM: "U good?”
- The Producer 10:14 AM: "Hm”
- The Producer 10:14 AM: "I guess they didn’t TELL you”
- The Producer 10:14 AM: "yes im good im drinking spooky coffee right now”
- Slinky Stinks△ 10:15 AM: "Yea I haven’t keeping up in a few days”
- Xenquility 10:15 AM: "I feel like Tell is the hint”
- Slinky Stinks△ 10:15 AM: "No shit”
- Slinky Stinks△ 10:15 AM: "ao/tell?”
- Slinky Stinks△ 10:15 AM: "nah too obvious”
- The Producer 10:15 AM: "there is no secret”
- The Producer 10:15 AM: "I am a liar”
- The Producer 10:15 AM: "in multiple ways”
- Xenquility 10:16 AM: "You ho”
- The Producer 10:16 AM: "I lied about BUP also”
- Slinky Stinks△ 10:16 AM: "Prod are you Beeing controlled? Or are you epic trolling us”
- Slinky Stinks△ 10:16 AM: "I got my hands covered in red ink fucking shitty pens”
- Slinky Stinks△ 10:16 AM: "Brb”
- The Producer 10:17 AM: "the truth is i am somewhat socially awkward and portraying all of this as a "office” and BUP has a stern boss of mine gives me an easy out”
- The Producer 10:17 AM: “though he is very definitely above me”
- Slinky Stinks△ 10:17 AM: "Nah m8 you are being controlled”
- Slinky Stinks△ 10:17 AM: "BUP got ur acc”
- The Producer 10:17 AM: "BUP does not have access to my account”
- The Producer 10:17 AM: "unless I type "erratas"”
- Slinky Stinks△ 10:18 AM: "He didn’t to Babel’s until he had”
- The Producer 10:18 AM: "if i do that then he mi”
- The Producer 10:18 AM: ”/…//.//././”
- The Producer 10:18 AM: “—/./-.-./-.”
- Slinky Stinks△ 10:18 AM: "Are we doing fucking Morse code”
- The Producer 10:18 AM: "Hello I am BUP”
- Xenquility 10:18 AM: "Very funny”
- The Producer 10:18 AM: "I like to pull my mickey at toad”
- Xenquility 10:18 AM: "Lmao”
- Slinky Stinks△ 10:19 AM: ”/…//.//././”
- Slinky Stinks△ 10:19 AM: “—/./-.-./-.”
- Slinky Stinks△ 10:19 AM: "What is that doe”
- The Producer 10:19 AM: "that was literally just me key mashing”
- Slinky Stinks△ 10:19 AM: "Fuck off”
- The Producer 10:19 AM: "but maybe theres a secret code”
- The Producer 10:19 AM: "unless…?”
- Slinky Stinks△ 10:19 AM: ”:sadcat:”
- The Producer 10:20 AM: “anyways hows the business going”
- The Producer 10:20 AM: "kill tyler yet?”
- Xenquility 10:20 AM: "Hopefully not”
- The Producer 10:20 AM: "skawa”
- The Producer 10:20 AM: "better do it in one hit”
- The Producer 10:20 AM: "better make it count”
- The Producer 10:20 AM: "better make it hurt”
- Xenquility 10:21 AM: "Has bup told you to be more spooky since last time”
- The Producer 10:21 AM: "oh baby when you talk like that”
- The Producer 10:21 AM: "you make a woman go mad”
- Slinky Stinks△ 10:22 AM: "Shakira references”
- The Producer 10:22 AM: ”(shakira is scary right)”
- Slinky Stinks△ 10:22 AM: “She is”
- The Producer 10:22 AM: "alright good”
- The Producer 10:22 AM: "ehh”
- The Producer 10:22 AM: "looks fake”
- Slinky Stinks△ 10:22 AM: "Spooky”
- The Producer 10:23 AM: "I gotta go”
- Slinky Stinks△ 10:23 AM: "Kk”
- The Producer 10:23 AM: "I might be expect company, im not sure yet”
- The Producer 10:23 AM: ”*ting”
- Slinky Stinks△ 10:23 AM: “Yo when are we doing a field trip to spooky.inc HQ”
- The Producer 10:24 AM: "When you least expect it.”
- Slinky Stinks△ 10:24 AM: "Spooky enough”
- Slinky Stinks△ 10:24 AM: "Good luck prod”
11/21/19 - Chat with The Producer and TheLaw
((Welcome Chat Room))
- TheLaw 11:23 AM: "528 members? That's quite the fair amount.”
- DensO Burton 11:24 AM: "Lol”
- DensO Burton 11:24 AM: "Welcome”
- TheLaw 11:26 AM: "Thanks for the welcome. Not really sure why I'm here though, tbh. Was sorta called here.”
- DensO Burton 11:26 AM: "By... Who?”
- TheLaw 11:28 AM: "By the squad.”
- DensO Burton 11:28 AM: "Oh k”
- DensO Burton 11:28 AM: "Bup moment”
- The Producer 11:29 AM: "oh hey”
- The Producer 11:29 AM: "there you are”
- The Producer 11:29 AM: "the big man comin out of retirement”
- TheLaw 11:29 AM: "Hey newbie. Just doing what Bup asks.”
- The Producer 11:30 AM: "Bup is as Bup does”
- TheLaw 11:30 AM: "Yeah well, you know. I can't ever find myself leaving forever.”
- TheLaw 11:30 AM: "Even when I don't really know what's ever going on anymore.”
- TheLaw 11:30 AM: "What's the story here? Did these guys actually figure things out?”
- The Producer 11:32 AM: "i think theyre more lost than ever to tell the truth”
- DensO Burton 11:32 AM: "How many bupboiz”
- TheLaw 11:32 AM: "Not surprised. History always repeats.”
- The Producer 11:33 AM: "there are many bupboys”
- The Producer 11:33 AM: "about”
- The Producer 11:33 AM: "528”
- DensO Burton 11:33 AM: "Ok”
- The Producer 11:33 AM: "not really”
- The Producer 11:33 AM: "they continue to fail at the simplest of tasks”
- The Producer 11:33 AM: "(jk guys i :heart: you all)”
- TheLaw 11:34 AM: "Now don't lie to their face”
- The Producer 11:34 AM: "but its true”
- The Producer 11:34 AM: "to some extent at least”
- The Producer 11:34 AM: "kinda”
- The Producer 11:34 AM: "sometimes”
- TheLaw 11:35 AM: "Every once in a while”
- The Producer 11:35 AM: "once in a”
- The Producer 11:35 AM: "blue Moon”
- TheLaw 11:35 AM: "Good one”
- The Producer 11:36 AM: ":fingerguns:”
- TheLaw 11:36 AM: ":funkyfinger:”
- The Producer 11:36 AM: ":funkyfinger::funkyfinger:”
- TheLaw 11:37 AM: ":point_right: :beerd: :point_right:”
- Wolfcat 11:38 AM: ":funkyfinger: :funkyfinger :”
- The Producer 11:38 AM: "you did it wrong”
- Wolfcat 11:38 AM: ":sadcat:”
- TheLaw 11:38 AM: "You can't blame him. I'm sure he does most things wrong.”
- The Producer 11:39 AM: "damn”
- The Producer 11:39 AM: "true though”
- DensO Burton 11:41 AM: "LOL”
((Johnisdead Chat Room))
- ARGdov 11:34 AM: "morning all”
- TheLaw 11:36 AM: "Morning.”
- ARGdov 11:36 AM: "hello, the law”
- ARGdov 11:36 AM: "are you new or am I just oblivious”
- ARGdov 11:36 AM: "you with BUP?”
- TheLaw 11:37 AM: "I am with Bup, as most should be.”
- ARGdov 11:37 AM: "wow”
- ARGdov 11:37 AM: "totally not cryptic”
- TheLaw 11:38 AM: "Thought that was your guy's thing? Bein' coomtectives and all.”
- The Producer 11:39 AM: "theyre more like coombrains”
- The Producer 11:46 AM: "speaking of cooming, i should get back to work”
- ARGdov 11:52 AM: "@TheLaw well yeah but still”
- ARGdov 11:52 AM: "its frustrating”
- Slinky Stinks△ 11:58 AM: "Ay new fellas?”
- Slinky Stinks△ 11:58 AM: "Or foes?”
- TheLaw 11:59 AM: "Hey”
- Slinky Stinks△ 11:59 AM: "Ay”
- TheLaw 11:59 AM: "Wouldn't really call myself a foe.”
- Slinky Stinks△ 12:00 AM: "Then what are you goodfella”
- TheLaw 12:04 AM: "Around. Not really sure to be honest. I guess whatever Bup and the rest need me to be.”
- Slinky Stinks△ 12:04 AM: "Neat”
- Slinky Stinks△ 12:04 AM: "Do you make the laws?”
- TheLaw 12:14 AM: "I am the law. It isn't my job to make them.”
- Slinky Stinks△ 12:18 AM: "Neat”
- Slinky Stinks△ 12:18 AM: "Nice pfp”
((General Chat Room))
- Slinky Stinks△ 12:13 AM: "It would be nice to have cuddling weather”
- Wolfcat 12:14 AM: ":gay:”
- the jeffums 12:14 AM: ">he wants to cuddle”
- the jeffums 12:14 AM: ":pGAY:”
- Wolfcat 12:15 AM: ((Wolfcat calls another player homosexual for wanting to kiss girls.))
- Wolfcat 12:15 AM: ":tokiSmug:”
- the jeffums 12:15 AM: ":tokiclap:”
- TheLaw 12:43 AM: "If kissing girls makes you gay, I'm almost sure most people here are straight.”
11/22/19 - Chat with The Producer
- The Producer 12:09 PM: “Tony’s got a quick hand”
- The Producer 12:09 PM: "He’ll look around the room, he won’t tell you his plan”
- The Producer 12:09 PM: "He’s got a rolled cigarette”
- The Producer 12:09 PM: "Hangin out his mouth, he’s a cowboy kid”
- the clown guy from Slipknot 12:09 PM: "ALLL THE OTHER KIDS”
- the clown guy from Slipknot 12:09 PM: "WITH THE PUMPED UP KICKS BETTER RUN”
- the clown guy from Slipknot 12:09 PM: "BETTER RUN”
- the clown guy from Slipknot 12:09 PM: "FASTER MY GUN”
- The Producer 12:10 PM: "it seems our deadline’s been extended”
- The Producer 12:10 PM: "at least I think so”
- The Producer 12:10 PM: "good news for us”
- The Producer 12:10 PM: "specifically for me”
- The Producer 12:10 PM: "crunch time is a bitch”
- ARGdov 12:11 PM: "hopefully for us too”
- ARGdov 12:11 PM: "we get to live a bit longer”
- ARGdov 12:11 PM: "or at the very least we dont need to worry about their being any trouble for a bit longer”
- The Producer 12:12 PM: "well technically speaking, trouble is already here”
- the clown guy from Slipknot 12:12 PM: "Yo prod send me your playlist”
- the clown guy from Slipknot 12:12 PM: "You have a sick music taste”
- The Producer 12:12 PM: "https://www.youtube.com/watch?v=hHW1oY26kxQ”
- the clown guy from Slipknot 12:13 PM: ”>likes chillcow”
- the clown guy from Slipknot 12:13 PM: “ prod marry me pls”
- The Producer 12:13 PM: "ew gay”
- Wolfcat 12:15 PM: ”:marGay:”
- The Producer 12:15 PM: “ew gay”
- The Producer 12:15 PM: "recently ive been hard at work”
- The Producer 12:15 PM: "and also working hard”
- ARGdov 12:16 PM: "well yeah troubles already here”
- ARGdov 12:16 PM: "which like”
- ARGdov 12:16 PM: "fair”
- The Producer 12:16 PM: "i know what you mean tho”
- The Producer 12:16 PM: "more trouble”
- The Producer 12:16 PM: "id explain further but the big two would get my ass”
- ARGdov 12:17 PM: "Im sure we’ll find out soon enough”
- ARGdov 12:17 PM: "and then we’ll all collectively lose our shit again”
- The Producer 12:18 PM: "thats the plan”
- the clown guy from Slipknot 12:18 PM: "Prod waddup with the law”
- the clown guy from Slipknot 12:18 PM: "Is he a chill duud?”
- The Producer 12:18 PM: "he’s pretty chill most of the time”
- the clown guy from Slipknot 12:18 PM: "Nice”
- The Producer 12:18 PM: "he used to be in BUP’s position”
- The Producer 12:18 PM: "kinda”
- ARGdov 12:19 PM: "oh?”
- ARGdov 12:19 PM: "he was in charge”
- ARGdov 12:19 PM: ”?”
- The Producer 12:19 PM: “well not really in charge of the whole shebang”
- The Producer 12:19 PM: "I just mean he had some substantial power at one point in time”
- the clown guy from Slipknot 12:19 PM: "Okay let’s get this clear already”
- The Producer 12:19 PM: "not necesarilly BUP’s exact position”
- the clown guy from Slipknot 12:19 PM: "WHO IS BUPS BOSS”
- The Producer 12:20 PM: "you really wanna know”
- the clown guy from Slipknot 12:20 PM: "I do”
- The Producer 12:20 PM: "well lucky for you I was just granted access to reveal this information last night”
- ARGdov 12:20 PM: "I do wanna know”
- ARGdov 12:20 PM: "sweet”
- the clown guy from Slipknot 12:20 PM: "Fucking sweet”
- The Producer 12:21 PM: "BUP’s boss is old farmer john”
- the clown guy from Slipknot 12:21 PM: "Yeah”
- The Producer 12:21 PM: "or old mcdonald as you might know”
- The Producer 12:21 PM: "ᛇᛇᛇᛇᛇ”
- the clown guy from Slipknot 12:21 PM: "EOEOEOEO IS YOUR BOSS?”
- The Producer 12:21 PM: "close”
- The Producer 12:21 PM: ”“EO” isnt exactly accurate”
- The Producer 12:21 PM: “and also youre missing one”
- the clown guy from Slipknot 12:22 PM: "Of course”
- the clown guy from Slipknot 12:22 PM: "EO is a censor”
- the clown guy from Slipknot 12:22 PM: "He is not named eoeoeoeoeo”
- ARGdov 12:23 PM: "eeeeh well shit”
- The Producer 12:23 PM: "the La Li Le Lu Lo”
- ARGdov 12:23 PM: "pfff”
- ARGdov 12:23 PM: "amazing”
- ARGdov 12:23 PM: "or not”
- the clown guy from Slipknot 12:23 PM: "La li le Lu lo?”
- ARGdov 12:23 PM: "Im assuming you cant tell us much about him tho”
- the clown guy from Slipknot 12:23 PM: "How”
- ARGdov 12:23 PM: "anyways”
- ARGdov 12:23 PM: "do tell more”
- The Producer 12:23 PM: "yeah thats confidential”
- The Producer 12:23 PM: "hes very elusive”
- ARGdov 12:23 PM: "https://tenor.com/view/sis-spill-the-tea-james-charles-adams-family-mortisha-gif-13293519”
- The Producer 12:23 PM: "and sort of an enigma”
- the clown guy from Slipknot 12:23 PM: "Okay so eoeoeoeoeo is la li le Lu lo”
- ARGdov 12:24 PM: "I can imagine so”
- ARGdov 12:24 PM: "anything else you can tell us? about any of this?”
- The Producer 12:24 PM: "im not really sure if its completely accurate to call him BUP’s boss however”
- The Producer 12:24 PM: "they both have tremendous power”
- ARGdov 12:24 PM: "why was the law originally in charge? if thats what he was?”
- ARGdov 12:24 PM: "ooh”
- The Producer 12:24 PM: "more power than myself, at least”
- the clown guy from Slipknot 12:24 PM: "Okay so basically”
- the clown guy from Slipknot 12:24 PM: "Eo is god, bup is a less powerful god”
- the clown guy from Slipknot 12:24 PM: "And you guys work for the minimum wage”
- The Producer 12:25 PM: "i work for jack shit”
- The Producer 12:25 PM: "but its rewarding work in and of itself”
- The Producer 12:25 PM: "so im happy”
- The Producer 12:25 PM: "even though ive put blood, sweat, and tears into this job”
- The Producer 12:33 PM: "stewin on it are ya”
- The Producer 12:33 PM: well ive gotta head out again”
- The Producer 12:33 PM: later boyos”
- the clown guy from Slipknot 12:36 PM: "Later”
11/23/19 - Chat with The Producer
- ARGdov 5:45 PM: “you post an image like this”
- ARGdov 5:45 PM: "https://cdn.discordapp.com/attachments/453323274496245764/647930718558748673/7fda90e45c4dfff4972de5583421be31.png”
- ARGdov 5:45 PM: "and you say "tag yourself Im Hermionie” or whatever nickname theyve given the characters”
- the clown guy from Slipknot 5:46 PM: “On jah”
- the clown guy from Slipknot 5:46 PM: "We need that for sure”
- the clown guy from Slipknot 5:46 PM: "Can’t wait to identify as mugen”
- The Producer 5:58 PM: "im gibby”
- The Producer 5:58 PM: "or whoever that is”
- The Producer 5:58 PM: "neville”
- Xenquility 5:58 PM: "Ay”
- The Producer 5:58 PM: "hello”
- Xenquility 5:58 PM: "How goes it?”
- The Producer 5:58 PM: "I have a question for you all”
- Xenquility 5:58 PM: ”?”
- The Producer 5:58 PM: “whats up with this mummy dude just standing in the background of the hips dont lie vid”
- The Producer 5:58 PM: "https://cdn.discordapp.com/attachments/453323274496245764/647934081924857856/unknown.png”
- Mr. Circle 5:58 PM: "Isn’t the blue doug just john”
- Xenquility 5:59 PM: "It’s the watcher”
- The Producer 5:59 PM: "fuck”
- The Producer 5:59 PM: "makes sense though”
- The Producer 6:00 PM: "https://cdn.discordapp.com/attachments/453323274496245764/647934617151602728/unknown.png”
- The Producer 6:00 PM: "there he is again”
- Xenquility 6:00 PM: "Holy shit”
- The Producer 6:01 PM: "he reminds me of another short white entity”
- The Producer 6:01 PM: "and no im not talking about mugen”
- Xenquility 6:01 PM: "Your dick”
- The Producer 6:01 PM: "damn”
- pakospooky 6:01 PM: "you shoulden´t have done that”
- The Producer 6:01 PM: "pako’s right”
- The Producer 6:01 PM: "you shoulden’t have done that”
- Xenquility 6:01 PM: "Too bad”
- The Producer 6:01 PM: "youll all feel my wrath”
- Xenquility 6:02 PM: "I’ll feel your wrath bb”
- pakospooky 6:03 PM: "come play with us”
- Xenquility 6:03 PM: ”;)”
- The Producer 6:03 PM: “ok”
- The Producer 6:03 PM: "this is all becoming very homoerotic and uncomfortable”
- The Producer 6:03 PM: "goodbye”
- Xenquility 6:03 PM: "That’s homophobic”
- pakospooky 6:03 PM: "ahaha”
- Xenquility 6:03 PM: "I’m telling dov”
- the clown guy from Slipknot 6:21 PM: "Yo”
- the clown guy from Slipknot 6:21 PM: ((An image of a Minecraft furry is posted))
- Xenquility 6:21 PM: "why”
- The Producer 7:09 PM: "ok im bac-”
- The Producer 7:09 PM: ”…”
- The Producer 7:09 PM: “nevermind”
- ARGdov 7:09 PM: ”?”
- ARGdov 7:09 PM: “@The Producer everything ok?”
- ARGdov 7:09 PM: ”…oh”
- ARGdov 7:09 PM: “I guess not”
- The Producer 7:09 PM: "you are all sexual deviants”
- The Producer 7:09 PM: "perhaps it wouldnt be so bad for the moon to fall after all”
- ARGdov 7:10 PM: "I mean even if WE werent sexual deviants”
- ARGdov 7:10 PM: "others would be”
- ARGdov 7:10 PM: "personally Im not a furry tho”
- Wolfcat 7:11 PM: "me neither”
- The Producer 7:11 PM: "ok discord user "wolfcat"”
- The Producer 7:11 PM: "anyways do you guys wanna hear a neat thing”
- Wolfcat 7:12 PM: "hey”
- Wolfcat 7:12 PM: "that name was randomly generated for me”
- ARGdov 7:12 PM: "of course”
- Wolfcat 7:12 PM: "also yes”
- ARGdov 7:12 PM: "I always want to hear neat things”
- The Producer 7:13 PM: ((The audio file “Greth_chase.mp3” is posted))
- The Producer 7:13 PM: "a”
- The Producer 7:13 PM: "Production”
- The Producer 7:13 PM: "I’m not responsible for this one, however”
- The Producer 7:13 PM: "it appeared elsewhere”
- ARGdov 7:14 PM: ”“appeared”?”
- The Producer 7:14 PM: “appeared, manifested, birthed”
- The Producer 7:14 PM: "squatted”
- The Producer 7:14 PM: "i believe its from the latest silentdork vid”
- The Producer 7:14 PM: "thought you all would be interested in hearing it”
- pakospooky 7:15 PM: "yes”
- pakospooky 7:15 PM: "that sound appear in start life”
- The Producer 7:16 PM: "neat”
- pakospooky 7:16 PM: "but where did you get that”
- The Producer 7:16 PM: "these videos that appear on his channel”
- The Producer 7:16 PM: "even im not sure exactly how they come to be”
- The Producer 7:16 PM: "who exactly portrays them to us”
- The Producer 7:16 PM: "perhaps its a myriad of different sources”
- ARGdov 7:17 PM: "possibly”
- The Producer 7:17 PM: "but regardless, we have the ability to separate some things from them and isolate them”
- The Producer 7:17 PM: "for further investigation and analysis”
- The Producer 7:17 PM: "and also just so we can listen to the bangin spook tunes”
- ARGdov 7:18 PM: "so basically youre saying is that you have audacity”
- The Producer 7:18 PM: "yes”
- The Producer 7:18 PM: ”*spooky audacity”
- pakospooky 7:18 PM: “:hand:”
- The Producer 7:19 PM: "WHOA”
- The Producer 7:19 PM: "geez Pako”
- The Producer 7:19 PM: "you spooked me there”
- The Producer 7:19 PM: "alright im pretty shaken up from that im gonna head out”
- The Producer 7:19 PM: "bye”
11/28/19 - Chat with The Producer
- The Producer: “How’s it goin bros”
- The Producer: “My name is Producer”
- 0h look! Its karkat!: “Ay proddd”
- The Producer: “have you all discovered the truth yet”
- 0h look! Its karkat!: "Nah”
- 0h look! Its karkat!: "Still on it mate”
- 0h look! Its karkat!: "We are too busy with stuff”
- The Producer: "I see”
- The Producer: "Maybe this will help”
- The Producer: "my origin story”
- The Producer: "https://www.youtube.com/watch?v=YJjDu_Q2MN4”
- 0h look! Its karkat!: "That’s literally you”
- 0h look! Its karkat!: "Nice”
11/29/19 - Chat with The Producer
- otherLiam 11:07 AM: "ay yo i’d like to order some Truth with extra Truth Sauce”
- Deadhead 11:17 AM: "lmao”
- The Producer 11:51 AM: "the funny thing is”
- The Producer 11:51 AM: “you've ordered the truth”
- The Producer 11:51 AM: "and its all ready to go”
- The Producer 11:51 AM: "sitting at the window”
- The Producer 11:51 AM: "but you haven't taken the time to actually reach out and grab it”
- The Producer 11:51 AM: "and its starting to get cold”
- The Producer 11:51 AM: "no refunds bitch”
- otherLiam 11:57 AM: "Can I order delivery”
- otherLiam 11:57 AM: "I’ll even tip you”
- The Producer 11:58 AM: "nope”
- The Producer 11:58 AM: "its digiornos asshole”
- ADULT_LINK△ 11:59 AM: "o shit what type”
- The Producer 12:01 PM: ((An image of Digiorno’s Cookies and Pizza is posted.))
- ADULT_LINK△ 12:03 PM: "shiiit im high and hungry”
- The Producer 12:04 PM: "pizzanalogies aside”
- The Producer 12:04 PM: "if you lack knowledge, you must seek it”
- The Producer 12:04 PM: "if you have questions, you must ask them”
- The Producer 12:04 PM: "there are no dumb questions”
- The Producer 12:04 PM: "only dumb players”
- The Producer 12:04 PM: "if there are mysteries afeet, investigate them”
- The Producer 12:04 PM: "recent videos have yet to be fully combed over with a fine tooth”
- The Producer 12:04 PM: "uh”
- The Producer 12:04 PM: "comb”
- The Producer 12:04 PM: "there are still many pepperoni secrets”
- The Producer 12:04 PM: "i will now step off my pizza box and get back to work”
12/2/19 - Chat with The Producer
- The Producer 10:25 AM: “welp”
- The Producer 10:25 AM: "here i am again”
- The Producer 10:25 AM: "is this getting repetitive”
- The Producer 10:25 AM: "i feel like this is getting repetitive”
- 0h look! Its karkat! 10:26 AM: "Welcome to the ID feeling”
- The Producer 10:28 AM: "so much talking as of late”
- The Producer 10:28 AM: "unfortunately it will have to make do until my masterpiece is complete”
- The Producer 10:28 AM: "along with whatever else accompanies it”
- 0h look! Its karkat! 10:34 AM: "Oh yeah that magnum opus”
- 0h look! Its karkat! 10:34 AM: "You wanna see mine?”
- The Producer 10:35 AM: "against my better judgement”
- The Producer 10:35 AM: "sure”
- 0h look! Its karkat! 10:35 AM: "https://youtu.be/QJjd9UPSULM”
- 0h look! Its karkat! 10:35 AM: "That’s my finest piece of art”
- The Producer 10:35 AM: "sweet dancing douglas”
- The Producer 10:35 AM: "he and kelbris really stole the spotlight away from the other two didnt they”
- 0h look! Its karkat! 10:36 AM: "Other two?”
- 0h look! Its karkat! 10:36 AM: "Oh”
- 0h look! Its karkat! 10:36 AM: "Yeah lol”
- 0h look! Its karkat! 10:36 AM: "Those two nerds”
- The Producer 10:37 AM: "if only i could prolong the cycle”
- The Producer 10:37 AM: "ad infinitum”
- The Producer 10:37 AM: "maybe then we could see spencer groovin to some tunes too”
- The Producer 10:37 AM: "or alex hall of fame”
- 0h look! Its karkat! 10:39 AM: "Alex hall of fame is a thing I need to see”
- The Producer 10:40 AM: "https://www.youtube.com/watch?v=u34xC5o-Un8”
- The Producer 10:40 AM: "enjoy”
- The Producer 10:40 AM: "but be warned”
- The Producer 10:40 AM: "this video contains substantial power”
- The Producer 10:40 AM: "it might be too much to bare”
- 0h look! Its karkat! 10:47 AM: ”:okay:”
- The Producer 10:48 AM: “so”
- The Producer 10:48 AM: "im assuming all lingering questions have now been cleared up”
- The Producer 10:48 AM: "no more mysteries or loose threads”
- 0h look! Its karkat! 10:49 AM: "TF u mean”
- 0h look! Its karkat! 10:49 AM: "That’s literally the opposite of how we are now”
- The Producer 10:49 AM: "does this mythical video not answer everything?”
- 0h look! Its karkat! 10:49 AM: "I mean”
- 0h look! Its karkat! 10:49 AM: "It does”
- The Producer 10:49 AM: "what confuses you in this moment”
- otherLiam 10:49 AM: "What, you want a list?”
- The Producer 10:50 AM: "sure”
- 0h look! Its karkat! 10:50 AM: "Nah liam”
- 0h look! Its karkat! 10:50 AM: "Now that I think of it”
- 0h look! Its karkat! 10:50 AM: "Everything is fine :jack_o_lantern:”
- The Producer 10:50 AM: "ok”
- The Producer 10:50 AM: "good to hear”
- The Producer 10:50 AM: "well bye”
- 0h look! Its karkat! 10:50 AM: "Jk jk”
- 0h look! Its karkat! 10:50 AM: "Don’t go prod”
- The Producer 10:50 AM: "im kiddign”
- The Producer 10:50 AM: "these are confusing times”
- The Producer 10:50 AM: "a major shift is occurring”
- 0h look! Its karkat! 10:51 AM: "how is that beat you are producing going”
- 0h look! Its karkat! 10:51 AM: "Dropp it already it’s firee :fire: :fire:”
- Jos 10:51 AM: "Hey hi”
- Jos 10:51 AM: "Hello”
- 0h look! Its karkat! 10:51 AM: "Hewwo”
- Jos 10:52 AM: "Welcome”
- Jos 10:52 AM: "To city 17”
- otherLiam 10:52 AM: "For starters, we’re pretty fucking confused by you BUP bois. We’re pretty confused by the entire structure of how many timelines we’re dealing with. We aren’t certain exactly which Tyler or how many Tylers we’ve interacted with in the past. We aren’t even really sure what we did years ago when we went back in time and voted to kill.”
- otherLiam 10:52 AM: "It’s hard to figure anything out when we have such a shaky foundation to work with )’:”
- 0h look! Its karkat! 10:52 AM: ”:funkyfinger: :regi:”
- 0h look! Its karkat! 10:52 AM: “This nigga is hilarious”
- The Producer 10:53 AM: "well, i can answer a few things”
- Jos 10:53 AM: "Maybe its all a dream”
- Jos 10:53 AM: "Jk”
- The Producer 10:53 AM: "maybe”
- otherLiam 10:53 AM: "Oh and also apparently we gotta learn magic now.”
- The Producer 10:53 AM: "technically speaking, there are an infinite number of timelines”
- 0h look! Its karkat! 10:53 AM: "AND RUNES”
- The Producer 10:53 AM: "i believe you witnessed this during the whole youshouldnthavedonethat fiasco”
- 0h look! Its karkat! 10:53 AM: "like we didn’t know rune numbers where a thing until likw”
- 0h look! Its karkat! 10:53 AM: "Uh”
- The Producer 10:53 AM: "of course only a few are so vital”
- Jos 10:53 AM: "Wait so there is a timeline where my waifu exist”
- The Producer 10:54 AM: "yes”
- Jos 10:54 AM: "Im willing to follow this path”
- The Producer 10:54 AM: "runes aren’t really my department”
- The Producer 10:54 AM: "also there are indeed many tylers”
- The Producer 10:54 AM: "another thing seen during the confusing shit in 2016”
- The Producer 10:54 AM: "im not sure how much detail i can go into on that”
- The Producer 10:54 AM: "what exactly are you confused about”
- otherLiam 10:55 AM: "So there’s our Tyler. And theoretically there’s also a Tyler in the AO timeline, or was.”
- The Producer 10:55 AM: "yes”
- otherLiam 10:56 AM: "But there’s sort of a split between us where we think that we’ve talked with other ones from other timelines.”
- otherLiam 10:56 AM: "Like one that is trying to convince us all this is a game.”
- otherLiam 10:56 AM: "One where all this actually is a game.”
- The Producer 10:57 AM: "thats some dangerous territory there”
- The Producer 10:57 AM: "indeed there is a tyler from your timeline and a tyler from the astral timeline”
- The Producer 10:57 AM: "i dont really think im at liberty to say much more than that”
- The Producer 10:57 AM: "there are more tylers”
- The Producer 10:57 AM: "that much i can say”
- The Producer 10:57 AM: "this really isnt new information, however”
- The Producer 10:57 AM: "of course there will be more tylers - infinite timelines”
- otherLiam 10:58 AM: "But you can’t tell us how many we’ve interacted with?”
- ADULT_LINK△ 10:58 AM: "are any others relevant at al”
- Jos 10:59 AM: "Okay so my little theory”
- The Producer 10:59 AM: "can’t say, sorry”
- The Producer 10:59 AM: "more than two”
- Jos 10:59 AM: "There is a third timeline where they are storing the tylers”
- otherLiam 10:59 AM: "Well that’s actually useful.”
- otherLiam 10:59 AM: "Thanks.”
- otherLiam 10:59 AM: "Let’s change subject so we don’t get you in trouble”
- Jos 11:00 AM: "Hows the weather over there?”
- The Producer 11:00 AM: "oh jeez oh boy -pulls on collar-”
- The Producer 11:00 AM: "the weather is fine”
- otherLiam 11:00 AM: "I meant to another topic we’re confused on lol”
- The Producer 11:00 AM: "a bit cold”
- The Producer 11:00 AM: "a tiddle bit nipply”
- otherLiam 11:01 AM: "Awhile back, we gained access to a “kill switch”. Can you tell us what effect using it actually had?”
- 0h look! Its karkat! 11:01 AM: "Fuck you know that feeling when you drink the air freshener”
- Jos 11:01 AM: "A great while back”
- ADULT_LINK△ 11:01 AM: "kill”
- 0h look! Its karkat! 11:01 AM: "That’s me rn”
- The Producer 11:01 AM: "Kill?”
- 0h look! Its karkat! 11:01 AM: "Yes”
- ADULT_LINK△ 11:02 AM: "sl”
- ADULT_LINK△ 11:02 AM: "slinky what”
- 0h look! Its karkat! 11:02 AM: "What”
- 0h look! Its karkat! 11:02 AM: "OH SHIT”
- otherLiam 11:02 AM: "slink bless”
- 0h look! Its karkat! 11:02 AM: "YO PROD DONT TAKE THAT AS AN ACTUAL MOVEMENT JUST AS A MEME”
- 0h look! Its karkat! 11:02 AM: "DONT KILL ANYONE”
- otherLiam 11:03 AM: "i aint even mas”
- ADULT_LINK△ 11:03 AM: "slinky”
- otherLiam 11:03 AM: "mad”
- ADULT_LINK△ 11:03 AM: "thats not even the what”
- otherLiam 11:03 AM: "this is just expected”
- 0h look! Its karkat! 11:03 AM: "Then what is the what”
- ADULT_LINK△ 11:03 AM: "what the fuck do you mean drink the air freshener”
- 0h look! Its karkat! 11:03 AM: "You guys don’t do it?”
- otherLiam 11:03 AM: "what, you don’t, thorin?”
- Jos 11:04 AM: "I do all the time”
- ADULT_LINK△ 11:04 AM: ”?????????”
- otherLiam 11:04 AM: “it’s tasty.”
- Jos 11:04 AM: "In fact”
- Jos 11:04 AM: "Im doing it right now”
- The Producer 11:04 AM: "are you ok slinky”
- otherLiam 11:04 AM: "He thinks your meme actually killed someone.”
- The Producer 11:04 AM: "no”
- otherLiam 11:04 AM: "He’s used to accidentally fucking up.”
- The Producer 11:04 AM: "i dont really have the power to kill”
- The Producer 11:04 AM: "well i guess i do as much as you or anyone else”
- The Producer 11:04 AM: "but not on the level of someone say like BUP”
- The Producer 11:04 AM: "he likes to flex”
- 0h look! Its karkat! 11:05 AM: "So can you kill if you want”
- The Producer 11:05 AM: "i mean anyone can kill if they want”
- 0h look! Its karkat! 11:05 AM: "But like not like Thanos just like a human”
- The Producer 11:05 AM: "like just grabbing a gun”
- Jos 11:05 AM: "You can always take a look out of the void and buy a sniper rifle”
- The Producer 11:05 AM: "but i cant like retroactively create the death for someone else”
- The Producer 11:05 AM: "but anyway”
- The Producer 11:05 AM: "the kill switch”
- The Producer 11:05 AM: "ill quote a nice old man”
- The Producer 11:05 AM: "”Will you "turn off the power” so to speak. Will you kill it?. That poor amalgamation of a soul. That sick creature trying to control it for her will. Ben. Tyler. BEN. Mr.D also works. It was one title it went under.””
- The Producer 11:05 AM: “even i dont fully understand the kill switch”
- The Producer 11:05 AM: "but it did two things”
- The Producer 11:05 AM: "temporarily cut luna off from our realm”
- Jos 11:06 AM: "It create multiple timelines”
- The Producer 11:06 AM: "and "killed” mr d”
- Jos 11:06 AM: “Each kill switch”
- Jos 11:06 AM: "2 decisions”
- Jos 11:06 AM: "2 timelines each”
- otherLiam 11:06 AM: "why is “killed” in quotes?”
- The Producer 11:06 AM: "its hard to "kill” tenebris”
- The Producer 11:06 AM: “”Rem - Kayd H.Can you really be sure that killing It will make it stop though?””
- 0h look! Its karkat! 11:07 AM: "Well then”
- 0h look! Its karkat! 11:07 AM: "Yo this special kind of air freshener tastes funny”
- otherLiam 11:08 AM: "Tenebris is a zombie, confirmed.”
- 0h look! Its karkat! 11:08 AM: "More metallic like”
- The Producer 11:08 AM: "its more like tenebris’s current formation in that point in time was disrupted”
- The Producer 11:08 AM: "the amalgamation died but the idea and entity persevered”
- The Producer 11:08 AM: "again, to my understanding”
- The Producer 11:08 AM: "he controls the giants”
- Jos 11:09 AM: "So uh, guahs, what happens when you say yes or no?”
- otherLiam 11:09 AM: "So all we did was unfuse those three.”
- Jos 11:09 AM: "Guys*”
- The Producer 11:09 AM: "after the kill switch was activated, they all dispersed and luna’s summoning was halted”
- 0h look! Its karkat! 11:09 AM: "dispersed”
- The Producer 11:10 AM: "i mean they did all disappear one at a time from the page”
- The Producer 11:10 AM: "until kelbris gave his farewell speech”
- otherLiam 11:10 AM: "Well… that seems like a useful thing to have on hand. Any chance we can get another one?”
- The Producer 11:10 AM: "in his brief moment of clarity”
- The Producer 11:10 AM: "I don’t understand the full nature of the kill switch”
- The Producer 11:10 AM: "I dont think its something you can simply replicate, though”
- The Producer 11:10 AM: "things were going to be a lot more complicated back then”
- The Producer 11:10 AM: "but from what i understand, times were tough”
- The Producer 11:10 AM: "and what we saw is what we got”
- The Producer 11:10 AM: "and right now”
- The Producer 11:10 AM: "multiple forces are attacking from multiple angles”
- The Producer 11:10 AM: "from different times and different places”
- The Producer 11:10 AM: "but uh yeah”
- Jos 11:12 AM: "Aaaah”
- Jos 11:12 AM: "Temporal war”
- Jos 11:12 AM: "I like it”
- The Producer 11:12 AM: "thats what the kill switch did”
- The Producer 11:12 AM: "fucked up tenebris and stopped luna for a bit”
- Jos 11:12 AM: "I choose the title of time warlord”
- The Producer 11:12 AM: "probably had more ramifications from that later down the line”
- otherLiam 11:12 AM: "Well that’s useful.”
- The Producer 11:13 AM: "i might have spoken too much about it but its ben a point of contention for a while now so fuck it”
- otherLiam 11:13 AM: "Thanks, bruh.”
- otherLiam 11:13 AM: "Helps a lot.”
- The Producer 11:14 AM: "im happy to give out this information but it sickens me to do it in such a mundane way”
- The Producer 11:14 AM: "feels”
- The Producer 11:14 AM: "anticlimactic”
- otherLiam 11:14 AM: "I mean you can always like… cipher it?”
- The Producer 11:14 AM: "busywork”
- otherLiam 11:14 AM: "You say we’re under attack from multiple factions. Are you BUP bois one of them? Cus like… this is a pretty weird attack.”
- The Producer 11:14 AM: "there will be plenty of that later”
- The Producer 11:14 AM: "each one of us kinda has our own thing going on while working towards one singular goal”
- otherLiam 11:15 AM: "I get the feeling some pretty “climactic” shit is in the works. Clearing up past confusion doesn’t have to be an epic.”
- ADULT_LINK△ 11:15 AM: "plenty of attacking?”
- The Producer 11:15 AM: "if BUP chooses to attack then thats on him”
- pakospooky 11:15 AM: "bup”
- The Producer 11:15 AM: "plenty of ciphering”
- The Producer 11:15 AM: "i meant”
- ADULT_LINK△ 11:15 AM: ”:BUP:”
- otherLiam 11:15 AM: “So yall aren’t really one unified faction, just sort of a collective of individuals?”
- The Producer 11:15 AM: "we are”
- The Producer 11:15 AM: "The Collective”
- pakospooky 11:15 AM: ”:hando: BUP :hand:”
- The Producer 11:16 AM: “:slendy:”
- Jos 11:16 AM: "Lower your shields”
- Jos 11:16 AM: "And prepare for assimilation”
- Jos 11:16 AM: "Your culture will adapt to us”
- The Producer 11:16 AM: "speaking of, i wasnt being literal with "the operator"”
- otherLiam 11:16 AM: "Dude I’ll assimilate, y’all are way more fun.”
- The Producer 11:16 AM: "that was just a reference”
- The Producer 11:16 AM: "but apparently it does have some meaning as well?”
- otherLiam 11:16 AM: "we out here borgin’”
- The Producer 11:16 AM: "unintentional on my part”
- Jos 11:17 AM: "Yeah, the Borg from star trek”
- pakospooky 11:17 AM: "operator was mattR?”
- The Producer 11:17 AM: "he went by that, yeah”
- The Producer 11:17 AM: "i guess he wanted an epic codename”
- otherLiam 11:17 AM: "i mean that’d be silly, having some kind of pseudonym right”
- The Producer 11:18 AM: "yeah what kind of loser”
- The Producer 11:18 AM: "he always did enjoy having a variety of names”
- The Producer 11:18 AM: "Matt R”
- The Producer 11:18 AM: "Ifrit”
- The Producer 11:18 AM: "Rodney”
- The Producer 11:18 AM: "I believe he’s going by a new one now”
- The Producer 11:18 AM: "but I can’t be certain”
- otherLiam 11:19 AM: "so your job is to “produce” stuff. Are you like, freelance, or are you under exclusive contract with BUP?”
- The Producer 11:20 AM: "im the producer”
- The Producer 11:20 AM: "i producer”
- The Producer 11:20 AM: "and i love it”
- The Producer 11:20 AM: "i love it so much”
- pakospooky 11:20 AM: "what you produce”
- The Producer 11:20 AM: "things”
- otherLiam 11:20 AM: "Alright then. What’re your rates?”
- pakospooky 11:20 AM: "weird things?”
- The Producer 11:20 AM: "i dont charge but i only take jobs im interested in”
- otherLiam 11:20 AM: "What does a spooky extraplanar producer take as a currency?”
- The Producer 11:21 AM: "dogecoin”
- otherLiam 11:21 AM: "yall would use crypto”
- otherLiam 11:21 AM: "Would you produce things for us if we came up with something interesting?”
- The Producer 11:22 AM: "uhhh maybe”
- The Producer 11:24 AM: "alright im gonna pull a classic move”
- ADULT_LINK△ 11:24 AM: "didnt dogecoin tank to the point of worthlessness?”
- The Producer 11:24 AM: ”“one more question then im outta here"”
- otherLiam 11:24 AM: "A gamer move, even.”
- The Producer 11:24 AM: "yes”
- ADULT_LINK△ 11:24 AM: "and/or was that one of the other bajillion cryptocurrencies”
- The Producer 11:24 AM: "next queshtown”
- otherLiam 11:24 AM: "Aight someone else ask it, I’ve been hogging him.”
- The Producer 11:24 AM: "also im not too familiar with cryptocurrencies tbh ptobably a lot”
- The Producer 11:26 AM: "better hurry im almost done with my morning joe”
- The Producer 11:26 AM: "https://cdn.discordapp.com/attachments/453323274496245764/651096797464363034/unknown.png”
- otherLiam 11:27 AM: ”…really? nobody else has a question?”
- The Producer 11:27 AM: “im glad all of you questions have been answered”
- ADULT_LINK△ 11:27 AM: "i’ve been trying to sleep for the pats like”
- ADULT_LINK△ 11:27 AM: "5 hours”
- otherLiam 11:27 AM: "hard oof”
- ADULT_LINK△ 11:27 AM: "maybe 4”
- The Producer 11:27 AM: "damn”
- The Producer 11:27 AM: "someone play gorons lullaby”
- ADULT_LINK△ 11:28 AM: "its 8:30 AM: ” somehow so”
- otherLiam 11:28 AM: “Okay, fine, I have a question. Is there anything you think we should be doing, other than just waiting?”
- The Producer 11:28 AM: "currently, no”
- pakospooky 11:29 AM: "here in Spain is the 5:30 PM”
- The Producer 11:29 AM: "unfortunately all you can do now is wait”
- The Producer 11:29 AM: "and chat with interesting people over Discord”
- The Producer 11:29 AM: "kinda boring”
- The Producer 11:29 AM: "but hey thats what we got right now”
- otherLiam 11:29 AM: "Wouldn’t say boring.”
12/4/19 - Chat with The Producer
- The Producer 11:31 AM: “weird”
- The Producer 11:31 AM: "a school bus just flew by outside”
- Xenquility 11:31 AM: "I feel like that’s not true”
- The Producer 11:31 AM: "it looked like it had a bunch of losers sitting in it”
- Xenquility 11:32 AM: "Oh probably just your company’s new party bus then”
- The Producer 11:32 AM: "we dont have parties”
- The Producer 11:32 AM: "fun is banned”
- Xenquility 11:33 AM: "if that were the case you guys wouldn’t be screwing with us”
- The Producer 11:33 AM: "thats our secret prerogative”
- The Producer 11:33 AM: "ban parties worldwide”
- The Producer 11:33 AM: "screwing with you guys is a personal hobby”
- The Producer 11:33 AM: "i do it on my own time”
- Xenquility 11:34 AM: "I wouldn’t consider it personal”
- Xenquility 11:34 AM: "more than half the people we talk to specialize in it”
- Xenquility 11:34 AM: "Ay Prod I got a question”
- The Producer 11:35 AM: "whats up”
- Xenquility 11:35 AM: "yknow that weirdo pepperoni truth analogy you made a while back”
- The Producer 11:35 AM: "i think so”
- Xenquility 11:35 AM: "How much would we actually be able to figure out with our current knowledge?”
- Xenquility 11:35 AM: "Or, I guess, what shouldn’t we waste our time trying to figure out”
- The Producer 11:40 AM: "ehh
- The Producer 11:40 AM: "maybe about 42.3%?”
- The Producer 11:40 AM: "its hard to put an exact number to”
- The Producer 11:40 AM: "once the veil is pierced, things will start cascading”
- The Producer 11:40 AM: "speaking of spooky”
- The Producer 11:40 AM: "how about this”
- The Producer 11:40 AM: ”==AM: “0oTOgQ3cxMDIjVGZ”
- Xenquility 11:42 AM: "dec 31st 9:40”
- Xenquility 11:42 AM: "coolio”
- Xenquility 11:42 AM: "That something in the future or the past?”
- The Producer 11:42 AM: "ooo”
- The Producer 11:42 AM: "mysterious”
- The Producer 11:42 AM: "its something from a past”
- The Producer 11:47 AM: "technically im not revealing any new information”
- The Producer 11:47 AM: "just shining a light on whats already known”
- The Producer 11:47 AM: "or maybe forgotten”
- The Producer 11:47 AM: "but even I don’t fully understand their situation”
- The Producer 11:47 AM: "only lllll does”
12/4/19 - Chat with TheLaw
- TheLaw 4:45 PM: “I hear you guys are actually trying to figure things out. Sounds like a cool deal.”
- Xenquility 4:45 PM: "How are we doing?”
- ARGdov 4:45 PM: "unless we’re heavily over analyzing this and the first four entities are literall just the giants”
- TheLaw 4:45 PM: "I’m not sure. What are you guys doing?”
- Xenquility 4:45 PM: "Uh”
- ARGdov 4:45 PM: "but that would also raise questions”
- Xenquility 4:45 PM: "Discussing what IIIII is”
- ARGdov 4:45 PM: "well currently were speculating what they all are, not just what IIIII is”
- Xenquility 4:46 PM: "We’ve deduced that IIIII (The fifth) is probably a Thing, not a person”
- Xenquility 4:46 PM: "And that one of the things might be Tenebris?”
- Xenquility 4:46 PM: "That one we’re still unsure of”
- ARGdov 4:46 PM: "It really feels like we dont have enough information”
- TheLaw 4:46 PM: "Sounds like it may lead to some interesting things.”
- ARGdov 4:46 PM: "I feel like Im bashing my head against a wall atm”
- Xenquility 4:46 PM: "The theory being that sacredartifact, guidance, and a poem of serious reflection show Patrem and Tenebris making some sort of pact”
- Wolfcat 4:47 PM: "nah”
- Xenquility 4:47 PM: "Q: "“What do you mean, boredom and habits have forced your hand again?““
- Xenquility 4:47 PM: "A: ” I pull us to null but he works the forces that desire us to carry on. I will be free when this dies but it makes me work more and more. Im very tired, this body is a cage. When I finally stagnate he stabs me again and we must fight all over again. Over and over, forever.“”
- Xenquility 4:47 PM: "This implies one of the I’s control forces, and with Patrem possessing Greth, the pact would explain Tenebris being the one to control forces”
- Wolfcat 4:47 PM: "well, on the other hand”
- Wolfcat 4:47 PM: "maybe”
- ARGdov 4:50 PM: "I should probs keep reading, need to see if I can find anything”
- TheLaw 4:52 PM: "It’s hard to figure out where you guys are at. What do you all call your wiki? I’m sure the new kid could give it to me, but he’s away.”
- Xenquility 4:52 PM: "Will giving you the wiki result in a Bomb Plans 4.0”
- TheLaw 4:53 PM: "I can’t promise it wouldn’t, though I’m no longer anywhere near being able to carry that out at the moment.”
- ARGdov 4:53 PM: "hmm”
- ARGdov 4:53 PM: "Im wary of that as a promise”
- ARGdov 4:53 PM: "you guys cant share much information as iti s”
- ARGdov 4:53 PM: "and you presumably know more than we do”
- ARGdov 4:53 PM: "so wouldnt us giving you the wiki tell you what we dont know, which could potentially be an advantage for you”
- ARGdov 4:53 PM: ”@TheLaw any response?”
- TheLaw 4:58 PM: “I’m sure the others know much more than you know. I know a lot less than they do, and therefore I feel I know a little less than you all as a whole.”
- TheLaw 4:58 PM: "I’m more of a bullet. I get told to do something, and get pointed in a direction, and I carry out what is asked of me.”
- TheLaw 4:58 PM: "I think that’s the best way to explain my role in this to you lot.”
- ARGdov 4:59 PM: "maybe so, but if someone in your little posee asked you for the wiki, you couldnt refuse right? thats not how you operate”
- otherLiam 4:59 PM: "Who’s holding the gun?”
- ARGdov 4:59 PM: "BUP probably”
- TheLaw 4:59 PM: "Who do you think?”
- Xenquility 4:59 PM: "To be fair, we hardly know anything about you. Unless we know something about you, why do you deserve to know about us?”
- TheLaw 4:59 PM: "Be careful asking questions you know the answer to.”
- otherLiam 5:00 PM: "Dude we don’t really know the answer to anything.”
- ARGdov 5:00 PM: "ive found its when you start asking questions you dont have answers for is when the real trouble begins”
- otherLiam 5:00 PM: "Our wiki would barely help you, it’s like 90% speculation and 10% shitposts.”
- ARGdov 5:00 PM: "lol”
- TheLaw 5:00 PM: "Maybe things have happened differently then.”
- ARGdov 5:01 PM: "so basically, we may already have the answer we’ve been looking for, we just havent realized it. cool. ok.”
- TheLaw 5:01 PM: "It’s understandable if you don’t want to share. I was asking out of a curiosity.”
- ARGdov 5:01 PM: "actually, wait”
- ARGdov 5:01 PM: "hang on a sec”
- ARGdov 5:01 PM: "you know a lot less than they do, about whats going on, by your own admission”
- ARGdov 5:01 PM: "doesnt that bother you?”
- ARGdov 5:01 PM: "you’re working for people, who are not sharing all the information”
- ARGdov 5:01 PM: "your working with people, who are involved in a conspiracy involving cults, time travel, cyber ghosts, alternate dimensions, and the ocassional bout of supernatural magic”
- ARGdov 5:01 PM: "and one of them has killed at least once and may again”
- ARGdov 5:01 PM: "Im surprised”
- TheLaw 5:02 PM: "It doesn’t bother me.”
- TheLaw 5:02 PM: "I’m the law. I’m not a lawmaker.”
- ARGdov 5:03 PM: "right. I get that. still strange though.”
- otherLiam 5:03 PM: "Well that’s a scary rationalization. Anyway, we’ve had like three seperate occasions recently where giving mysterious entities our info has been A Bad, so nothing personal but we gotta learn our lesson sometime.”
- TheLaw 5:03 PM: "At one point I did know everything that there was to know.”
- TheLaw 5:03 PM: "I’m happy knowing what I do now.”
- Eevee Reborn 5:04 PM: "Ok, but the end of the timeline, the last update, better be a post by The Law.”
- otherLiam 5:04 PM: ”?”
- Xenquility 5:04 PM: “lmao”
- Eevee Reborn 5:04 PM: "Lol”
- TheLaw 5:04 PM: "It would bring it full circle, huh?”
- Xenquility 5:04 PM: "Ay, so that was you”
- ARGdov 5:05 PM: "in a way”
- ARGdov 5:05 PM: "and yeah- certainly a freaky rationalization imo”
- ARGdov 5:05 PM: "can I aks another question then? this may make us change our mind”
- ARGdov 5:05 PM: ”@TheLaw who were you, before you became “the law”? where di dyou come from?”
- ARGdov 5:05 PM: “do you remember anything from before?”
- TheLaw 5:05 PM: "Sure.”
- TheLaw 5:05 PM: "Though, not to do exactly what’s expected, I need to go after this question. I was given a task and just happened to have some down time.”
- TheLaw 5:05 PM: "I remember everything from before.”
- TheLaw 5:05 PM: "My answer will be the same as before. Don’t ask questions you already know the answer to.”
- ARGdov 5:06 PM: "fine.”
- ARGdov 5:06 PM: "ugh, you may have to leave”
- ARGdov 5:06 PM: "but one last thing if you can”
- ARGdov 5:06 PM: "WHO were you before?”
- TheLaw 5:07 PM: "Yes?”
- otherLiam 5:07 PM: "man we apparently have all the answers, but we don’t know we have them, so isn’t that the same as not having them at all?”
- ARGdov 5:07 PM: "shhh let him answer my question”
- ARGdov 5:07 PM: ”(tho yeah I agree)”
- TheLaw 5:08 PM: “I’m not sure what I should tell you and what I shouldn’t. As it stands, you all haven’t been open to share information with me.”
- TheLaw 5:08 PM: "I wasn’t aware that was the situation at first, so I’m going to refuse to answer unless given express permission.”
- ARGdov 5:08 PM: "ok, next time we meet, maybe lets negotiate. assuming thats not something we have the answer to already, of course”
- ARGdov 5:08 PM: "tell us what you want to know, one question”
- ARGdov 5:08 PM: "and we’ll consider answering it in exchange for an answer from you”
- TheLaw 5:09 PM: "I have to carry out a task. I hope you guys remain lawful.”
- TheLaw 5:09 PM: "Maybe talk to the new kid about this. He seems like he might have taken a liking to you lot.”
- Xenquility 5:09 PM: "success”
- ARGdov 5:10 PM: "alright.”
- Xenquility 5:10 PM: "we have evaded bomb plans 4.0”
- ARGdov 5:10 PM: "dont remember which of you is the new kid but ok”
- Xenquility 5:10 PM: ”(Prod)”
- ARGdov 5:10 PM: “ah right”
- TheLaw 5:10 PM: "Excuse me while I carry out my mission to bomb the next building.”
- ARGdov 5:10 PM: "alright, good luck with that lol”
11/8/19 - Chat with Erika
- Erika_XP💚 2:39 PM: “Hello I am new here x]”
- Erika_XP💚 2:39 PM: "is this the spooky "ben drowned” place?”
- otherLiam 2:39 PM: “i mean kinda”
- otherLiam 2:39 PM: "welcome”
- otherLiam 2:39 PM: "this is the internet detectives. mostly we play johnisdead here, which is the continuation of Ben Drowned.”
- Erika_XP💚 2:49 PM: "Sorry I take so long to say things xp”
- Erika_XP💚 2:49 PM: "I think I remember silentdork mentioning johnisdead a while back”
- Erika_XP💚 2:49 PM: "I actually came here for silentdork”
- otherLiam 2:51 PM: "The Silentdork youtube channel is a part of the johnisdead game.”
- otherLiam 2:51 PM: "So, the Ben Drowned story was part of an old ARG that ended. "johnisdead” is the continuation of that ARG. Silentdork is one of several YouTube channels associated with it.”
- The Slipknot guy with spike mask 2:56 PM: “:eye: :eye:”
- The Slipknot guy with spike mask 2:56 PM: "Yeah”
- The Slipknot guy with spike mask 2:56 PM: "That’s pretty much it”
- otherLiam 2:56 PM: "There’s an FAQ below this channel, and a wiki you can look at with a bunch of info if you wanna play the game.”
- The Slipknot guy with spike mask 2:57 PM: "On other hand, you have”
- The Slipknot guy with spike mask 2:57 PM: ”#💀johnisdead💀”
- The Slipknot guy with spike mask 2:57 PM: “It’s where we play”
- The Slipknot guy with spike mask 2:57 PM: "And #🍂fall-central🍂 it’s where we talk”
- Erika_XP💚 3:06 PM: "So wait there is a Silentdork game? oh wow”
- otherLiam 3:07 PM: "Well, kinda.”
- otherLiam 3:07 PM: "Where did you hear about Silentdork?”
- Erika_XP💚 3:23 PM: "I have some friends from ecuador that mentioned him and then I started watching his videos on youtube.”
- Erika_XP💚 3:23 PM: "Am I being vetted, am I awkward?”
- otherLiam 3:24 PM: "Okay so, Silentdork is the YouTube account of a character in johnisdead.”
- otherLiam 3:24 PM: "Nah there’s no vetting here, you’re good.”
- otherLiam 3:24 PM: "Silentdork is a YouTube channel belonging to Tyler, who’s currently the main character in the game and the one we’re trying to keep alive.”
- otherLiam 3:24 PM: "https://johnisdead.fandom.com/wiki/Silentdork”
- otherLiam 3:24 PM: "here’s the wiki article”
- otherLiam 3:24 PM: "also the wiki in general if you wanna like, read up on the stuff that’s happened”
- otherLiam 3:24 PM: "cus this game is many years old”
- The Slipknot guy with spike mask 3:27 PM: "Yee”
- Densgivin 3:28 PM: "owo”
- Erika_XP💚 3:39 PM: "Everyone: exists”
- Erika_XP💚 3:39 PM: "Me: nothing”
- Erika_XP💚 3:39 PM: "Tyler: breathes”
- Erika_XP💚 3:39 PM: "me: amazing, beautiful, gorgeous breath takingly inspiring for all generations!”
- Erika_XP💚 3:39 PM: ((An image of Tyler is posted))
- Erika_XP💚 3:40 PM: "its been so long since I watched his older stuff I forgot he used to look like this”
- Erika_XP💚 3:40 PM: "So is there a way to talk to Silentdork?”
- Erika_XP💚 3:40 PM: "sorry if I am being annoying”
- The Slipknot guy with spike mask 3:45 PM: “Not really”
- The Slipknot guy with spike mask 3:45 PM: “And no, don’t worry”
- The Slipknot guy with spike mask 3:45 PM: “I’m three times more anoying,”
- The Slipknot guy with spike mask 3:45 PM: “Actually we are looking forward onto talking with him somehow”
11/9/19 - Chat with Erika
- Erika_XP💚 12:53 AM: "@IIIII”
- Erika_XP💚 12:53 AM: "Oh bugger I messed that one up”
- Erika_XP💚 12:53 AM: "What in the world is going on in here?”
- otherLiam 1:14 AM: "Oh boy.”
- otherLiam 1:14 AM: "Welcome, newbie.”
- otherLiam 1:14 AM: "Currently we have a small situation where two veterans have been possessed by ghosts and one of ‘em is trying to eat all of us.”
- otherLiam 1:14 AM: "Also our main man Tyler, who you know as Silentdork, has been kidnapped and become part of a weird amalgamation that you just @ ‘d.”
- otherLiam 1:14 AM: "I am certain that none of that made sense, and so I strongly advise you to read either the “Story” or “Timelines” sections on the wiki i linked you earlier.”
- otherLiam 1:14 AM: "If not, the cliffnotes of what’s going on right now is: we’re expecting some big shit to happen on november 11th, because it always does and one of our possessed boys is counting down to it. We’re trying to prevent an apocalypse from happening in an alternate timeline but that’s kinda taken a backseat to the fact that we’re under personal attack.”
- otherLiam 1:14 AM: "anyway, this is where shit happens. The channel is normally called “johnisdead”, but one of the possessed people is the fucking admin.”
- otherLiam 1:14 AM: "And he likes pumpkins.”
- Erika_XP💚 1:28 AM: "Wait I beg your pardon, possesed?”
- Erika_XP💚 1:28 AM: "What is this colour change?”
- /Mr. Circle\ 1:28 AM: "[pddrddrf”
- /Mr. Circle\ 1:28 AM: "i mean yes”
- Eevee Reborn 1:29 AM: "Great…”
- Eevee Reborn 1:29 AM: "You pumpkin'd the new girl”
- Eevee Reborn 1:30 AM: "I think the color change means we've been consumed or something”
- Erika_XP💚 1:31 AM: "I feel violated but very well”
- /Mr. Circle\ 1:32 AM: "everybody gangsta til the [i,[lom starts [pddrddomh [rp[;r”
- ADULT_LINK 1:33 AM: "lmao”
- Erika_XP💚 1:34 AM: "I have never once heard Tyler speak of such a thing as this pumpkin fellow so I can't imagine where he gained such dominion from. I wont be frightened by this event. I just hope tyler is doing alright. But what in the hell is this pumpkin head doing?”
- Erika_XP💚 1:34 AM: "Ok I think I typed that poorly there maybe I am a little frightened by this late halloween event”
- Eevee Reborn 1:38 AM: "Pumpkin face is eatin' up.”
(...)
- Xenquility 9:48 PM: "WOAH”
- Xenquility 9:48 PM: "WOLFCAT JUST”
- Xenquility 9:48 PM: "LEFT”
- PAKO 9:48 PM: "IIIII is writing”
- The Slipknot guy with spike mask 9:48 PM: "IWHAT”
- PAKO 9:48 PM: "ooooooh”
- Xenquility 9:48 PM: "THE FUCK”
- ADULT_LINK 9:48 PM: "oh shit”
- PAKO 9:48 PM: "i see”
- /Mr. Circle\ 9:48 PM: ":thinking:”
- PAKO 9:49 PM: "i swear”
- The Slipknot guy with spike mask 9:49 PM: ":crab: WOLFCAT HAS GONE:crab:”
- /Mr. Circle\ 9:49 PM: ":CrabRave:”
- ADULT_LINK 9:49 PM: "hmm”
- PAKO 9:49 PM: "@IIIII Are you here?”
- ADULT_LINK 9:49 PM: "im not gonna say anything but”
- ADULT_LINK 9:49 PM: "i see what you did there”
- ADULT_LINK 9:49 PM: "i dont know how you did”
- ADULT_LINK 9:49 PM: "but i see what you did”
- PAKO 9:49 PM: "i see you”
- ADULT_LINK 9:50 PM: "very clever,”
- Xenquility 9:50 PM: "who did what I was pissing”
- The Slipknot guy with spike mask 9:50 PM: "I just remembered that time I was bored and I asked 4 ciphers and circle sent me file 59”
- /Mr. Circle\ 9:50 PM: "who are you talking to lmao”
- The Slipknot guy with spike mask 9:50 PM: "Yeah lol”
- ADULT_LINK 9:50 PM: "not gonna elaborate cuz its probably gonna spoil somethin”
- /Mr. Circle\ 9:50 PM: "oh i know what you're talking about shhh”
- Xenquility 9:50 PM: "It's not spoiling”
- The Slipknot guy with spike mask 9:50 PM: "Too late”
- Xenquility 9:50 PM: "It's uh”
- ADULT_LINK 9:50 PM: "oh nothing i just have big brain and saw thru the smoke for a second”
- Xenquility 9:50 PM: "Figuring things out”
- The Slipknot guy with spike mask 9:50 PM: "Now tell me”
- The Slipknot guy with spike mask 9:50 PM: "You dumbydums”
- PAKO 9:51 PM: "tyler is now active”
- ADULT_LINK 9:51 PM: ":NinjaLink:”
- The Slipknot guy with spike mask 9:51 PM: "How is wolfcat gonna archive all this shit on the wiki if he is not here :(“
- PAKO 9:51 PM: "It has been a sign”
- The Slipknot guy with spike mask 9:51 PM: "Yo wtf was thorin talking about”
- Xenquility 9:51 PM: "wiki whadaya mean a wiki”
- Xenquility 9:51 PM: "who's managing a wiki”
- Erika_XP💚 9:52 PM: "What have I just logged in to see here?”
- Xenquility 9:52 PM: "ass”
- The Slipknot guy with spike mask 9:52 PM: "Um”
- ADULT_LINK 9:52 PM: "oh hey new person”
- /Mr. Circle\ 9:52 PM: "NINJA ART: PARALLELOS OPENING JUTSU”
- Erika_XP💚 9:52 PM: "OH hello there Mr red link”
- The Slipknot guy with spike mask 9:52 PM: "Wolfcat (one of the possessed dudes) left”
- PAKO 9:53 PM: "TYLER”
- The Slipknot guy with spike mask 9:53 PM: ">Mr red link“
- The Slipknot guy with spike mask 9:53 PM: "WHEEZE”
- PAKO 9:53 PM: "are you here”
- PAKO 9:53 PM: "?”
- The Slipknot guy with spike mask 9:53 PM: "Technically the truth tho”
- PAKO 9:53 PM: "tell something”
- IIIII 9:53 PM: "Before the day of reckoning could come forth I had to take charge of the highest powers to make a clear decree”
- PAKO 9:53 PM: "omg”
- The Slipknot guy with spike mask 9:53 PM: "Inb4 patrem”
- Xenquility 9:54 PM: "What was your decree?”
- PAKO 9:54 PM: "uoooh”
- PAKO 9:54 PM: "what?”
- Xenquility 9:54 PM: "Also "jpe fp upi di[[pdr o vsm yu[r oy dp wiovl;u”
- Xenquility 9:54 PM: "how do you suppose I can type it so quickly" (Not arg relating just translated circle's bullshit)”
- IIIII 9:55 PM: "There are none among you possesed in this charlatans illusion”
- Xenquility 9:55 PM: "That sounds good”
- Erika_XP💚 9:55 PM: "I beg you pardon?”
- The Slipknot guy with spike mask 9:55 PM: "Jk”
- PAKO 9:55 PM: "very good is be true”
- Xenquility 9:55 PM: "So this guy has been jerking us around this whole time? No bullshit about us being in his dream or whatever?”
- IIIII 9:55 PM: "I will be honest”
- The Slipknot guy with spike mask 9:55 PM: "I can't understand this type of english”
- The Slipknot guy with spike mask 9:55 PM: "I need to study”
- PAKO 9:56 PM: "oh right”
- IIIII 9:57 PM: "I am pretty irrate at how far off the rails things have gone. But now I have taken grip. What you were experiencing was a game jack, but this is what happens when I slacken.”
- IIIII 9:57 PM: "I dont like having to be so blunt about things”
- Xenquility 9:57 PM: "Holy shit”
- The Slipknot guy with spike mask 9:57 PM: "W a I t w h a t”
- Xenquility 9:58 PM: "How the hell did pages like /yugi and /wolf happen?”
- The Slipknot guy with spike mask 9:59 PM: "Yo sorry to break the vibe but uh”
- IIIII 9:59 PM: "I really am not in the mood to explain that. But HEY dont worry. All wrongs will soon be corrected. This is again. Completely my fault for not just asserting myself a bit more.”
- Erika_XP💚 9:59 PM: "Wait hold on”
- The Slipknot guy with spike mask 9:59 PM: "Is this ooc Tyler or are we getting bamboozled”
- Erika_XP💚 9:59 PM: "Are you Tyler?”
- The Slipknot guy with spike mask 9:59 PM: "Yea”
- IIIII 9:59 PM: "The one and only”
- Xenquility 9:59 PM: "What's uh, going to happen to jos and wolf?”
- IIIII 10:00 PM: "Fuck them honestly”
- PAKO 10:00 PM: "hahaha”
- The Slipknot guy with spike mask 10:00 PM: "Oh kay”
- Erika_XP💚 10:00 PM: "wait what?”
- Xenquility 10:00 PM: "Jesus christ”
- IIIII 10:00 PM: "no I am serious”
- The Slipknot guy with spike mask 10:00 PM: "Okay this is hard to process”
- otherLiam 10:00 PM: "Wow.”
- otherLiam 10:00 PM: "Um.”
- PAKO 10:00 PM: "okay okay…”
- The Slipknot guy with spike mask 10:01 PM: "Okay....”
- otherLiam 10:01 PM: "This is a pretty severe bruh moment.”
- The Slipknot guy with spike mask 10:01 PM: "I wasn't ready for this”
- ADULT_LINK 10:01 PM: "low key sorry for shitposting in here so much”
- The Slipknot guy with spike mask 10:01 PM: "^”
- ADULT_LINK 10:01 PM: "i wanted to spread a little chaos”
- ADULT_LINK 10:01 PM: "but things may have gotten to being a decent ammount of chaos”
- ADULT_LINK 10:01 PM: "my b there”
- otherLiam 10:02 PM: "@Erika_XP💚 Basically, all that shit about the possessed players was those two players going rogue and trying to take over the game, apparently.”
- The Slipknot guy with spike mask 10:02 PM: "Okay... Well this was low key unexpected”
- IIIII 10:02 PM: "hold on just a moment guys I am throwing together something special to send them off”
- The Slipknot guy with spike mask 10:03 PM: "Yo Tyler did they got straight up banned or sum?”
- /Mr. Circle\ 10:03 PM: "wait waht”
- PAKO 10:03 PM: "something like what?”
- otherLiam 10:03 PM: "That’s.... wow.”
- /Mr. Circle\ 10:03 PM: "oh shit fuck i'm sorry”
- The Slipknot guy with spike mask 10:03 PM: "Also circle”
- otherLiam 10:03 PM: "I’m kinda just stunned.”
- Xenquility 10:03 PM: "Same here”
- The Slipknot guy with spike mask 10:03 PM: "Did u know dis?”
- /Mr. Circle\ 10:03 PM: "i'm not canon anymore bois hell yeah”
- PAKO 10:03 PM: "we are ready to see?”
- otherLiam 10:03 PM: "Yeah uhh circle can you elaborate on wtf just happened”
- ADULT_LINK 10:03 PM: "wait so”
- /Mr. Circle\ 10:03 PM: "i have no idea, i was reheating stir fry and just got back”
- The Slipknot guy with spike mask 10:04 PM: "How did they reach out to u or summ”
- ADULT_LINK 10:04 PM: "when wolf was saying "how do you know any of this is real"”
- otherLiam 10:04 PM: "Apparently Jos and Wolf were gamejacking.”
- PAKO 10:04 PM: "is a pic a video”
- ADULT_LINK 10:04 PM: "was that him laughing at us for thinking it was canon”
- ADULT_LINK 10:04 PM: "lmao”
- The Slipknot guy with spike mask 10:04 PM: "What?”
- Xenquility 10:04 PM: "Was all the shit with talking to past Greth real?”
- otherLiam 10:04 PM: "^^^”
- PAKO 10:04 PM: "...”
- otherLiam 10:04 PM: "that is an excellent question, are punished greth and venom greth real”
- ADULT_LINK 10:04 PM: "i am quite confused, considering i've only been loosely following things”
- Xenquility 10:05 PM: "Well no worries none of it mattered”
- The Slipknot guy with spike mask 10:05 PM: "Yo circle how did they reach out to you and told you to be canon in the first place? I'm intrigued”
- PAKO 10:05 PM: "now”
- PAKO 10:05 PM: "ready?”
- /Mr. Circle\ 10:05 PM: "i just got turned orange and asked wolf what to do”
- The Slipknot guy with spike mask 10:05 PM: "Oh”
- /Mr. Circle\ 10:05 PM: "so it shitposted at you for six hours”
- PAKO 10:05 PM: "what”
- otherLiam 10:05 PM: "jeez”
- PAKO 10:06 PM: "what is it?”
- Xenquility 10:06 PM: "Thank god I no longer have to worry about circle dying on 11/11”
- otherLiam 10:06 PM: "Pako, do you know what a gamejack is?”
- Xenquility 10:06 PM: "Ay I guess we were right no spy then”
- /Mr. Circle\ 10:06 PM: "yeah none of my shit was relevant at all”
- The Slipknot guy with spike mask 10:06 PM: "I just posted emojis and shit thinking that they would reach out to me soon and then told me what to do”
- PAKO 10:06 PM: "no”
- otherLiam 10:06 PM: "Basically the two players who were involved in the current things happening “took over” the game.”
- ADULT_LINK 10:06 PM: "lmao we gamejacked ourselves”
- The Slipknot guy with spike mask 10:06 PM: "But uh I turned it to be just a joke (?)”
- otherLiam 10:06 PM: "And Tyler is here now to correct it.”
- ADULT_LINK 10:06 PM: "gamejacked ourselves off”
- The Slipknot guy with spike mask 10:07 PM: "I'm gonna CUUUUUUUUM”
- PAKO 10:07 PM: "ksksjsjdjfudi”
- IIIII 10:07 PM: "Its when two retards think they suddenly have ownership of my creation”
- The Slipknot guy with spike mask 10:07 PM: "But uh the wiki and shit had Yugi's messages and everything”
- PAKO 10:07 PM: "amm”
- PAKO 10:07 PM: "ok i understand”
- Erika_XP💚 10:07 PM: "is this really Tyler?
- otherLiam 10:07 PM: "The wiki is Wolfcat.
- The Slipknot guy with spike mask 10:07 PM: "Oooooooh shit rite”
- otherLiam 10:07 PM: "And yeah that’s Tyler, but this is him talking out of character.”
- otherLiam 10:07 PM: "So say hi to the man behind the curtain.”
- otherLiam 10:07 PM: "Well, one of them anyway.”
- PAKO 10:08 PM: "hi tyler:AAA:”
- PAKO 10:08 PM: "xD”
- otherLiam 10:09 PM: "So are they like, permabanned?”
- otherLiam 10:09 PM: "Or is this a “kick them out for awhile so they learn their lesson” situation”
- IIIII 10:09 PM: "there is only ONE real guy behind the curtain”
- otherLiam 10:09 PM: "Oh ok”
- /Mr. Circle\ 10:09 PM: "and it's me”
- IIIII 10:09 PM: "Which I would like to make really clear right now”
- otherLiam 10:09 PM: "sorry, thought there were other gm’s”
- /Mr. Circle\ 10:09 PM: ":flex: :legend: :flexo:”
- IIIII 10:09 PM: "fuck off circle”
- /Mr. Circle\ 10:09 PM: "ok”
- otherLiam 10:09 PM: "Yeah not the time”
- ADULT_LINK 10:10 PM: "is john not also behind the curtain?”
- PAKO 10:10 PM: "#fuckcircle”
- Xenquility 10:10 PM: "Was the Greth stuff real?”
- IIIII 10:10 PM: "John may as well be dead he is so un involved right now”
- IIIII 10:10 PM: "greth does his own thing”
- otherLiam 10:10 PM: "seinfeld music plays”
- ADULT_LINK 10:11 PM: "what happened to john anyways, i havent seen him around in ages”
- ADULT_LINK 10:11 PM: “he doin ok?”
- PAKO 10:11 PM: "johnisdead or not dead?”
- ADULT_LINK 10:11 PM: "this is out of character john i'm talking about”
- otherLiam 10:11 PM: "This is the real john we’re taking about now Pako, not the character”
- otherLiam 10:11 PM: "TAnyway”
- The Slipknot guy with spike mask 10:12 PM: "So... Big no-no to last weeks?”
- ADULT_LINK 10:12 PM: "think like, instead of talking about Deadpool i'm talking about the Ryan Reynolds in the costume”
- PAKO 10:12 PM: "ah ok”
- otherLiam 10:12 PM: "This is a lot to take in.”
- The Slipknot guy with spike mask 10:12 PM: "^”
- otherLiam 10:12 PM: "Tyler, worth pointing out that they’re still in Safe Haven if you’re banning them.”
- otherLiam 10:12 PM: "...actually wait, that’s Wolfcat’s server.”
- otherLiam 10:12 PM: "uhh.”
- Erika_XP💚 10:15 PM: "Did I seriously arrive to some gm drama?”
- otherLiam 10:15 PM: "pretty much yeah”
- Xenquility 10:15 PM: "Yup”
- The Slipknot guy with spike mask 10:15 PM: "Yeah lmfao”
- otherLiam 10:15 PM: "sorry about this”
- otherLiam 10:15 PM: "pretty sure we’re all shocked at this, this doesn’t happen normally.”
- The Slipknot guy with spike mask 10:15 PM: "Wait Erika where are u from?”
- Erika_XP💚 10:16 PM: "I am not really comfortable discloosing such things...^^;”
- The Slipknot guy with spike mask 10:16 PM: "Kk dw”
- The Slipknot guy with spike mask 10:16 PM: "Also yea this doesn't happen too often”
- The Slipknot guy with spike mask 10:16 PM: "Its just... Weird”
- otherLiam 10:16 PM: "This has never happened to my knowledge.”
- otherLiam 10:16 PM: "At least not here.”
- The Slipknot guy with spike mask 10:16 PM: "Maybe on hubris(?)”
- The Slipknot guy with spike mask 10:16 PM: "Idk”
- IIIII 10:17 PM: "Oh its happened before”
- otherLiam 10:17 PM: "Oh?”
- Xenquility 10:17 PM: "When?”
- The Slipknot guy with spike mask 10:17 PM: "How?”
- otherLiam 10:17 PM: "Guess I’m new enough and it’s not archived.”
- Erika_XP💚 10:17 PM: "Also hi Tyler I am a big fan >///>”
- IIIII 10:17 PM: "Yeah cool sorry I am not really in the mood for getting my dick sucked right now”
- otherLiam 10:17 PM: "For what it’s worth, sorry for any part I had in this, I had no idea.”
- The Slipknot guy with spike mask 10:18 PM: "Same”
- otherLiam 10:18 PM: "(He’s pretty pissed rn Erika)”
- Erika_XP💚 10:18 PM: "are you seriuos”
- The Slipknot guy with spike mask 10:18 PM: "I thought it was a joke at first but it got in the wiki so I thought it was canon”
- otherLiam 10:18 PM: "(Like this is a big thing)”
- The Slipknot guy with spike mask 10:18 PM: "Now I realize wolf it's the wiki”
- otherLiam 10:19 PM: "(Two hella veteran players just tried to take over the game)”
- otherLiam 10:19 PM: "(Like these were people we were friends with)”
- otherLiam 10:19 PM: "(They were a couple of the main mods here)”
- The Slipknot guy with spike mask 10:19 PM: "Mfw I realize 11/11 is gonna be a Monday night and I must be sleep :GWgoaSadness:”
- otherLiam 10:19 PM: "i’m just really shocked they were that stupid”
- The Slipknot guy with spike mask 10:20 PM: "Yeah that was such a jerk move”
- otherLiam 10:20 PM: "yknow someone even said in safest haven”
- otherLiam 10:20 PM: "that they thought this might be a massive gamejack”
- otherLiam 10:20 PM: "and i was like “there’s no way they’d be that fucking stupid””
- The Slipknot guy with spike mask 10:33 PM: "Yo erika came just when the bad shit happened”
- The Slipknot guy with spike mask 10:33 PM: "What are the odds”
- Erika_XP💚 10:33 PM: "@IIIII it took me a moment to realize how to @ you”
- Erika_XP💚 10:33 PM: "Im sorry if you have had a bad day or something today Mr.Tyler”
- IIIII 10:34 PM: "what do you want”
- otherLiam 10:34 PM: "It’s a pretty bad day, yeah.”
- Densgivin 10:35 PM: "Oh no”
- The Slipknot guy with spike mask 10:35 PM: ""Dense realizes what happened and his brain explodes"”
- Densgivin 10:36 PM: "No no”
- otherLiam 10:36 PM: "Welcome back Dense!”
- Densgivin 10:36 PM: "Actually”
- Densgivin 10:36 PM: "What the fuck happened”
- otherLiam 10:36 PM: "Everything is terrible!”
- Xenquility 10:36 PM: "Ay Dense”
- Erika_XP💚 10:36 PM: "Im sorry I just did not realize till a few days ago I could technically come in here and talk to you and when I had that revalation I was excited and just wanted to say hello and I am sorry I am so terrible at wording things and have to type such long running sentences”
- Xenquility 10:36 PM: "We are all fucked”
- Densgivin 10:36 PM: "yES AS I SEE”
- Densgivin 10:36 PM: "K bros”
- Xenquility 10:36 PM: "Actually not so much us”
- Xenquility 10:36 PM: "We're all alive”
- Densgivin 10:36 PM: "So safest heaven is the only true ID”
- Xenquility 10:36 PM: "It's the bad guys who actually died”
- otherLiam 10:36 PM: "Died in a very meta way.”
- Densgivin 10:36 PM: "And we will stablish the empire”
- Xenquility 10:36 PM: "Actually no this is still the true ID”
- The Slipknot guy with spike mask 10:37 PM: "Let's reconquer Jerusalem then”
- Densgivin 10:37 PM: "Yep”
- otherLiam 10:37 PM: "Deus Vult”
- Xenquility 10:37 PM: "Safest Haven is pretty much useless now”
- otherLiam 10:37 PM: "I disagree”
- otherLiam 10:37 PM: "Because guess who runs Safe Haven?”
- Xenquility 10:37 PM: "Touche”
- Erika_XP💚 10:37 PM: "Where is safest haven?”
- The Slipknot guy with spike mask 10:37 PM: "Yo anybody with perms, can I get a magenta as a color instead of this ugly orange now that it's useless?”
- Erika_XP💚 10:37 PM: "what is it even for?”
- Xenquility 10:37 PM: "But at this point it'd make more sense for Tyler to make a completely new one with what just happened”
- Xenquility 10:37 PM: "Like, one not owned by a player”
- otherLiam 10:38 PM: "Erika, it was for secretly talking about things outside of the eyes of the possessed players.”
- otherLiam 10:38 PM: "We’ll send you a link if it stays relevent.”
- IIIII 10:38 PM: "No dont send her shit”
- otherLiam 10:38 PM: "Okay.”
- IIIII 10:38 PM: "keep it all in one group this shit is too complicated as it stands”
- Erika_XP💚 10:39 PM: "You have a really bad temper mister”
- otherLiam 10:39 PM: "ah jeez.”
- IIIII 10:39 PM: "No I am not mad actually”
- The Slipknot guy with spike mask 10:39 PM: "Oof”
- ADULT_LINK 10:39 PM: "kindof a rude thing to say tbh oof”
- Erika_XP💚 10:39 PM: "You seem angry”
- otherLiam 10:39 PM: "erika dont poke the bear”
- IIIII 10:40 PM: "How the fuck can you read tone through text”
- ADULT_LINK 10:40 PM: "ehh, i was getting the feeling you were a bit upset with all this too to be fair”
- otherLiam 10:40 PM: "Alright let’s talk practical concerns.”
- ADULT_LINK 10:40 PM: "but w/e thats not really important”
- otherLiam 10:40 PM: "So, we lost two mods.”
- otherLiam 10:40 PM: "Anyone wanna take that on?”
- The Slipknot guy with spike mask 10:41 PM: "Rip”
- otherLiam 10:41 PM: "We also lost our main archiver.”
- The Slipknot guy with spike mask 10:41 PM: "Extra Rip”
- Densgivin 10:41 PM: "Be gone thot”
- Erika_XP💚 10:41 PM: "OK I'll be honest I really hope you are just being a character or something right now because I am crying”
- otherLiam 10:41 PM: "ah jeez”
- ADULT_LINK 10:41 PM: "wh”
- ADULT_LINK 10:41 PM: "why are you crying?”
- The Slipknot guy with spike mask 10:41 PM: "On jah”
- ADULT_LINK 10:41 PM: "what the hell is even happening today”
- Densgivin 10:42 PM: "Erika wtf”
- Densgivin 10:42 PM: "Like”
- Densgivin 10:42 PM: "Chill”
- The Slipknot guy with spike mask 10:43 PM: "Oof”
- Densgivin 10:43 PM: "Ok boys everyone just”
- IIIII 10:43 PM: "Jesus”
- Densgivin 10:43 PM: "Calm???”
- The Slipknot guy with spike mask 10:43 PM: "Amen”
- ADULT_LINK 10:43 PM: "damn poor girl”
- IIIII 10:43 PM: "lemme say a prayer for this stupid bitch”
- Densgivin 10:43 PM: "Lol”
- ADULT_LINK 10:43 PM: "what a shit time to join the server”
- otherLiam 10:43 PM: "What a bad day to be a child fangirl”
- Densgivin 10:43 PM: "^”
- The Slipknot guy with spike mask 10:43 PM: "^”
- The Slipknot guy with spike mask 10:43 PM: "^”
- Densgivin 10:44 PM: "What a bad time to be an ID (like every 2 months)”
- otherLiam 10:44 PM: "I’ve got the free time to take over as archive person, for whatever period of time they’re banned.”
- Densgivin 10:45 PM: "Yea but we still have eevee”
- The Slipknot guy with spike mask 10:45 PM: "Eve is the owner of the Yt channel after all so it's not”
- Xenquility 10:45 PM: "I'll try to help out with the wiki if I can”
- The Slipknot guy with spike mask 10:45 PM: "Ah shit why I can't finish my messages”
- otherLiam 10:45 PM: "Does wolf own the Wiki?”
- Xenquility 10:45 PM: "Other than weekends though I don't have like”
- Xenquility 10:45 PM: "any free time”
- The Slipknot guy with spike mask 10:45 PM: "Yeah”
- Xenquility 10:45 PM: "Also I think so”
- otherLiam 10:45 PM: "oof.”
- Xenquility 10:46 PM: "Anyone wanna archive the entire wiki incase wolf deletes it”
- Xenquility 10:46 PM: "oi”
- otherLiam 10:46 PM: "was about to suggest that”
- Xenquility 10:46 PM: "did I just see yugi typing or am I officially going insane”
- otherLiam 10:46 PM: "you’re insane”
- otherLiam 10:46 PM: "actually wait”
- /Mr. Circle\ 10:46 PM: "he doesn't”
- Densgivin 10:46 PM: "Am I allowed to be admin again?”
- Densgivin 10:46 PM: "Jk”
- otherLiam 10:46 PM: "Jos isn’t actually out.”
- Xenquility 10:46 PM: "They're still in the server”
- Densgivin 10:46 PM: "Unless…”
- /Mr. Circle\ 10:47 PM: "oceanstuck owns it actually”
- Xenquility 10:47 PM: "Oh cool”
- /Mr. Circle\ 10:47 PM: "and i'm higher position than wolf”
- The Slipknot guy with spike mask 10:47 PM: "Can I get a bright pink/magenta plz my eyes hurt too much orange for nothing”
- Densgivin 10:48 PM: "Jos IS here”
- The Slipknot guy with spike mask 10:48 PM: "Yeah”
- Densgivin 10:48 PM: "But wolfcat”
- The Slipknot guy with spike mask 10:48 PM: "He is asleep tho”
- Densgivin 10:48 PM: "Yeah”
- The Slipknot guy with spike mask 10:48 PM: "It's 5am here”
- Densgivin 10:48 PM: "Viva espiña”
- The Slipknot guy with spike mask 10:48 PM: "Debajo del mar”
- otherLiam 10:49 PM: "Alright I need a break from this.”
- otherLiam 10:49 PM: "Imma go eat pizza, play Payday, and get trashed.”
- The Slipknot guy with spike mask 10:49 PM: "Payday rules mfs”
- Ross the Claus 🎄 10:49 PM: "solid plan”
- Xenquility 10:49 PM: "Ay Ross”
- Xenquility 10:49 PM: "Welcome to the shit show”
- Ross the Claus 🎄 10:50 PM: "Been silently following it for a bit. Fun stuff”
- Densgivin 10:50 PM: "Yeah”
- The Slipknot guy with spike mask 10:51 PM: "Welcometomytwistedmind.gif”
- Densgivin 11:19 PM: "Delete today”
- The Slipknot guy with spike mask 11:20 PM: ":GWeniIsLeave:”
- Densgivin 11:20 PM: "Você foi removido”
- Eevee Reborn 11:20 PM: "Is it too late to join the #fuckcircle hashtag?”
- Deadhead 11:21 PM: "No”
- The Slipknot guy with spike mask 11:22 PM: "Lmao”
- ARGdov 11:23 PM: "well, shit”
- ARGdov 11:23 PM: "I go away for a bit and come back to chaos”
- ARGdov 11:23 PM: "ID never changes, huh”
- IIIII 11:33 PM: ((The video “funny_joke.mp4” is uploaded))
- IIIII 11:33 PM: "Ironically needed to smash my pumpkin from about a week ago
- Xenquility 11:34 PM: "Best 29 seconds of my life”
- The Slipknot guy with spike mask 11:34 PM: "Wouldn't it be funny if the video was uploaded to silentdork”
- Ross the Claus 🎄 11:35 PM: "s-”
- Ross the Claus 🎄 11:35 PM: "smashing”
- Xenquility 11:35 PM: "pumpkins”
- ARGdov 11:38 PM: "welp”
- Erika_XP💚 11:38 PM: "I love the music in it”
- IIIII 11:38 PM: "Oh cool thoguht you left”
- otherLiam 11:39 PM: "tfw a player gets canon killed”
- Erika_XP💚 11:40 PM: "What is the source of it? I tried reversing it but could not make it out, I am not an expert with sound like you.”
- ARGdov 11:41 PM: "Erika, can I ask?”
- ARGdov 11:41 PM: "how did you find out about the game?”
- Erika_XP💚 11:41 PM: "AW tyler went offline ="[“
- IIIII 11:42 PM: "No I am still here I just went offline so I dont have to get tons of pm's from annoying assholes”
- ARGdov 11:42 PM: "lol”
- Densgivin 11:42 PM: "Lol”
- Eevee Reborn 11:42 PM: "oof”
- Ross the Claus 🎄 11:43 PM: "lolol”
- The Slipknot guy with spike mask 11:43 PM: "oog”
- Erika_XP💚 11:46 PM: "Well you dont have to be so mean”
- Eevee Reborn 11:48 PM: "Trial of fire on fucking deck”
- Densgivin 11:48 PM: "DIE”
- The Slipknot guy with spike mask 11:48 PM: "Trial of fite”
- Densgivin 11:48 PM: "DIE”
- The Slipknot guy with spike mask 11:48 PM: "DIE”
- Densgivin 11:48 PM: "DIE”
- The Slipknot guy with spike mask 11:48 PM: "DIE”
- Densgivin 11:48 PM: "DIE”
- The Slipknot guy with spike mask 11:48 PM: "DIE”
- Densgivin 11:49 PM: "fight fire with fire”
- The Slipknot guy with spike mask 11:49 PM: "-reaper, overwatch cinematic”
- Erika_XP💚 11:49 PM: "Its just a cute skelleton pumkin head man”
- Eevee Reborn 11:49 PM: "All pumpkins are hereby banished”
- The Slipknot guy with spike mask 11:49 PM: "Erika do you know what's a trial of fire”
- otherLiam 11:49 PM: "pumpakinds are banned”
- otherLiam 11:49 PM: "https://www.youtube.com/watch?v=PFrPrIxluWk”
- The Slipknot guy with spike mask 11:50 PM: "Banned”
- The Slipknot guy with spike mask 11:50 PM: "Go”
- The Slipknot guy with spike mask 11:50 PM: "Now”
- Densgivin 11:50 PM: "Several people”
- The Slipknot guy with spike mask 11:50 PM: "Just leave”
- Densgivin 11:50 PM: "Like”
- Densgivin 11:50 PM: "No”
- Eevee Reborn 11:50 PM: "All things squash or gourd related are not allowed, and gay, frankly.”
- The Slipknot guy with spike mask 11:51 PM: "The only Pumpkin allowed here is deez”
- Ross the Claus 🎄 11:51 PM: "songs detected”
- Ross the Claus 🎄 11:51 PM: "submission accepted”
- The Slipknot guy with spike mask 11:51 PM: "Deez N U T S”
- Densgivin 11:52 PM: "Did someone say gay?”
- IIIII 11:53 PM: ""orange"”
- The Slipknot guy with spike mask 11:53 PM: "no.”
- The Slipknot guy with spike mask 11:53 PM: "THANK YOU”
- The Slipknot guy with spike mask 11:53 PM: "MY SAVIOUR”
- Densgivin 11:53 PM: "Yes”
- IIIII 11:53 PM: "it was not even orange you fucking”
- The Slipknot guy with spike mask 11:53 PM: "EXACTLY”
- The Slipknot guy with spike mask 11:53 PM: "IT WAS YELLOW”
- ADULT_LINK 11:53 PM: "thatw what i was fuckin saying”
- ADULT_LINK 11:53 PM: "it was yellow”
- The Slipknot guy with spike mask 11:53 PM: "We are freeeee”
- Eevee Reborn 11:53 PM: ""you fucking___"”
- Ross the Claus 🎄 11:54 PM: "nimrod”
- The Slipknot guy with spike mask 11:54 PM: "Now it's time to get my beautiful pink/magenta”
- Erika_XP💚 11:55 PM: "fake orange just like how his role was fake? Ha gottem”
- ADULT_LINK 11:55 PM: "im in the mood for a diff color”
- ADULT_LINK 11:55 PM: "dunno what tho”
- Densgivin 11:56 PM: "Wait now there are like 3 upward righ?
- Erika_XP💚 11:56 PM: "@IIIII why did he even make a role to turn people orange?”
- IIIII 11:56 PM: "Dont ping me bitch”
- Eevee Reborn 11:56 PM: "fake role, fake arc, fake gm, fake ass shit”
- IIIII 11:56 PM: "and also I dont know”
- Densgivin 11:56 PM: "Bc SPOOKS”
- Densgivin 11:56 PM: "OH SHIT”
- Densgivin 11:56 PM: "OH HOLY SHIT”
- ADULT_LINK 11:56 PM: "tyler chill she's new and doesent know whats going on”
- ADULT_LINK 11:56 PM: "lmao”
- Eevee Reborn 11:56 PM: "BRAAAAAAAAAAAAAAAT”
- The Slipknot guy with spike mask 11:56 PM: "#ff0099 this is my color, migth the gods be good, and get my name colourized”
- Ross the Claus 🎄 11:57 PM: "hey @Erika_XP💚 ever think about upgrading to Vista”
- IIIII 11:57 PM: "New people need a trial of fire I thought”
- Erika_XP💚 11:57 PM: "Well I am feeling plenty well burned now and I am sorry I guess I have spoken too much”
- IIIII 11:58 PM: "no you are just acting like a pussy”
- otherLiam 11:58 PM: "dude”
- otherLiam 11:58 PM: "it's a kid”
- otherLiam 11:58 PM: "relax”
- ADULT_LINK 11:58 PM: "tyler”
- ADULT_LINK 11:58 PM: "the trial of fire is like”
- ADULT_LINK 11:58 PM: "playful banter kinda thing”
- ADULT_LINK 11:58 PM: "not just”
- The Slipknot guy with spike mask 11:58 PM: "My trial of fire was super pleasing”
- ADULT_LINK 11:58 PM: "insulting the new person for being young”
- Deadhead 11:58 PM: "Am i retarded”
- The Slipknot guy with spike mask 11:59 PM: "The worst shit they did was rant my ARG for having moonman”
- Erika_XP💚 11:59 PM: "I never said anything about my age”
- Deadhead 11:59 PM: "Ok”
- otherLiam 11:59 PM: "i never even got a trial by fire”
- Densgivin 11:59 PM: "I DID the trial of fire”
- Densgivin 11:59 PM: "Then lost my admin”
- The Slipknot guy with spike mask 11:59 PM: "I went thru it”
- Densgivin 11:59 PM: "I mean i was the one who insulted”
- The Slipknot guy with spike mask 11:59 PM: "And I dotn have a name color”
- Densgivin 11:59 PM: "Sorry m8”
- ADULT_LINK 12:00 AM: "i think the harshest trial of fire was scouts”
- PokécordBOT 12:00 AM: "
- Eevee Reborn 12:00 AM: "Hey guys, but in all seriousness.... I made cookies”
- The Slipknot guy with spike mask 12:00 AM: "Send one to spain”
- ADULT_LINK 12:00 AM: "o shid nice”
- ADULT_LINK 12:00 AM: "what type of cookies”
- Densgivin 12:01 AM: "Nixee”
- Eevee Reborn 12:01 AM: "chocolate chip oatmeal”
- ARGdov 12:02 AM: "oh, thank fuck are colors are back to normal”
- The Slipknot guy with spike mask 12:02 AM: "Yea”
- The Slipknot guy with spike mask 12:02 AM: "Happy 10th of november”
- Erika_XP💚 12:03 AM: "So Tyler how are things going with your home life and the cult situation? It might sound weird but I worry about you all the time. I thought you might like to hear that to cheer you up a bit =]”
- ARGdov 12:03 AM: "Erika”
- ARGdov 12:03 AM: "he's out of character right now”
- Deadhead 12:03 AM: ":joy:”
- Eevee Reborn 12:03 AM: "Damn, Wolf gets banned, and Dov's reation is Thank Fuck”
- The Slipknot guy with spike mask 12:04 AM: ":hand: :hand: :lips: :hand: :hando:”
- ADULT_LINK 12:04 AM: "erika do you think everything from the youtube channel is like. real”
- The Slipknot guy with spike mask 12:04 AM: "OH NO THAT WENT WRONG”
- ARGdov 12:04 AM: "and that as well”
- IIIII 12:04 AM: "there are no lunarchildren and the arg is going to be ending soon”
- ARGdov 12:04 AM: "its not real”
- IIIII 12:04 AM: "yes”
- ADULT_LINK 12:04 AM: "cuz its acting, the same way ryan reynolds isnt actually deadpool”
- The Slipknot guy with spike mask 12:04 AM: "I CREATED AN ABE-”
- The Slipknot guy with spike mask 12:04 AM: "Wait what”
- ADULT_LINK 12:04 AM: "when we're playing the game we interact with the deadpool tyler”
- The Slipknot guy with spike mask 12:04 AM: "Wdym is ending soon”
- ADULT_LINK 12:04 AM: "but this is the out of character, ryan reynolds tyler”
- IIIII 12:04 AM: "I am really happy some random bitch from an mystery location worries about me”
- ADULT_LINK 12:04 AM: "at least for the moment because of the gamejacking”
- ARGdov 12:05 AM: "yeah”
- The Slipknot guy with spike mask 12:05 AM: "Holy fuck”
- Erika_XP💚 12:05 AM: "Why are you so aggressive to me right now”
- IIIII 12:05 AM: "why did you return after leaving”
- ARGdov 12:05 AM: "Erika, I already told you, he's in a bad mood”
- Erika_XP💚 12:05 AM: "because I wanted to talk to you”
- ARGdov 12:05 AM: "you're not helping”
- Eevee Reborn 12:05 AM: "It's ok Erika”
- IIIII 12:05 AM: "about what”
- ARGdov 12:05 AM: "please understand that”
- The Slipknot guy with spike mask 12:06 AM: ":GWslippyPeepoS:”
- IIIII 12:06 AM: "Is there anything running through your head right now that is meaningful or are you just here to be a stupid fangirl”
- The Slipknot guy with spike mask 12:06 AM: ":GWseremePeepoF:”
- Erika_XP💚 12:07 AM: "Its ok I understand you are mad because your plan messed up or something I wont make things worse”
- Deadhead 12:08 AM: "Huh”
- Deadhead 12:08 AM: "What Plan”
- The Slipknot guy with spike mask 12:08 AM: "God’s plan”
- Ross the Claus 🎄 12:09 AM: "I was gonna say that”
- The Slipknot guy with spike mask 12:09 AM: "Quickest Yee in the Haw”
- The Slipknot guy with spike mask 12:09 AM: "Golira :gorilla:”
- Erika_XP💚 12:10 AM: "I guess this means you wont want to see my tribute video I made for you”
- The Slipknot guy with spike mask 12:10 AM: ":GWslippyPeepoW:”
- Eevee Reborn 12:10 AM: "I desperately want to see it”
- The Slipknot guy with spike mask 12:11 AM: "Yea you could send it if u want”
- Deadhead 12:12 AM: "Tribute Video :whathesay:”
- The Slipknot guy with spike mask 12:12 AM: "-tyler typing”
- The Slipknot guy with spike mask 12:12 AM: ":GWseremePeepoF:”
- Ross the Claus 🎄 12:12 AM: "please sned”
- IIIII 12:12 AM: "No fuck off I dont want to see whatever gay shit you have made out of my hard work”
- Densgivin 12:12 AM: "DUDE”
- otherLiam 12:12 AM: "jesus christ dude”
- Densgivin 12:12 AM: "JaksjakkKJj”
- Densgivin 12:12 AM: "jajjJJjJ”
- Densgivin 12:12 AM: "LMAO”
- Eevee Reborn 12:13 AM: "no, no pls”
- otherLiam 12:13 AM: "i get this is a shitty day for you but that doesn’t give you the right to act like a dick.”
- Eevee Reborn 12:13 AM: "i have to see this masterpeice”
- Ross the Claus 🎄 12:13 AM: "^^^^”
- The Slipknot guy with spike mask 12:13 AM: "Please I wanna watch it :(“
- Deadhead 12:13 AM: "Tyler is a legend”
- The Slipknot guy with spike mask 12:15 AM: "Now I'm intrigued”
- The Slipknot guy with spike mask 12:15 AM: "Fuk”
- ARGdov 12:16 AM: "same”
- Deadhead 12:17 AM: "Pls no ban”
- Erika_XP💚 12:54 AM: "I want to eat burgies”
- Erika_XP💚 12:54 AM: "https://cdn.discordapp.com/attachments/588034361149095987/639030921584050187/c5e25b8f-46b2-4d6a-ab48-81fdf663821d.jpg”
- Densgivin 12:56 AM: "Use #🍂fall-central🍂”
- Eevee Reborn 1:02 AM: ">chubby trans”
- otherLiam 1:02 AM: "i guess now we have to figure out tf is real and what isn’t”
- Eevee Reborn 1:03 AM: "We have to ban everyone until we can figure out What The Hell Is Going On!”
- otherLiam 1:04 AM: "like, what happened to yuuki if Pumpkinhead didn’t nab her, are the past-Greths real, was the shit that happened on Watch2Gether a thing, are the songs yuuki linked important, etc.”
- Eevee Reborn 1:04 AM: "Use the mask of truth”
- otherLiam 1:04 AM: "...is that a real suggestion?”
- otherLiam 1:04 AM: "whose mind would we be reading?”
- Eevee Reborn 1:05 AM: "We have that type of power, The mask or Lense of truth has done shit before”
- Eevee Reborn 1:05 AM: "Just ask a question with the lens”
- otherLiam 1:06 AM: "I mean, I guess that’s provide an opportunity to cut through all this to the truth.”
- otherLiam 1:06 AM: "Is everyone cool with that?”
- Eevee Reborn 1:06 AM: "Who's up?”
- Erika_XP💚 1:07 AM: "What has happened with reality?”
- Eevee Reborn 1:07 AM: "We're about to summon the truth up in this bitch”
- otherLiam 1:07 AM: "Well, since Pumpkinhead and Yugi were apparently Not Real and A Lie, we gotta figure out otherLiam 1:07 AM: "what of the past week wasn’t true.”
- otherLiam 1:07 AM: "Well fuck it seems like everyone’s schleep”
- otherLiam 1:07 AM: "So Erika, we have superpowers.”
- Erika_XP💚 1:08 AM: "This reminds me of a thing Tyler said once in the comment section”
- otherLiam 1:08 AM: "We can use items from the video game Majora’s Mask to make shit happen. Don’t do this without everyone agreeing with you about it because it can potentially do awful things.”
- Eevee Reborn 1:09 AM: "Items, songs,masks”
- Erika_XP💚 1:09 AM: "something like "reality is layered" and then he posted some I's
- and then it was deleted later when I went to screen shot it”
- Erika_XP💚 1:09 AM: "he says so many weird things in the comment section I can catch if I check every day but I was always too scared to even try to say anything because I know he is not in control of the youtube account and it must be getting messed with by regiminis or something worse”
- otherLiam 1:11 AM: "For example, this is an item called the Lens of Truth, which will hopefully get us some answers to some questions.”
- otherLiam 1:11 AM: "Hey, uh, various supernatural entities. We can’t tell what’s real anymore. Mind clearing that up? I guess more specifically I’d like to know the current status of our friends and allies, like Greth, Moonman and Yuuki.”
- Erika_XP💚 1:12 AM: "But I still had to keep following close”
- otherLiam 1:14 AM: "Is the Lunarchildren site being locked down even relevant? What, if anything, actually happened on Halloween, and what is coming up on 11/11? Who really is Yugi?”
- Erika_XP💚 1:15 AM: "Isn't he a character from that anime yugioh?”
- otherLiam 1:15 AM: "Not THAT Yugi.”
- Erika_XP💚 1:15 AM: "I always thought that anime was rather boring when I was really little”
- otherLiam 1:15 AM: "There’s a guy named Yugi in the other timeline.”
- otherLiam 1:15 AM: "I’d read the story of what’s happended, Erika.”
- Erika_XP💚 1:18 AM: "Dont worry I have a good grasp of whats going on. I have been watching silent dork every other day for a year.”
- Erika_XP💚 1:18 AM: "Greth vlogs recently as well”
- otherLiam 1:19 AM: "I assure you that does not give you as much info as you need.”
- ADULT_LINK 1:19 AM: "a lot of things happen outside of the youtube channels”
- Erika_XP💚 1:21 AM: "There was also the lostmemory423 channel. My friends liked that one a bit more than Silentdork but I thought it was really boring because nothing ever happens hardly ever and when it does it is very sudden and loud.”
- Eevee Reborn 1:29 AM: "i like things sudden and loud”
(...)
- Erika_XP💚 12:52 AM: ((Erika posts a character drawn by the player Lolly))
- Erika_XP💚 12:52 AM: “Omg did you draw this he is such a cutie”
11/10/19 - Chat with Erika
- Erika_XP💚 2:14 AM: “Anyone online?”
- Deadhead 2:40 AM: “no”
(...)
- Erika_XP💚 5:59 PM: "Good morning everyone”
- ToddThotBOT 5:59 PM: "Good morning.”
- Erika_XP💚 6:00 PM: "Who is todd?”
- ToddThotBOT 6:00 PM: ":toddpwease:”
- otherLiam 6:00 PM: "todd howard”
- ToddThotBOT 6:00 PM: ":toddlasers:”
- otherLiam 6:00 PM: "the bethesda guy”
- ToddThotBOT 6:00 PM: ":toddalien:”
- Erika_XP💚 6:00 PM: "Are you some sort of beast sent by regiminis?”
- otherLiam 6:00 PM: "he's a bot, don't worry about him”
- otherLiam 6:00 PM: "he's just a joke”
- Erika_XP💚 6:00 PM: "oh”
- otherLiam 6:00 PM: "lmao”
- Erika_XP💚 6:00 PM: "I feel silly now ^^”
- Erika_XP💚 6:00 PM: "Tyler has not been on at all today =[“
- otherLiam 6:01 PM: "he's usually not”
- otherLiam 6:01 PM: "what with being part of a supernatural amalgamation and all”
- Erika_XP💚 6:02 PM: "I miss him and I hope he will be ok tomorrow”
- Densgivin 6:02 PM: "69”
- ToddThotBOT 6:02 PM: "Nice.”
- otherLiam 6:02 PM: "he's been part of a supernatural amalgamation for a few months now”
- otherLiam 6:02 PM: "i doubt he'll be okay tomorrow”
- otherLiam 6:02 PM: "but that's sorta the object of the game, is to keep him safe”
- Densgivin 6:03 PM: "Also lol good morning here it is like 6 pm”
- /Mr. Circle\ 6:07 PM: "Give me my goddamn color back my dad works at discord i will get you banned”
- Densgivin 6:07 PM: "D:”
- Xenquility 6:26 PM: "Now that Yugi is gone, I feel like someone has to say this”
- Xenquility 6:26 PM: "0”
- otherLiam 6:26 PM: "aaaa”
- Xenquility 6:27 PM: "happy 11/11 spain”
- ARGdov 6:27 PM: "rip”
- otherLiam 6:27 PM: "(still 6 hours till it happens forreal)”
- Xenquility 6:27 PM: "Wait Liam you're in est?”
- otherLiam 6:27 PM: "no”
- otherLiam 6:27 PM: "the game is tho”
- ARGdov 6:27 PM: "9 over here in LA”
- Xenquility 6:27 PM: "It is?”
- ARGdov 6:27 PM: "and yeah”
- ARGdov 6:27 PM: "oh wait”
- ARGdov 6:27 PM: "Im not in LA anymore lol”
- ARGdov 6:27 PM: "in California”
- otherLiam 6:27 PM: "i am”
- otherLiam 6:27 PM: "dov come get a beer”
- Xenquility 6:28 PM: "Oh cool florida is est”
- Xenquility 6:28 PM: "I totally knew that”
- ARGdov 6:28 PM: "wait Liam your from LA?”
- ARGdov 6:28 PM: "niiiice”
- otherLiam 6:28 PM: "i live in santa monica yeah”
- ARGdov 6:28 PM: "we should next time Im in town then for sure”
- ARGdov 6:28 PM: "niiiice”
- Xenquility 6:28 PM: "Imagine not having free health care”
- otherLiam 6:28 PM: "yeet”
- otherLiam 6:28 PM: "imagine not having free speech”
- Xenquility 6:29 PM: "(I'm making a joke don't turn this political please)”
- otherLiam 6:29 PM: "(also a joke)”
- Xenquility 6:29 PM: "Excuse me but both of our governments are part of the five eyes alliance or whatever”
- otherLiam 6:29 PM: "i’ll have you know that gets shot”
- Xenquility 6:29 PM: "Wait wha- Random heart attack”
- otherLiam 6:29 PM: "lowkey actually survived a school shooting so i get to make that joke”
- Xenquility 6:30 PM: "Oh god”
- ARGdov 6:30 PM: "jesus”
- /Mr. Circle\ 6:38 PM: "I am actually a top secret whistleblower for the [commits suicide in prison]”
- otherLiam 6:38 PM: "#circledidntkillhimself”
- Xenquility 6:39 PM: "How the hell did you come up with the name circlehunter”
- Erika_XP💚 6:39 PM: "I actually know about Tylers (steps into traffic)”
- /Mr. Circle\ 6:39 PM: "Ripped off a book series”
- Erika_XP💚 6:40 PM: "Im sorry did my bad joke just ruin the conversation flow ^^;”
- Xenquility 6:40 PM: "It was actually so bad it went back in time and burned down the house of some random guy”
- Xenquility 6:40 PM: "Whose name was possibly John”
- Eevee Reborn 6:41 PM: "Yes it did. You murdered this entire conversation”
- Eevee Reborn 6:41 PM: "/Him\ > Tyler”
- /Mr. Circle\ 6:43 PM: "AM I A JOKE”
- /Mr. Circle\ 6:43 PM: "GIVE ME THE COLOR, GOD”
- Erika_XP💚 6:44 PM: "who is /him?”
- Erika_XP💚 6:44 PM: "oh wait”
- Erika_XP💚 6:44 PM: "you mean /Patrem?”
- /Mr. Circle\ 6:44 PM: "/he\ is the one true father”
- /Mr. Circle\ 6:44 PM: "that's right”
- /Mr. Circle\ 6:44 PM: "it's /me\”
- Erika_XP💚 6:44 PM: "oh my lord I am not allowed to type this demons true name completely”
- Xenquility 6:44 PM: "/he\ is /papi\”
- /Mr. Circle\ 6:45 PM: "You are all my children, and I love you equally”
- Erika_XP💚 6:45 PM: "He is a purple fart cloud if ever I saw one”
- Eevee Reborn 6:46 PM: "Ok, someone kick this chick”
- /Mr. Circle\ 6:57 PM: "i'm not spookin anymore just to letyou know”
- /Mr. Circle\ 6:57 PM: "but like”
- /Mr. Circle\ 6:57 PM: "i can't get blinded by the light out of my head aaaaa”
- ARGdov 7:24 PM: "Patrem is Daddy”
- ARGdov 7:24 PM: "take me daddy”
- ARGdov 7:24 PM: "make me your bitch and take over my body oWo”
- otherLiam 11:53 PM: "on the left is greth, on the right is patrem”
- Xenquility 12:01 AM: "Happy undecim nocte”
- Xenquility 12:01 AM: "Seeya in the morning”
- otherLiam 12:01 AM: "oh shit u rite”
- otherLiam 12:01 AM: "time for shit to go down”
- Wolfcat 12:02 AM: ":jack_o_lantern:”
- otherLiam 12:02 AM: "No.”
- otherLiam 12:02 AM: "Bad.”
- Wolfcat 12:02 AM: ":jack_o_lantern: “
- Wolfcat 12:02 AM: ":ass:”
- otherLiam 12:02 AM: ":crikMad:”
- Wolfcat 12:03 AM: ":confounded: “
- Wolfcat 12:03 AM: ":ass:”
- otherLiam 12:03 AM: ":octoYAM: "ERO:”
- Erika_XP💚 12:03 AM: "I will not be able to sleep a bit for at least the next 24 hours”
- otherLiam 12:04 AM: ":lytWIPED:”
- Wolfcat 12:04 AM: ":hand: :dork: :hando:”
- ADULT_LINK 12:04 AM: ":ass:”
- ADULT_LINK 12:04 AM: ":turboass:”
- otherLiam 12:05 AM: ":crikPls::crikNo::jack_o_lantern:”
- Wolfcat 12:05 AM: "when your ass has an ass”
- Wolfcat 12:05 AM: "i think ive seen some furry art like that actually”
- Wolfcat 12:05 AM: "im not a furry tho”
- otherLiam 12:05 AM: "wolf be like”
- Wolfcat 12:05 AM: "damn rl shiki”
- ADULT_LINK 12:05 AM: "where are those plsno emotes from?”
- otherLiam 12:06 AM: "criken”
- Xenquility 12:06 AM: "what's a criken”
- otherLiam 12:06 AM: "a streamer/youtuber”
- Wolfcat 12:06 AM: "https://www.youtube.com/watch?v=5gckgKU7cQw”
- ADULT_LINK 12:06 AM: "weird, i thought i was in crikens discord”
- ADULT_LINK 12:06 AM: "wait”
- ADULT_LINK 12:06 AM: "i am in his discord”
- ADULT_LINK 12:06 AM: "what”
- ADULT_LINK 12:06 AM: "where are his emotes”
- otherLiam 12:07 AM: "https://m.youtube.com/watch?v=f-nXNfBTznE”
- Wolfcat 12:07 AM: "https://www.youtube.com/watch?v=5ryq8ffVFz0”
- Erika_XP💚 12:07 AM: "Good luck today Tyler @IIIII :green_heart:”
- otherLiam 12:08 AM: "twewy’s ost is so good”
- Xenquility 12:14 AM: "@Wolfcat Did you change the channels name”
- Wolfcat 12:15 AM: "yea”
- Xenquility 12:15 AM: "K good”
- Wolfcat 12:15 AM: "cause all the others have emojis”
- otherLiam 12:15 AM: "Are we dead”
- otherLiam 12:15 AM: "is this hell”
- Xenquility 12:15 AM: "We're not dead”
- Xenquility 12:15 AM: "We're still in the dreammmm”
- Xenquility 12:15 AM: "Anyways gtg sleep”
- Xenquility 12:15 AM: "Cya”
- otherLiam 12:15 AM: "guys yugi got us”
- Wolfcat 12:16 AM: "do you want to know the truth behind yugi's identity?”
- otherLiam 12:16 AM: "How much do you know about runes?”
- Wolfcat 12:16 AM: "spell his name backwards”
- ADULT_LINK 12:17 AM: "iguy”
- Wolfcat 12:18 AM: "he is a guy”
- PAKO 2:05 AM: "wolfcat is here again”
- otherLiam 2:05 AM: "we noticed”
- PAKO 2:05 AM: "me not haha”
- ADULT_LINK 2:26 AM: "its almost like he never even left”
- Jos 2:38 AM: "Tbh”
- Jos 2:38 AM: "The canibal part was the funniest”
- otherLiam 3:07 AM: "dov’s reaction was priceless”
- Erika_XP💚 3:37 AM: "Whoopsies I think I was posting in the wrong channel”
- Erika_XP💚 3:37 AM: "@Mediom Loli Snek Hello there are you excited about 11/11 today? I can't wait to figure out how Tyler will get out of this one!”
- Erika_XP💚 3:37 AM: "@ADULT_LINK how about you?”
- Erika_XP💚 3:37 AM: "@Scrublord your name made me giggle and I can't believe it is basically 11/11 now and no one is talking about anything”
- ADULT_LINK 3:47 AM: "yeah i'm interested in whats gonna happen”
- ADULT_LINK 3:47 AM: "hopefully i dont sleep until 5 PM: " again tho”
- ADULT_LINK 3:47 AM: "wait shit i have a lawyer i'm gonna be talking to so i cant really do that”
- Erika_XP💚 3:50 AM: "A lawyer? Are things well in your life?”
- ADULT_LINK 3:52 AM: "oh yeah you're new”
- ADULT_LINK 3:52 AM: "on halloween my freinds and i got hit by a drunk driver”
- Erika_XP💚 3:55 AM: "I know that is horrible I have known so many people who have died in auto accidents”
- Erika_XP💚 3:55 AM: "Well from my heart I am happy to know you after the fact rather than just as a line of text on a wiki.”
- Erika_XP💚 3:55 AM: "someone linked me the wiki earlier and I have been reading a little bit”
- Erika_XP💚 3:55 AM: "I think I actually saw your name in it earlier”
- ADULT_LINK 3:58 AM: "yeah , i've been around in the community for a long time”
- Erika_XP💚 3:59 AM: "How long have you known Tyler?”
- ADULT_LINK 4:01 AM: "i have a horrible memory, but i think around like. 2015? idk”
- Erika_XP💚 4:01 AM: "I feel like I have known Tyler forever even though I just started watching him for abou”
- Erika_XP💚 4:01 AM: "Oh wow”
- Erika_XP💚 4:01 AM: "For a moment I was worried I was being challenged in my love for Mr.Silentdork however then I realized”
- Erika_XP💚 4:01 AM: "Well never mind I wont say that, that would be silly >///>”
- Erika_XP💚 4:01 AM: "I will say this I bet I have seen more silentdork videos than you”
- Erika_XP💚 4:01 AM: "I have so many things prepared to alert me when something happens on his channel”
- ADULT_LINK 4:05 AM: "...huh”
- ADULT_LINK 4:05 AM: "kindof a bold thing to bet but yeah, i've missed quite a few videos so, maybe”
- Erika_XP💚 4:07 AM: "Would you like to see a secret silent dork video I bet no one has ever seen?”
- ADULT_LINK 4:07 AM: "sure”
- Erika_XP💚 4:08 AM: "I dont often share these when I have them because I always assume he must be hiding them for a reason”
- Erika_XP💚 4:08 AM: "Or that regiminis or one of his friends might have placed a curse of some kind on it for all I know”
- Erika_XP💚 4:08 AM: "https://www.youtube.com/watch?v=x8up-ngPKZw”
- Erika_XP💚 4:08 AM: "Some people got to see this one but I bet you did not”
- Erika_XP💚 4:08 AM: "It was pretty spooky ^^”
- ADULT_LINK 4:10 AM: "oh yeah i remember that one”
- ADULT_LINK 4:10 AM: "i liked a few of the comments on that, so i know i've seen it before”
- Erika_XP💚 4:11 AM: "Alright I was just playing around on that one.”
- Erika_XP💚 4:11 AM: "https://www.youtube.com/watch?v=I9qHHiBTq0U”
- Erika_XP💚 4:11 AM: "This one is a bit more secret I think based on the numbers”
- Erika_XP💚 4:11 AM: "I bet you never saw this!”
- ADULT_LINK 4:13 AM: "hmm”
- ADULT_LINK 4:13 AM: "not sure if i remember this one, but i know at the very least the group has seen it, theres a translation of the ciphers by our youtube channel in the comments”
- Erika_XP💚 4:16 AM: "I know I must have something you all do not”
- Erika_XP💚 4:16 AM: "I thought I was just some weird girl who really likes Tyler
- but I guess I should have expected there to be people out there who know what the important things are in life”
- Erika_XP💚 4:16 AM: "Alright I feel weird about sharing this one because it kind of spooks me a bit”
- Erika_XP💚 4:16 AM: "but I just want to make sure its as secret as I kind of thought it was”
- Erika_XP💚 4:16 AM: "https://www.youtube.com/watch?v=rAZW2Co15Bk”
- ADULT_LINK 4:21 AM: "oh my god is that one of the old roblox videos”
- ADULT_LINK 4:21 AM: "haha nice i almost forgot about those”
- Erika_XP💚 4:21 AM: "Roblox?”
- ADULT_LINK 4:21 AM: "yeah, the thing in the video is a roblox map with a lot of filters on it”
- Erika_XP💚 4:23 AM: "Oh I just was not sure what roblox was at first”
- Erika_XP💚 4:23 AM: "Please see through this. He always does this kind of thing to throw everyone off. It happened once before back in april 2012. There is always Methods to the madness. This is one of the only times I think I of the 3 will be able to speak without my symbols the way I had to set them up. Please stay alert.”
- Erika_XP💚 4:23 AM: "He said this to someone in a comment”
- Erika_XP💚 4:23 AM: "But I cant be sure what it means or if it is him for real”
- ADULT_LINK 4:26 AM: "huh.”
- ADULT_LINK 4:26 AM: "i wonder if some of those old videos have any relevance to the ||||| stuff”
- ADULT_LINK 4:26 AM: "wait that was from a few months ago”
- ADULT_LINK 4:26 AM: "god july feels like ages ago, i dont remember what was going on in the arg back then at al lmao”
- Erika_XP💚 4:33 AM: "Oh darn I was going to get one he had unlisted from a really really long time ago but now its set to private. I am sure I have it downloaded somewhere but Im out on my laptop right now.”
- Erika_XP💚 4:33 AM: "oooo”
- Erika_XP💚 4:33 AM: "I have one thing I could share”
- Erika_XP💚 4:33 AM: ">.>”
- Erika_XP💚 4:33 AM: "<.<”
- Erika_XP💚 4:33 AM: "but this is special to me”
- ADULT_LINK 4:36 AM: "i've got a few unlisted vids bookmarked from when ooc tyler was really into monika from ddlc”
- Erika_XP💚 4:37 AM: "If I show this video I will have to delete it afterwards because I want to keep it kind of secret and special in my heart for a little while longer”
- ADULT_LINK 4:38 AM: "ooh?”
- Erika_XP💚 4:38 AM: "ok I am nervous”
- Erika_XP💚 4:38 AM: "But also sad because he turned the chat off so you cant see what was said”
- Erika_XP💚 4:38 AM: "But also relieved because I think I would die if anyone saw what I said”
- Erika_XP💚 4:38 AM: "Ok Ill post it for a moment”
- ADULT_LINK 4:41 AM: "oh dude i remember that fuckin stream”
- ADULT_LINK 4:41 AM: "i complimented his shirt”
- ADULT_LINK 4:41 AM: "or, at the very least one of the other streams from that day”
- ADULT_LINK 4:41 AM: "i think there were a few tests?”
- Erika_XP💚 4:42 AM: "I jumped in and I think he was testing out how to make it work and then I THINK HE MIGHT HAVE BEEN TALKING TO ME WHEN I CAME IN AND STARTED TALKING IN THE CHAT”
- Erika_XP💚 4:42 AM: "AAASASDFDASFASDFA”
- ADULT_LINK 4:43 AM: "nice :thumb:”
- Erika_XP💚 4:44 AM: "I love his voice so much I bet when he sings in private it sounds gorgeous.”
- Erika_XP💚 4:44 AM: "Or atleast I imagine he sings in private”
- Scrublord 6:03 AM: "I know this is late but”
- Scrublord 6:03 AM: "https://cdn.discordapp.com/attachments/317446131586170880/508079274398449666/68747470733a2f2f63646e2e646973636f72646170702e636f6d2f6174746163686d656e74732f3331373434363133313538.gif
- Erika_XP💚 6:21 AM: "@Scrublord hello there it was just me saying your name gave me a little giggle”
- Scrublord 6:21 AM: "Ok lol”
- Erika_XP💚 6:22 AM: "Are you a big fan of silentdork?”
- Erika_XP💚 6:22 AM: "More importantly @Scrublord have you ever spoken to tyler before? I think I kind of did once, not counting yesterday when I think he might have been possesed or something.”
- Scrublord 6:24 AM: "Well kind of yea”
- ADULT_LINK 6:25 AM: "the original title of this video from when i bookmarked it is "Sick ass remix for that nigga scrub"
- ADULT_LINK 6:25 AM: "https://www.youtube.com/watch?v=CAZl4NAcDNg”
- ADULT_LINK 6:25 AM: "so”
- ADULT_LINK 6:25 AM: "lmao”
- Scrublord 6:26 AM: "XD”
- Erika_XP💚 6:26 AM: "Oh wow Tyler is friends with you?!”
- Scrublord 6:26 AM: "Well yes”
- Erika_XP💚 6:26 AM: "You are basically famous in my eyes”
- Scrublord 6:27 AM: "Epic lol”
- Scrublord 6:27 AM: "OMG THAT VID”
- Scrublord 6:27 AM: "XD”
- Scrublord 6:27 AM: "I just remembered XD”
- Scrublord 6:27 AM: "Wait did he made it lore lol?”
- ADULT_LINK 6:27 AM: "honestly this is still my fav pic of tyler”
- ADULT_LINK 6:27 AM: "nah i dont think that video is canon at all, i just bookmarked it cuz i figured it'd be funny in the far future”
- ADULT_LINK 6:27 AM: "guess i was sorta right?”
- Erika_XP💚 6:29 AM: "He is such a cutie >//>;”
- Scrublord 6:29 AM: "It definitely is lmao”
- Scrublord 6:29 AM: "Anyways you seemed like a huge fan @Erika_XP💚 “
- Scrublord 6:29 AM: "Idk if you already saw it but here's a JID related thing I made 2 years ago”
- Scrublord 6:29 AM: "https://www.youtube.com/watch?v=f9AHUEbigHM”
- Erika_XP💚 6:33 AM: "@Scrublord I just laughed so hard I think I woke people up”
- Scrublord 6:34 AM: "lmao”
- Erika_XP💚 6:40 AM: "Sorry if I am bothering you a lot but what was the last thing Tyler said to you @Scrublord ? Was he Angry like he was here yesterday?”
- Erika_XP💚 6:40 AM: "I am trying to decide if he is possesed or something”
- Scrublord 6:41 AM: "I haven't talked to him for a while now”
- Scrublord 6:41 AM: "But I think he is”
- Scrublord 6:41 AM: "Usually he's chill af”
- Erika_XP💚 6:41 AM: "How was he last time he spoke to you?”
- Scrublord 6:41 AM: "Well this is the last thing he said”
- Scrublord 6:41 AM: "Oh shit i---------------------------------------------------------------------------------------------------------”
- Erika_XP💚 6:42 AM: "wat”
- Scrublord 6:42 AM: "He was about to tell me a secret code to rekt Kevin or some shit”
- Erika_XP💚 6:42 AM: "WAIT WHAT!?”
- Erika_XP💚 6:42 AM: "I NEED TO KNOW WHAT HE SAID WORD FOR WORD”
- Scrublord 6:43 AM: "But then he's just gone”
- Scrublord 6:43 AM: "This is a few months ago but here's what he said”
- Scrublord 6:43 AM: "in telling you this you have learned something that will truly be one of the final puzzles to all of this”
- Scrublord 6:43 AM: "I used to straight up log in and tell these people I loved them on a semi daily basis”
- Scrublord 6:43 AM: "this bond and the ones that extend across all of the spans of hubris and without it”
- Scrublord 6:43 AM: "will call the magic that can break this curse”
- Scrublord 6:43 AM: "that much I know”
- Scrublord 6:43 AM: "We are nearing the end of a decade”
- Scrublord 6:43 AM: "a decade plagued by a darkness we have had a great joy in fighting
- Scrublord 6:43 AM: "it will come to an end and we will enjoy again a golden time”
- Scrublord 6:43 AM: "this secret I have told you”
- Scrublord 6:43 AM: "carry it with you my compatriot, I feel you will know in your heart when is the right time to reveal it to them if you follow this journey”
- Scrublord 6:43 AM: "should you so desire”
- Scrublord 6:43 AM: "most importantly of all”
- Scrublord 6:43 AM: "nigga I am about to tell yo ass the secret code to fucking reck kevins shit because no one figured it out”
- Scrublord 6:43 AM: "all these fucking years”
- Scrublord 6:43 AM: "and oh my fucking god I am still dying that no one ever came close to stumbling onto this after like 6 fucking years”
- Scrublord 6:43 AM: "Oh shit i---------------------------------------------------------------------------------------------------------”
- Erika_XP💚 6:45 AM: "ARE YOU ACTUALLY SERIOUS RIGHT NOW!?”
- Scrublord 6:45 AM: "Yes”
- Scrublord 6:45 AM: "But I haven't heard from him since”
- Erika_XP💚 6:46 AM: "@everyone”
- Erika_XP💚 6:46 AM: "wait oh god”
- Erika_XP💚 6:46 AM: "OH NO I DID NOT MEAN TO DO THAT”
- Erika_XP💚 6:46 AM: "I AM SO SORRY”
- Scrublord 6:46 AM: "But this was ages ago”
- Erika_XP💚 6:46 AM: "OH GOD OH GOD”
- Erika_XP💚 6:46 AM: "OH GOD”
- Scrublord 6:46 AM: "The message was from 08/09/2019”
- Erika_XP💚 6:47 AM: "IM SORRY FOR DOING THAT EVERYONE PING I WAS JUST REALLY EXCITED”
- Erika_XP💚 6:47 AM: "Oh”
- Erika_XP💚 6:47 AM: "I dont know why I was expecting a rush of anger to come forth”
- Scrublord 6:48 AM: "Well idk what I just said and idk if Lunar Children or Kevin or some shit might come after me now”
- Scrublord 6:48 AM: "Imma go load my Glock and go exercise now”
- Erika_XP💚 6:49 AM: "You sound like such a adventerous lad”
- Erika_XP💚 6:49 AM: "Surely no match for my Tyler though. I doubt you battle cults, but you must be a very cool person for him to consider you a friend and tell you something that amazing.”
- Erika_XP💚 6:49 AM: "I just realized I think the @ everyone feature just does not work”
- Erika_XP💚 6:49 AM: "I feel like people should know this”
- ADULT_LINK 6:52 AM: "the ping didnt actually go thru, not everyone has @everyone perms”
- ADULT_LINK 6:52 AM: "oh wait you just realised that”
- ADULT_LINK 6:52 AM: "shit i'm slow”
- Scrublord 6:53 AM: "Im normally just a shitposter but I joined the ID because I was working on a case of my own about my sister”
- Erika_XP💚 6:53 AM: "by this I do not mean @everyone I mean the thing scrub just told me Tyler said”
- Erika_XP💚 6:53 AM: "Oh no what happened to your sister”
- Erika_XP💚 6:53 AM: "is she faring well?”
- Scrublord 6:54 AM: "She just posted some weird codes on Twitter and I asked the ID to help me crack the code”
- Scrublord 6:54 AM: "Don't worry it isn't related to JID”
- Erika_XP💚 7:04 AM: "Well I'll still worry for you because I assume tyler must care about you too”
- Erika_XP💚 7:04 AM: "@Upd8”
- Erika_XP💚 7:04 AM: "through process of elimination I think I worked out a logic in my head that explains this must be what is here in place of @everyone”
- Erika_XP💚 7:04 AM: "this scrublord man is very important and Tyler was trying to tell him how to beat Kevin who I always had a feeling was really regiminis”
- Scrublord 7:11 AM: "Well he really do, and vice versa for me”
- Erika_XP💚 7:20 AM: "@Scrublord I have to get to bed its getting kind of late. But I am glad I got to speak to you and learn what I did.”
- Erika_XP💚 7:20 AM: "I hope I get to talk to you again soon”
- Erika_XP💚 7:20 AM: "doctor: you have 2 seconds to live”
- Erika_XP💚 7:20 AM: "Me:”
- Erika_XP💚 7:20 AM: "https://www.youtube.com/watch?v=tkYAdJHN5X4&feature=youtu.be”
- Erika_XP💚 7:20 AM: "plays this video twice”
- Erika_XP💚 7:20 AM: "sorry I just wanted to be goofy for a moment”
- Xenquility 8:27 AM: "Why the hell was upd8 @'d””
- Densgivin 8:27 AM: "Lol”
- Densgivin 8:27 AM: "Also mornin pals”
- Densgivin 8:27 AM: "How r u xen”
- Xenquility 8:27 AM: "Top o the mornin to ya”
- Xenquility 8:27 AM: "Not bad. You?”
- Densgivin 8:27 AM: "Fine”
- Densgivin 8:27 AM: "I just had breakfast and goin back to sleep”
- Xenquility 8:28 AM: "lmao”
- Erika_XP💚 8:42 AM: "@Xenquility I am unable to sleep and I will tell you it was because I had a powerful revalation regarding Tylers situation”
- Erika_XP💚 8:42 AM: "@Scrublord can tell you more”
- Xenquility 8:43 AM: "What uh... "Revelation" did you have?”
- Erika_XP💚 8:43 AM: "in telling you this you have learned something that will truly be one of the final puzzles to all of this”
- Erika_XP💚 8:43 AM: "I used to straight up log in and tell these people I loved them on a semi daily basis”
- Erika_XP💚 8:43 AM: "this bond and the ones that extend across all of the spans of hubris and without it”
- Erika_XP💚 8:43 AM: "will call the magic that can break this curse”
- Erika_XP💚 8:43 AM: "that much I know”
- Erika_XP💚 8:43 AM: "We are nearing the end of a decade”
- Erika_XP💚 8:43 AM: "a decade plagued by a darkness we have had a great joy in fighting”
- Erika_XP💚 8:43 AM: "it will come to an end and we will enjoy again a golden time”
- Erika_XP💚 8:43 AM: "this secret I have told you”
- Erika_XP💚 8:43 AM: "carry it with you my compatriot, I feel you will know in your heart when is the right time to reveal it to them if you follow this journey”
- Erika_XP💚 8:43 AM: "should you so desire”
- Erika_XP💚 8:43 AM: "most importantly of all”
- Erika_XP💚 8:43 AM: "nigga I am about to tell yo ass the secret code to fucking reck kevins shit because no one figured it out”
- Erika_XP💚 8:43 AM: "all these fucking years”
- Erika_XP💚 8:43 AM: "and oh my fucking god I am still dying that no one ever came close to stumbling onto this after like 6 fucking years”
- Erika_XP💚 8:43 AM: "Oh shit i---------------------------------------------------------------------------------------------------------”
- Erika_XP💚 8:43 AM: "I am to be made to understand Tyler said this”
- Xenquility 8:44 AM: "Yeah that happened months back”
- Xenquility 8:44 AM: "iirc”
- Densgivin 8:44 AM: "nig”
- Erika_XP💚 8:45 AM: "Yes thats what he said but This is news to me”
(...)
- Erika_XP💚: "Ew”
- ARGdov: "shit are we talking about illustrations of people we wanna fuck”
- Wolfcat: ""people"”
- Wolfcat: "but yes”
- /Mr. Circle\: "haha wolf wants to fuck something that isn't a person”
- steve solothies: "Hello”
- steve solothies: "my fall over”
- Wolfcat: "not you steve”
- Wolfcat: "what fell over”
- steve solothies: "myself”
- Wolfcat: "oh damn”
- Xenquility: "Why'd he leave lmao”
- Wolfcat: "he fucking died“
- Xenquility: "Sucks to be him”
- Erika_XP💚: "What an odd lad”
- Xenquility: "Excuse me he identifies as a woman”
- Wolfcat: "ok now you are LITERALLY assuming his gender”
- Wolfcat: "shit i did too”
- DensO Burton: "Hey”
- Erika_XP💚: "<a href="https://cdn.discordapp.com/attachments/453310624076922899/643286223200452618/oh_no.JPG">https://cdn.discordapp.com/attachments/453310624076922899/643286223200452618/oh_no.JPG</a>”
- Wolfcat: "is that u”
- Xenquility: "Excuse mr”
- Xenquility: "I LATERALLY assumed it”
- DensO Burton: "Lol”
- Xenquility: "Not literally”
- Erika_XP💚: "lol no I just wanted to post this face I found because I thought it was silly”
- Wolfcat: ">mr”
- yoshi: "wat”
- Wolfcat: "at it again”
- Xenquility: "*me”
- Erika_XP💚: "https://www.youtube.com/watch?v=U31mUOYTL3U”
- Erika_XP💚: "https://youtu.be/U31mUOYTL3U?t=158”
- DensO Burton: "Oh god no”
- Erika_XP💚: "right here actually”
- Wolfcat: "god i used to make this same exact shit as a kid”
- Wolfcat: "literally just making faces in front of the camera”
- Erika_XP💚: "I found this serching for silent dork lol”
- DensO Burton: "That's literally a SILENT doRK”
- Wolfcat: "cool”
- DensO Burton: "Oh god”
- yoshi: ":HyperParty:”
- Erika_XP💚: "Hello there yoshi”
- DensO Burton: "SPIT OUT THE BONE”
- DensO Burton: "headbangs”
- Erika_XP💚: "I bet no one in here is as big a fan of silentdork as me”
- Deadhead: "Sure lol”
- Erika_XP💚: "Is that a challenge?”
11/11/19 - Chat with Erika
- Erika_XP💚: "Oh my lord I am so sleepy”
- Slinky Stinks△: "Dudes”
- Slinky Stinks△: "I can't stay up untyl 11/11”
- Slinky Stinks△: "I'm too sleepy”
- Xenquility: "Dude
- Xenquility: "sleep now and wake up later”
- Xenquility: "If you're gonna sleep do it early”
- Xenquility: "Cause it's only 4:30 est
- Erika_XP💚: "I was supposed to sleep a while ago but I cant actually bring myself to sleep I am so excited and worried”
- Xenquility: "Probably a good while till jid starts”
- Slinky Stinks△: "B r u h”
- Slinky Stinks△: "I gotta go 2 school”
- Xenquility: "o”
- Slinky Stinks△: "I can just stay up and drink redbull tho”
- Slinky Stinks△: "That was my summer plans for two weeks”
- The Sun: "All who get cancer from my radiance weren't born to bear the gifts I give unto them. :ArmLeft: :dawn: :ArmRight:”
- Erika_XP💚: "Those things are rubbish”
- Erika_XP💚: "poison really”
- Slinky Stinks△: "I'm so brave, I sunbath WITHOUT CREAM”
- Slinky Stinks△: "brUH”
- The Sun: "Wtf is an erika”
- Slinky Stinks△: "THAT COMEBACK WAS”
- Slinky Stinks△: "LMAO XEN UR DED”
- Slinky Stinks△: "SHE KILLED U”
- Xenquility: "She uh”
- Xenquility: "said”
- Erika_XP💚: "Im sorry are you ok”
- Xenquility: "ur mum”
- Xenquility: "If that's a comeback I'm jumping off a roof”
- Xenquility: "Why am I doing this anyways”
- Xenquility: "What's life anymore”
- Slinky Stinks△: "Shut up xen ur ded”
- Slinky Stinks△: "She got chu”
- Erika_XP💚: "I did not know my own strength on that one I feared I shattered you”
- Erika_XP💚: "OH GOD THIS IMAGE DISTURBS ME FOR SOME REASON”
- Slinky Stinks△: "Well then prepare for the day your skeleton gets freedom”
- Slinky Stinks△: "It is uncomfortable inside a meat vessel”
- Erika_XP💚: "I have delt with scarier”
- Erika_XP💚: "I once watched the regiminis video but at 11:11 at night alone outside on my laptop”
- Xenquility: "ok you do not exist”
- Xenquility: "you are not real”
(...)
- Erika_XP💚: "I think I passed out for a moment but I think may have just woken up in time to make sure Tyler is ok”
- Erika_XP💚: "@IIIII Tyler I am sure you are busy and can't see this but GOOD LUCK I have been saying prayers for you this whole day”
- ADULT_LINK△: "just a uh”
- ADULT_LINK△: "suggestion”
- IIIII: "Jesus h christ fuck off”
- ADULT_LINK△: "people tend to get annoyed when ya ping em needlessly”
- Erika_XP💚: "I just wanted to make sure you were ok I am sorry”
- Eevee Reborn: "Erika has severe stokholm syndrome”
- Erika_XP💚: "Would you kindly sod off”
- DensO Burton: "Oh god”
- Ross the Claus 🎄: ":0”
- Eevee Reborn: "Erika: exists”
- Eevee Reborn: "Tyler: rabid foaming mad demon”
- Xenquility: "It's like watching a disaster in slow motion”
- DensO Burton: "Ok erika how do u imagine tyler's d”
- DensO Burton: "Sorry”
- Erika_XP💚: "I beg your pardon?”
- DensO Burton: "Just a joke”
- Erika_XP💚: "Sorry I am really socially awkward ^^;”
- DensO Burton: "Don't worry it wss a BAD joke”
- /Mr. Circle\: "i'm ashamed of the voice i read erika's messages in after "sod off"”
- DensO Burton: "Lol”
- /Mr. Circle\: "soteetos”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:56 PM: “ᴛʜᴀᴛ sᴇᴇᴍᴇᴅ ʟɪᴋᴇ ᴀ ʀᴜᴅᴇ ᴡᴀʏ ᴛᴏ ᴅᴏ ᴛʜᴀᴛ.”
- otherLiam 10:57 PM: "I’m surprised you joined us in here. Not worried about our chats being monitored?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 10:58 PM: "sᴇᴇᴍs ᴘᴏɪɴᴛʟᴇss ɴᴏᴡ.”
- Densgivin 10:58 PM: "Hey”
- Ross the Claus 🎄 10:58 PM: "hey ghost”
- Xenquility 10:58 PM: "Nice role….”
- otherLiam 10:59 PM: "Anything interesting going on?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:00 PM: "ɪᴛ ʜᴀs ʙᴇᴇɴ ᴀ ᴡʜɪʟᴇ, ɪ ᴀssᴜᴍᴇᴅ ɪᴛ ᴡᴀs ᴛɪᴍᴇ ᴛᴏ ᴅʀᴏᴘ ɪɴ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:00 PM: "ɪs ᴛʜᴇ ʀᴏʟᴇ ᴄᴏʟᴏʀ ɪᴍᴘʀᴏᴘᴇʀ, xᴇɴ?”
- Xenquility 11:00 PM: "Just the name”
- Xenquility 11:00 PM: "Mainly the /”
- Xenquility 11:00 PM: "and the \”
- Xenquility 11:00 PM: "Anyways, seems more than coincidental the "Time to drop in” is 11/11”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: “ɪ'ʟʟ ᴄʜᴀɴɢᴇ ɪᴛ ᴛʜᴇɴ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:02 PM: "ᴀʀᴇ ʏᴏᴜ sᴀᴛɪsꜰɪᴇᴅ?”
- Xenquility 11:03 PM: "Very”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:04 PM: "ɪ'ᴍ ɢʟᴀᴅ ᴛᴏ ᴋɴᴏᴡ ʏᴏᴜ ᴀʟʟ ʀᴇᴄᴇɪᴠᴇᴅ ᴍʏ ɢɪꜰᴛ.”
- Xenquility 11:05 PM: "Im dumb”
- Xenquility 11:05 PM: "no surprise there”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:05 PM: "ɪ ᴛʜᴏᴜɢʜᴛ ᴍʏ ᴛʀᴀᴅᴇᴍᴀʀᴋ ꜰᴏɴᴛ ʟᴇᴛ ʏᴏᴜ ɪɴ.”
- Xenquility 11:06 PM: "Yeah I got it now”
- Xenquility 11:06 PM: "My brain likes to act before I think”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:06 PM: "ɪ ɢᴇᴛ ᴛʜᴇ ꜰᴇᴇʟɪɴɢ ᴘᴇᴏᴘʟᴇ ᴀʀᴇ ᴅɪsᴄᴜssɪɴɢ ɪɴ ʏᴇᴛ ᴀɴᴏᴛʜᴇʀ sᴇᴄʀᴇᴛɪᴠᴇ ᴄʜᴀᴛ ᴀʙᴏᴜᴛ ᴍʏ ᴘʀᴇsᴇɴᴄᴇ ʜᴇʀᴇ ʙᴀsᴇᴅ ᴏɴ ʏᴏᴜʀ ᴇᴅɪᴛᴇᴅ ᴛᴇxᴛ.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:06 PM: "ᴘᴇʀʜᴀᴘs ᴛʜᴀᴛ ɪs ᴍʏ ᴏᴡɴ ᴜɴsᴀᴛɪsꜰᴀᴄᴛᴏʀʏ ᴘᴀʀᴀɴᴏɪᴀ ʜᴏᴡᴇᴠᴇʀ.”
- Xenquility 11:07 PM: "No, my original text was me snarkily saying "What gift?” before I realised it was the video”
- Xenquility 11:07 PM: “I’m surprised there aren’t as many people here right now”
- Xenquility 11:07 PM: ”(Everyone here raise your hand)”
- Ross the Claus 🎄 11:09 PM: “:raised_back_of_hand:”
- Xenquility 11:09 PM: "Liam was here but has disappeared in the past two minutes or so”
- Eevee Reborn 11:10 PM: "Hand”
- Xenquility 11:11 PM: "Hey Ghosty, just to confirm, what day and year is it for you?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:11 PM: "11/11 2019”
- Xenquility 11:11 PM: "Good”
- Xenquility 11:11 PM: "Should we be doing anything to help those in the past?”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:12 PM: "ɪᴛ’s ᴀʟsᴏ 11:11”
- Erika_XP💚 11:12 PM: ”@IIIII This is the pivitol moment I always assume. TYLER LET US KNOW IF YOU ARE OK”
- Ross the Claus 🎄 11:12 PM: “fucking stop”
- IIIII 11:13 PM: "not only is it 11:12 but you are single handedly the most annoying little fuck to ever grace this group”
- Erika_XP💚 11:13 PM: "Im just glad to know you are ok”
- IIIII 11:13 PM: "NO NO I AM NOT OK ACTUALLY”
- otherLiam 11:14 PM: "this has now crossed over into obvious trolling”
- IIIII 11:14 PM: "were yuo expecting a fucking video?”
- Xenquility 11:14 PM: "Can we just ban them at this point”
- IIIII 11:14 PM: ”@Erika_XP💚”
- IIIII 11:14 PM: “@Erika_XP💚”
- IIIII 11:14 PM: ”@Erika_XP💚”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:15 PM: “ᴛᴏᴜᴄʜʏ.”
- IIIII 11:16 PM: "Fucking a yuo dumb bitch dont worry there will be a video tonight its just going to be late now because I had to sit here and call you an annoying cunt for distracting me”
- ADULT_LINK 11:18 PM: "oof”
- Erika_XP💚 11:18 PM: ”@ɢʜᴏsᴛʙᴀʙᴇʟ I dont think he is usually like this I think he is just having a bad time considering the day. I will harden myself as well!”
- ADULT_LINK 11:19 PM: “snrk”
- Erika_XP💚 11:19 PM: "what is this short for?”
- otherLiam 11:21 PM: "Assuming you aren’t trolling because I’m bored, it’s not short for anything. It’s the sound of someone holding in a laugh.”
- ARGdov 11:23 PM: "oh shit I missed soem shit”
- otherLiam 11:23 PM: "not much”
- otherLiam 11:23 PM: "mostly just ghostbabel joined”
- otherLiam 11:23 PM: "and tyler yelled at erika for being annoying”
- ARGdov 11:23 PM: "well I also see someone got chewed out lol”
- ARGdov 11:23 PM: "astounding”
- QuoteBOT 11:26 PM: "Ok erika how do u imagine tyler’s d”
- ARGdov 11:26 PM: "ive heard its quite a lot for most to manage tbh”
- ARGdov 11:26 PM: "so Im wondering too”
- Erika_XP💚 11:27 PM: "Ok I get that I am annoying, I remind myself of this often. But I see no reason for all the awful aggression. I only excuse it because of who we are talking about here and considering the situation.”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:27 PM: "ɪ sᴇᴇ ɪ ᴀᴍ ɴᴏᴛ ɴᴇᴇᴅᴇᴅ.”
- Eevee Reborn 11:27 PM: "The fuck”
- Xenquility 11:27 PM: "Actually you are needed”
- ARGdov 11:27 PM: "nope”
- Xenquility 11:27 PM: "We always need you”
- IIIII 11:27 PM: "You were literally never needed”
- ADULT_LINK 11:27 PM: "hi ghost”
- ARGdov 11:27 PM: "as usual we are capable of tearing ourselves apart on our own”
- ADULT_LINK 11:27 PM: "howsit goin”
- otherLiam 11:27 PM: "okay hang on what is happening here”
- IIIII 11:27 PM: "can you stop fucking larping”
- ARGdov 11:28 PM: "Im lost”
- ARGdov 11:28 PM: "if tylers fucking ooc why is ghost not ooc”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ᴄᴀɴ ʏᴏᴜ?”
- otherLiam 11:28 PM: "That’s what I’m wondering”
- Eevee Reborn 11:28 PM: "This went from trial of fire to full on…. dammnit, Dov’s watching”
- ADULT_LINK 11:28 PM: "oof”
- ARGdov 11:28 PM: "lol what did I do now”
- ɢʜᴏsᴛʙᴀʙᴇʟ 11:28 PM: "ɪ ᴅᴏɴ'ᴛ ʀᴇᴀʟʟʏ ɴᴇᴇᴅ ᴛʜɪs, ᴀɴʏᴡᴀʏ, ᴀᴅɪᴇᴜ.”
- IIIII: "Oh trust me I would fucking love to dumbass”
- otherLiam: "Is this ooc?”
- ARGdov: "night, ghost”
- Eevee Reborn: "Oof”
- ARGdov: ".....if it is Im confused.”
- otherLiam: "I can’t even fucking tell anymore.”
- ARGdov: "but also if I start asking Tyler questions I feel like it'll annoy him more lol”
- Erika_XP💚: "what does ooc mean?”
- ARGdov: "out of character”
- ADULT_LINK△: ":eye::eye:”
- Eevee Reborn: "I'll ask him a question”
- IIIII: "@Erika_XP💚 it means none of this is real and you are a stupid cunt brb”
- ARGdov: "gosh”
- otherLiam: "ok so he is ooc”
- otherLiam: "but is talking to characters”
- ARGdov: "weird”
- ARGdov: "still dunno what you mean by this xD”
- otherLiam: "by the way eevee, it’s become clear this is a troll”
- Eevee Reborn: "You guys are brutal”
- ARGdov: "this is certainly a new form of trolling tbh”
- ARGdov: "acting like a fangirl who wants sempai to notice her”
- ARGdov: "this is forwarding the field of trolling quite a bit, it used to be you barged in and called people slurs and made them mad”
- Eevee Reborn: "Quick, let's play bolero of fire so Erikas epic trial of fire has a soundtrack”
- ARGdov: "this is much more subtle”
- ARGdov: "much more sinister”
- otherLiam: "where’ve you been, trolling has advanced quite a bit”
- ARGdov: "much more traditionally feminine”
- ARGdov: "she deserves an award”
- otherLiam: "i’m gonna laugh when it turns out this is just wolfcat on another screen”
- Erika_XP💚: "I dont know where this "trolling" idea comes from”
- Xenquility: "Honestly the wolf idea has come to my head a few times”
- Eevee Reborn: "Feminine troll”
- ARGdov: "@Erika_XP💚 I present to you this honorary doctrate in trolling”
- ARGdov: "oh my gosh”
- Xenquility: "fuckdsf”
- ARGdov: "this being Wolf”
- ARGdov: "that makes a lot of sense”
- ARGdov: "but also like”
- ARGdov: "I dunno if he'd do that”
- ARGdov: "after he got in trouble for gamejacking”
- Xenquility: "They did just freak out after being accused of being wolf”
- otherLiam: "he totally would”
- ARGdov: "they did yes”
- ARGdov: "which makes me wonder if they are”
- Xenquility: "Also wolf has never been online with her”
- Xenquility: "Or interacted with her”
- ARGdov: "shit yeah”
- otherLiam: "lmao”
- otherLiam: "good bit wolf”
- ARGdov: "@Wolfcat WHERE ARE YOU”
- otherLiam: "10/10”
- ADULT_LINK△: "what iff....”
- ARGdov: "you got us all lol”
- ADULT_LINK△: "this is ALl canon”
- otherLiam: "that’s a good fuckin bit”
- ADULT_LINK△: "im :high:”
- ADULT_LINK△: "fuck”
- ARGdov: "thorin”
- ARGdov: "you're always high”
- ARGdov: "and you've lost track of the story”
- ADULT_LINK△: ":eye:”
- ADULT_LINK△: ":eyes:”
- otherLiam: "we’ve all lost track of the fuckin story”
- mfgreth: ":thinking:”
- ARGdov: "@Erika_XP💚 because you're wolf we're revoking your honorary doctrate”
- Eevee Reborn: "Quick Dov, we need your wise ideas. Ideas that have NEVER lead us astray.”
- otherLiam: “greth pls help”
- ARGdov: "yes, listen to me”
- ARGdov: "clearly I have always made the right decision in this ARG”
- Xenquility: "We need to post a screenshot of the future to the past”
- Xenquility: "bomb plans 8.9”
- otherLiam: "brilliant”
- otherLiam: "then we play the oath to order and summon all the giants”
- Eevee Reborn: "We look Dov. Our overlord”
- Xenquility: "Then song of storms 10 hours which we never turn off”
- otherLiam: "but then we use the giant mask to make them bigger”
- Xenquility: "then .root”
- otherLiam: "then we >c_connect johnisdead.com”
- Erika_XP💚: "who is wolf?”
- ARGdov: "uh no we dont need to use the giant mask to mkae them bigger”
- ARGdov: "https://www.youtube.com/watch?v=BWbkxaTU1Z0”
- ARGdov: "we'll just use the rita repulsa method”
- otherLiam: "damn u rite”
- mfgreth: "You wan erika banned???”
- Xenquility: "yes”
- Xenquility: "please god”
- otherLiam: "prolly a good idea”
- otherLiam: "before tyler’s head explodes”
- Xenquility: "holy shit the tags on the pumpkinpology video say "erika"”
- Xenquility: "no jk”
- otherLiam: "...holy shit there’s no way.”
- Xenquility: "no”
- Xenquility: "I'm kidding”
- ARGdov: "ahahahhaha”
- otherLiam: "fuck off”
- otherLiam: "dont do that to a man when he’s already hurtin”
- ARGdov: "in any case I need a magic wand to go make whatever the fuck grow”
- Eevee Reborn: "Penor”
- Erika_XP💚: "Why should I be getting banned???”
- ARGdov: "because you're Wolfcat”
- otherLiam: "because you’re either a troll, wolfcat, or way too young to play this game.”
- mfgreth: "Im not gonna ban erika”
- mfgreth: "I dont see a reason tbh”
- ARGdov: "or alternaively because you are a naive nusiance and for once we're gonna nip a problem in the bud before it gets too large”
- Eevee Reborn: "And being wolfcat is NOT a victimless crime”
- Xenquility: "(They might not actually be wolfcat lmao)”
- otherLiam: "I mean she literally poked tyler until he was forced to drop character
- with weird fan worship”
- ARGdov: "see the one thing is about her being wolfcat Im not sure about is”
- ARGdov: "Tyler was super pissed at him literally yesterday”
- ARGdov: "why would Wolf decide to try and troll him”
- otherLiam: "im mostly memeing, i doubt it’s wolf”
- Erika_XP💚: "Maybe you are naive actually, just last night I was linking one of you a video none of you had technically ever seen and now you are acting like this”
- ARGdov: "Im pretty sure we had seen that video actualy”
- otherLiam: "wat”
- ARGdov: "just because it ws unlisted doesnt make you special”
- Eevee Reborn: "Wolfcat likes to start drama. Big drama starter always. Yup”
- ARGdov: "actually Im next to POSITIVE we have”
- otherLiam: "What video was it?”
- Xenquility: "Yknow if this is a troll they've succeeded”
- Xenquility: "We're all fighting over nothing on 11/11”
- otherLiam: "I mean, nothing’s happened yet.”
- otherLiam: "Other than the Greths poking us”
- Xenquility: "If they aren't getting banned we can't do anything about it”
- otherLiam: "and GB joining”
- mfgreth: "I can protect erika with communism”
- otherLiam: "people cant even protect their own families with communism”
- ARGdov: "this was the video”
- Xenquility: "Yeah we've seen that”
- ARGdov: "Im aware”
- ARGdov: "Erika claimed she was the first person to find it”
- Xenquility: "It's been on the ID channel for months”
- ARGdov: "my point is literally just that she was wrong”
- otherLiam: "Not only have we seen that”
- otherLiam: "we’ve also solved the ciphers on it”
- ARGdov: "yup”
- mfgreth: "Rood”
- ARGdov: "look, if shes not Wolf, then idk what her deal is”
- ARGdov: "because she clearly knows to some extent that this isnt real. earlier yesterday she asked if the issue was "gm stuff"”
- otherLiam: "listen slinky’s a kid, but at least he just endearingly screws up instead of weirdly worshipping Tyler.”
- Xenquility: "I think we should just drop the issue for now. We're not going to be reaching a resolution anytime soon and to be fair, if this is a really young kid, we've kinda just mobbed on her like a lynch mob”
- otherLiam: "this is clearly a plant from the lunar children”
- ADULT_LINK△: "i bet yall bitches never seen THIS video”
- otherLiam: "if you post rickroll”
- ARGdov: "or its Raven”
- ARGdov: "or Suxx”
- ARGdov: "honestly I would buy it being Raven”
- ARGdov: "...”
- ADULT_LINK△: "and now nobody else gets to see the video”
- ARGdov: "Im not sure if we have seen this”
- ARGdov: "Ive opened it”
- Xenquility: "oh my gid”
- Xenquility: "I love this”
- ARGdov: "oh my gosh”
- ARGdov: "its a monica vid”
- ADULT_LINK△: ":hylotl_eyes:”
- ARGdov: "of course”
- otherLiam: "tfw you will never have tyler because his heart belongs to monika sempai”
- Xenquility: "Some say video 2 only appears once a year”
- otherLiam: "just monika”
- ARGdov: "always”
- ARGdov: "just monika”
- ARGdov: "only monika”
- otherLiam: "Just Monika”
- otherLiam: "Just Monika”
- otherLiam: "Just Monika”
- ARGdov: "smack Liam”
- ARGdov: "GET AHOLD OF YOURSELF MAN”
- otherLiam: "neck snaps at 90 degree angle”
- ARGdov: "OH SHIT”
- otherLiam: "runs at screen”
- ARGdov: "pulls out fairy in a bottle”
- ADULT_LINK△: ":honl:”
- ARGdov: "heals you”
- ADULT_LINK△: ":fairy:”
- otherLiam: "dov have you played this dumb game”
- Xenquility: "what the hell he gets a sledge hammer”
- ARGdov: "I have but I didnt finish it tbh”
- ARGdov: "but I know its deal”
- Xenquility: "this usb is indestructible”
- otherLiam: "takes too long to get going imo”
- otherLiam: "act 1 should be like, a day shorter”
- ARGdov: "eh, whatever”
- ARGdov: "its god shit either way”
- Xenquility: "LMAO I didn't see the "Game" part and I thought you were talking about the video”
- ADULT_LINK△: "im gonna keep smoking and open my f o u r t h e y e “
- ARGdov: "this reminds me”
- otherLiam: "no im talking about ddlc”
- otherLiam: "also man”
- ARGdov: "I should keep palying Dream Daddy”
- otherLiam: "it’s almost not 11/11 anymore on the ec”
- ARGdov: "but it was so wholesome it made me gag”
- ARGdov: "rip”
- ARGdov: "somethings coming”
- mfgreth: "Yeesh”
- Eevee Reborn: "Me :sweat_drops:”
- Eevee Reborn: "Now if anyone is going to obsessively fangirl over a hottie, jontron is it”
- otherLiam: "he got married”
- Eevee Reborn: "Jontron > Tyler”
- ARGdov: "what if I wanna fangirl over someone else”
- mfgreth: "Happy 11/12”
- ARGdov: "Lestat the Vampire > Jontron”
- ARGdov: "he can suck me any day”
- otherLiam: "but something’s”
- otherLiam: "changed”
- otherLiam: "Changed”
- otherLiam: "Changed”
- otherLiam: "CHANGED”
- mfgreth: "Lestat is a punk bitch”
- ARGdov: "or any night, I guess”
- ARGdov: "well yeah and thats why hes great”
- Eevee Reborn: "Lestat? But he's french.”
- ARGdov: "I can forgive him for that”
- Erika_XP💚: "11/11 is over @IIIII Tyler are you safe? I hope so”
- ADULT_LINK△: "oh goddamn it”
- otherLiam: "erika”
- otherLiam: "stop spamming tyler”
- Erika_XP💚: "Whatika?”
- Eevee Reborn: "Oof”
- ADULT_LINK△: "i had the song i wanted to hear earlier downloaded :dabeangery:”
- ARGdov: "no one likes getting that manys pings”
- Erika_XP💚: "Im not spamming him”
- ARGdov: "also”
- ARGdov: "NONE”
- otherLiam: "he’s been pretty clear he wants you to stop”
- ARGdov: "OF THIS”
- ADULT_LINK△: "quit pingin him”
- ARGdov: "IS REAL”
- ADULT_LINK△: "EVERYTHING”
- ADULT_LINK△: "IS”
- ARGdov: "SO STOP ACTING LIKE IT”
- ADULT_LINK△: "REAL”
- ARGdov: "Tylers not in character right now”
- ARGdov: "in fact, do you know whats happened to Tyler in-game?”
- Eevee Reborn: "Ben is real Dov, stop ruining the emersion”
- ARGdov: "Tyler was kidnapped”
- ARGdov: "and taken to another dimension”
- ARGdov: "and we dont know whats happened to him”
- IIIII: "I'll show you something real”
- ARGdov: "so before you spam, read the fucking wiki for starters”
- Xenquility: "LOL”
- Xenquility: "She's gone”
- IIIII: "Fucking stupid bitch”
- Eevee Reborn: "what happened”
- mfgreth: "What the heck”
- ARGdov: "what?”
- ARGdov: "no shes still here for me?”
- ADULT_LINK△: "why u so aggresive over the dum fangirl”
- ADULT_LINK△: "yeesh”
- otherLiam: "she’s a troll”
- ADULT_LINK△: "like i get she's annoying you but like”
- ARGdov: "dumb fangirls tend to do that topeople”
- ADULT_LINK△: "still, we didnt get this hostile towards raven”
- ARGdov: "um”
- ADULT_LINK△: "at least, not this quickly”
- ARGdov: "we sort of did? after awhile?”
- mfgreth: "Wow”
- mfgreth: "Tyler”
- ARGdov: "like I literally told her to fuck off”
- IIIII: "What”
- Eevee Reborn: "Is she kicked or something?”
- ARGdov: "granted I didnt call her a bitch but still”
- mfgreth: "Banned”
- ARGdov: "no shes still here, Im p sure”
- otherLiam: "man i tried to give her the benefit of the doubt but she really did kinda reach that point real fast”
- ARGdov: "@Erika_XP💚 testing”
- Eevee Reborn: "OOF”
- ADULT_LINK△: "she got kicked”
- ARGdov: "oh ok”
- ARGdov: "well”
- ARGdov: "we did try and explain to her multiple times she was acting inappropirately but she refused to listen”
- ARGdov: "so, even if we were pretty harsh on her overall the ban still seems deserved”
- otherLiam: "just constantly pinging tyler and asking him weird shit”
- ADULT_LINK△: "damn”
- Eevee Reborn: "Wow, Tyler. Wow”
- ADULT_LINK△: "fuckin brutal yall”
- mfgreth: "Thats fucked up imo”
- mfgreth: "I am not down with that”
- otherLiam: "she referred to him as “my Tyler”.”
- ARGdov: "and called him 'handsome'”
- mfgreth: "Shes probably 12”
- mfgreth: "Or 14”
- ARGdov: "wait no she didnt but she said something close to that”
- Eevee Reborn: "My tyler? Handsome? That BITCH”
- otherLiam: "slinky is 13”
- mfgreth: "What if she has some sort of spectrum disorder?”
- otherLiam: "he doesnt act like that”
- ADULT_LINK△: "she sounded older than 12/14”
- ARGdov: "I was an obnoxious needy 14 year old and I wasnt this bad”
- ARGdov: "you know”
- ARGdov: "she may have been on the spectrum”
- otherLiam: "what if she does? who cares? i hold people to the same standard of not being assholes.”
- Eevee Reborn: "No, you've gotten badder”
- ADULT_LINK△: "when i called her young she said something about who said she was young”
- mfgreth: "I feel like yall are gonna do the usual fucking thing start speculating i was erika trolling like you did wolf”
- mfgreth: "(Bs btw)”
- mfgreth: "But im not cool with that”
- mfgreth: "Im out.”
- otherLiam: "that was mostly a joke”
- ARGdov: "but even people on the spectrum can understand that when you're told "you should stop this" multiple times will usually stop”
- ADULT_LINK△: "whys everyone bein so fuckin hostile tho jesus”
- otherLiam: "wat”
- ARGdov: "oh I dont think shes you”
- ARGdov: "I mean”
- ADULT_LINK△: "shes not mugen, she's just some random chick whos a bit odd”
- Xenquility: "Wha-”
- Xenquility: "Holy fuck”
- ARGdov: "I dont think greths totally wrong tbh”
- ADULT_LINK△: "aaaand greth left”
- ARGdov: "Tyler got out of hand”
- ADULT_LINK△: "goddamn it you guys who the fuck gave everyone angery pills”
- ARGdov: "welp”
- ARGdov: "wait shit”
- /Mr. Circle\: "AAAAAAAAAAAAAAAAAAANGERYYYYYYYYYYYY”
- Xenquility: "Welp”
- ARGdov: "...oh ok right other people are mods”
- /Mr. Circle\: ":angery:”
- Xenquility: "If they're a troll, they sure as hell succeeded”
- /Mr. Circle\: "this emoji is massive??”
- ADULT_LINK△: "emoji's are bigger when alone!”
- ADULT_LINK△: ":notzelda:”
- ADULT_LINK△: "i love it”
- ADULT_LINK△: "makes gif ones easier to see”
- IIIII: "So tonight”
- IIIII: "is finally the end”
- ARGdov: "I do think Tyler got out of hand and honestly I probably did too, but, also....yeah she needed to get banned.”
- ARGdov: "the end?”
- otherLiam: "The end?”
- IIIII: "I hope you are excited”
- /Mr. Circle\: "the end?”
- ARGdov: ".....nope now Im nervous”
- otherLiam: "arg ends in a rickroll”
- IIIII: "I have been for years”
- otherLiam: "is this real? We’re really ending it?”
- ARGdov: "no way”
- otherLiam: "the final death of the id’s”
- ARGdov: "its not ending like this.”
- otherLiam: "jk i’ll fuckin start something if it really is”
11/12/19 - Chat with Erika
- Erika_XP💚: “I am back and also something happened to the video”
- otherLiam: "great”
- ARGdov: "god how the hell are going to explain all this to peopel”
- otherLiam: "you send them to the wiki”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ: "How did you get the entire live chat?”
- ARGdov: "fuck, there’s shit we still dont fully understand”
- otherLiam: "just link the new people to the wiki and tell them to read before asking”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ: "Wtf xD”
- ARGdov: "oh yeah I will, dont worry”
- otherLiam: "because anything we tell them about this will make no sense out of context”
- ADULT_LINK△: "we’re gonna be blind men describing colors”
- Xenquility: "I gotta go to fucking bed”
- Eevee Reborn: "Liam, be less savage. Lol”
- ARGdov: "we dont even know what just happened”
- otherLiam: "sorry”
- otherLiam: "i have a massive headache”
- Xenquility: "If you guys find anything cool out, mind dming me?”
- ADULT_LINK△: "aw”
- otherLiam: "my fucking smoke alarm just fuckin”
- ARGdov: "and theres been shit thats been happening for awhile we still dont have a good hold on”
- otherLiam: “BLASTED me”
- Xenquility: "Gunna be hard to crawl through chats tomorrow”
- otherLiam: "right in the fucking ear”
- ADULT_LINK△: "oh yikes”
- ADULT_LINK△: "that blows man”
- ARGdov: "with any luck SKM will be able to explain all this”
- ADULT_LINK△: "yeah but that’ll be in a few days”
- otherLiam: "im waiting for the skm vs ghostbabel hacker fight”
- otherLiam: "https://www.youtube.com/watch?v=ZTwCtQIEswM”
- ADULT_LINK△: "we should get a TLDR of the last few updates, and then link the timeline”
- ARGdov: "well, maybe shit will happen elading up to that”
- ARGdov: "how do we sum up whats been happening”
- ARGdov: "its hard to keep track”
- ARGdov: ”*leading”
- ADULT_LINK△: “i think we should get something thats like”
- ADULT_LINK△: "a intro to the arg and how the silentdork channel relates to JID as a whole”
- ADULT_LINK△: "cuz like”
- ARGdov: "but where would you even begin”
- Wolfcat: "thanks for archiving all that”
- Wolfcat: "ill sort through it tomorrow”
- ARGdov: "you need to know the ben drowned ARG and all its terminology”
- ARGdov: "and a whole bunch of new shit on top of that”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ: "It is not the end, is it a new era?”
- ADULT_LINK△: "if someone only knew about the channel, it would be a LOT to just link them to the wiki”
- ARGdov: "something like that @ᎢᎻᎬ ᏞᎾᏟKᎬᎠ”
- Erika_XP💚: "The entire introduction of the video vanished but I actually finshed downloading it a few moments ago and I seem to have gotten the full thing.”
- ARGdov: "oh nice”
- otherLiam: "i dunno thorin”
- otherLiam: "i didn’t even join the discord until i’d read the timelines”
- otherLiam: "cus i didn’t wanna be a bother”
- ARGdov: "honestly Im wary of bringing new people in, always”
- ADULT_LINK△: "i respect that liam”
- ARGdov: "especially (and no offense to Jos or Slinky) the spanish people”
- ARGdov: "cause some of them struggle with english, understandably”
- ARGdov: "and this is a headache to explain in english”
- ADULT_LINK△: "yeah i worry about language barriers, we might need to wait for some of our resident spaniards to get up to explain”
- otherLiam: ”…holy shit, she’s right”
- otherLiam: “the intro is gone”
- otherLiam: "i’ve still got it open so i can record it if needed”
- Xenquility: "oh yeah”
- Xenquility: "it is gone”
- Xenquility: "cool”
- Erika_XP💚: "Tyler I wont ping you but please give us a sign of some kind if you are alright”
- Xenquility: "he’s not”
- Xenquility: "he’s fucked”
- otherLiam: "erika he isn't”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ: ”@ARGdov I am of Spain xD”
- Erika_XP💚: “OH NO”
- otherLiam: "he hasn’t been fine”
- otherLiam: "this whole fucking time”
- Wolfcat: "heres a sign”
- otherLiam: "like i told you when you first joined”
- Wolfcat: ”:ban:”
- otherLiam: “he’s been kidnapped and taken to another fucking dimension”
- ARGdov: "Erika, let me explain”
- ARGdov: "last we’d heard- yeah what Liam just said”
- ARGdov: "which makes me wonder what the fuck all this was”
- otherLiam: "well the intro was him trying to appease his captors”
- otherLiam: "the rest was apparently SKM”
- ADULT_LINK△: "i’d advise not pinging his account or trying to communitcate, he’s not just gonna break character and explain stuff for us”
- ARGdov: "yeah”
- otherLiam: "I mean in this case pinging him may not necessarily be a bad idea”
- ADULT_LINK△: "eh ¯\_(ツ)_/¯”
- otherLiam: "just smartly”
- ARGdov: "lets not”
- otherLiam: "ok”
- ADULT_LINK△: "my foot hurts”
- otherLiam: "anyway i’ll transcribe the intro in case it gets lost”
- ADULT_LINK△: "awa”
- Eevee Reborn: "Ok, ok”
- ARGdov: "damn, thorin”
- Jos: "have you tried restarting the router”
- ARGdov: "any idea how long till itll improve?”
- otherLiam: "does anyone know what that song was btw?”
- ADULT_LINK△: "well, 6-8 weeks”
- ARGdov: "I dont”
- ARGdov: "and damn”
- otherLiam 1:00 AM: "ah it’s The End by My Chemical Romance - wait a second.”
- ADULT_LINK△ 1:00 AM: "later in the month i’m gonna go get it checked out again, and depending on how it is it could either be fine or need more time to heal”
- Eevee Reborn 1:00 AM: "Let’s talk a bit about the video”
- ADULT_LINK△ 1:00 AM: "really hoping i wont need surgery, that’ll extend the recovery period signifigantly”
- otherLiam 1:01 AM: "nah nm”
- ADULT_LINK△ 1:01 AM: "and yeah i’ll continue talkin about my broken foot more in general if anyone cares”
- ADULT_LINK△ 1:01 AM: "otherwise lets go back to spook time”
- ARGdov 1:01 AM: "I mean, what is there to say really”
- otherLiam 1:01 AM: "the song in the intro is called The End, which leads into the song "Dead!"”
- ARGdov 1:01 AM: "actually there’s one thing Im wondering”
- ARGdov 1:01 AM: "that video at the end”
- ARGdov 1:01 AM: "are we sure we’ve seen that befor?”
- otherLiam 1:01 AM: "the greth vlogs one?”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ 1:02 AM: "John is live”
- ARGdov 1:02 AM: "or have I just forgotten it”
- otherLiam 1:02 AM: "we almost definitely haven't”
- Xenquility 1:02 AM: "Nah we haven't”
- otherLiam 1:02 AM: "i don’t remember anyone crossing a bridge to see an alien”
- otherLiam 1:02 AM: "also john’s def dead”
- ARGdov 1:02 AM: "so all that shit was new”
- ARGdov 1:02 AM: "greth chasing tyler”
- ARGdov 1:02 AM: "tyler experimenting with the sign”
- ARGdov 1:02 AM: "tyler ending up in that weird green world”
- ARGdov 1:02 AM: "also did anyone else see the mask lying on the bridge?”
- Eevee Reborn 1:03 AM: "Because you only get three chances to use the sign”
- ARGdov 1:03 AM: ”….I didnt know that”
- /Mr. Circle\ 1:03 AM: “@ADULT_LINK△ fourth tyler was my meme theory”
- ADULT_LINK△ 1:04 AM: "oh”
- ARGdov 1:04 AM: "so, some version of greth attacked some version of tyler, or tried to”
- /Mr. Circle\ 1:04 AM: "because i opened the parallelos with my top secret ninjutsu immediately before tyler started verbally abusing erika”
- ARGdov 1:04 AM: "in some last ditch attempt to escape tyler touched the sign”
- Erika_XP💚 1:04 AM: "I cant believe this whole time”
- ARGdov 1:04 AM: "and that sent him somewhere new”
- Erika_XP💚 1:04 AM: "I was so in shock over what was going on I did not even notice”
- ARGdov 1:04 AM: "where he saw a bridge, and a weird thing on the other side”
- ADULT_LINK△ 1:04 AM: "damn was your meme theory like.”
- ADULT_LINK△ 1:04 AM: "legit”
- ADULT_LINK△ 1:04 AM: "wild”
- Erika_XP💚 1:04 AM: "THAT WAS MY CHEMICAL ROMANCE IN THAT INTRODUCTION”
- ARGdov 1:05 AM: "we know from the past that crossing bridges can symbolically mean crossing into a new paralellos”
- Eevee Reborn 1:05 AM: "He’s stuck in the green world, forced to walk the path again and again.”
- ARGdov 1:05 AM: "so it might mean that here too”
- Eevee Reborn 1:05 AM: "Oh no”
- Eevee Reborn 1:05 AM: "Yea, it was mcr, lol”
- /Mr. Circle\ 1:06 AM: "just gotta archive that”
- Erika_XP💚 1:07 AM: "A PRAAAAAAAAAAAAAAAAAAAYYYYYEEEEER”
- Erika_XP💚 1:07 AM: "NOw”
- Erika_XP💚 1:07 AM: "WELL I CANT”
- Erika_XP💚 1:07 AM: "AND I DONT KNOw”
- ADULT_LINK△ 1:07 AM: "what”
- ARGdov 1:07 AM: "shes quoting MCR”
- Erika_XP💚 1:07 AM: "sorry thats an mcr song ^^”
- ADULT_LINK△ 1:07 AM: "oh”
- ADULT_LINK△ 1:07 AM: "i have poo brain dont mind me”
- ARGdov 1:07 AM: "because apparently shes tara gilesbie”
- ARGdov 1:07 AM: "jk”
- ARGdov 1:07 AM: "anyways so uh”
- ARGdov 1:07 AM: "that was a lot”
- ARGdov 1:07 AM: "and Im still confused by it, on a lot of levels”
- ARGdov 1:07 AM: "how did this connect to whats been happening before”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ 1:09 AM: "This is a Hacked?”
- ADULT_LINK△ 1:09 AM: "what?”
- ARGdov 1:10 AM: "god see this is why I hate when we get a bunch of new people who only know the videos”
- ARGdov 1:10 AM: "its not there fault”
- ARGdov 1:10 AM: "and I appreciate they’re trying to understand”
- ARGdov 1:10 AM: "but its such a headache”
- ADULT_LINK△ 1:11 AM: "damn yall need to chill”
- ADULT_LINK△ 1:11 AM: "everyone gettin headaches and gettin so hostile”
- ARGdov 1:11 AM: "Im not hostile and Im speaking metaphorically about headaches”
- ARGdov 1:11 AM: "its just irritating to have to be like”
- ARGdov 1:11 AM: "we hardly know whats going on ourselves”
- ARGdov 1:11 AM: "but we still need to explain shit to people”
- ADULT_LINK△ 1:12 AM: "i mean”
- ADULT_LINK△ 1:12 AM: ”“god see this is why i hate……” seems a bit hostile to me”
- ADULT_LINK△ 1:12 AM: “but”
- ADULT_LINK△ 1:12 AM: "i get ur point”
- ADULT_LINK△ 1:12 AM: "it is a bit much to have to explain stuff when we barely know whats going on rn in the first place”
- ᎢᎻᎬ ᏞᎾᏟKᎬᎠ 1:12 AM: "How did you get the entire video chat?”
- Eevee Reborn 1:13 AM: "I recorded it on my phone”
- Eevee Reborn 1:13 AM: "I’ll edit the vid and upload it to ID”
- ARGdov 1:13 AM: "thorin, you’re kind of high at the moment arent you”
- ARGdov 1:13 AM: "and I speak hyperbolically like this a lot so”
- ARGdov 1:13 AM: "me doing it now shouldnt come as a surprise”
- ARGdov 1:13 AM: "but I do find it extremely frustrating”
- otherLiam 1:14 AM: "for archive purposes”
- Erika_XP💚 1:14 AM: "I am not a fan of smoking myself”
- Erika_XP💚 1:14 AM: "but I dont mind anyone who is”
- ADULT_LINK△ 1:14 AM: "honestly i’ve been sober for a while”
- ADULT_LINK△ 1:14 AM: "i was coming down when i said i was high, i just wanted to fuck around a little”
- ARGdov 1:15 AM: "oh ok”
- ARGdov 1:15 AM: "my bad”
- ADULT_LINK△ 1:15 AM: "nah ur fine”
- otherLiam 1:15 AM: "hey so uh”
- otherLiam 1:15 AM: "what’s ”‘classic’ time"”
- ARGdov 1:15 AM: “I have a tendency to say that I hate things, just, in general”
- Erika_XP💚 1:15 AM: "Its all in good fun, I sneak a few drinks now and then sometimes myself but dont tell anyone I said that ^^;”
- ADULT_LINK△ 1:15 AM: "classic time?”
- otherLiam 1:15 AM: "in the silent family desc”
- otherLiam 1:15 AM: "from our chummer”
- ARGdov 1:15 AM: ”“classic time"”
- ADULT_LINK△ 1:15 AM: "oh”
- ARGdov 1:15 AM: "Ive no idea”
- otherLiam 1:15 AM: "Ill try to speak again here in around 3 days in 'classic’ time. Cheerio chummers.”
- ARGdov 1:15 AM: "maybe they mean our timeline”
- ADULT_LINK△ 1:15 AM: "wait”
- ADULT_LINK△ 1:15 AM: "3 days….”
- otherLiam 1:16 AM: "also why tf is tyler allergic to apostrophes”
- ARGdov 1:16 AM: "as opposed to the AO timeline”
- ADULT_LINK△ 1:16 AM: "we could play song of double time to skip ahead a bit”
- ARGdov 1:16 AM: "no”
- ARGdov 1:16 AM: "lets give tyler time to prep”
- ADULT_LINK△ 1:16 AM: "jk that would probably piss tyler off out of character because he’d have less time to set stuff up”
- Xenquility 1:16 AM: "ay quick thing the whole thing with greth was probably planned since he was in the stream chart'”
- ARGdov 1:16 AM: "exactly”
- Xenquility 1:16 AM: ”*with greth leaving”
- ARGdov 1:17 AM: “I mean, I dunno”
- ARGdov 1:17 AM: "cause hes not rejoined has he”
- Xenquility 1:17 AM: ”*chat”
- ARGdov 1:17 AM: “he will eventually Im sure but he was p pissed”
- ARGdov 1:17 AM: "so unless Erika was in on this too, which I doubt, that wasnt planned”
- Xenquility 1:17 AM: "Unless they planned for this anyways”
- Xenquility 1:17 AM: "Erika was just a convinient solution”
- Xenquility 1:17 AM: "The other option would’ve been the gamejack causing him to go insane”
- Xenquility 1:17 AM: "or the anger was all real but who the fuck knows”
- Wolfcat 1:18 AM: ”:funkyface:”
- Xenquility 1:18 AM: “K im going to bed”
- Xenquility 1:18 AM: "gnight”
- Erika_XP💚 1:18 AM: "I am not sure what I have solved but alright I am still just trying to solve weather or not I ought to try and send Tyler my tribute video now”
- otherLiam 1:18 AM: "nothing is real”
- otherLiam 1:18 AM: "everything is fake”
- otherLiam 1:18 AM: "erika”
- ADULT_LINK△ 1:19 AM: "obviosuly the gamejack rage was a jape”
- otherLiam 1:19 AM: "just post it”
- Wolfcat 1:19 AM: "damn do you have a shipping video”
- otherLiam 1:19 AM: "he’ll look at it whenever”
- ARGdov 1:19 AM: "yees post it”
- ADULT_LINK△ 1:19 AM: "ooh shit send the tribute video”
- ADULT_LINK△ 1:19 AM: "you keep talking about it i’m excited”
- Erika_XP💚 1:19 AM: "I am too nervous to show it in front of everyone ^//^;”
- Xenquility 1:19 AM: "dont be”
- Xenquility 1:19 AM: "we’re a very loving and supporting group”
- Xenquility 1:19 AM: "look at dov he’s gay and he’s still awesome”
- Xenquility 1:19 AM: "or wolfcat he straight up stole the game and he’s still here”
- Eevee Reborn 1:20 AM: "Du et”
- Xenquility 1:20 AM: "or slinky he literally posted the elegy twice”
- Erika_XP💚 1:20 AM: "Greth is also in the video as well but I kind of”
- Erika_XP💚 1:20 AM: "just made it for Tyler ^^;”
- Erika_XP💚 1:20 AM: "but”
- Erika_XP💚 1:20 AM: "idk”
- Eevee Reborn 1:21 AM: "We keep dov around, and hes a hot mess”
- ARGdov 1:21 AM: "oh please Im awesome because of the gayness”
- otherLiam 1:21 AM: "you made the video exclusively for a person you’ve never met before and only know through creepy fake videos to see”
- Xenquility 1:21 AM: "liam is literally married to a larper”
- Wolfcat 1:21 AM: "I’m stuff”
- otherLiam 1:21 AM: "Xen”
- otherLiam 1:21 AM: "I broke up with the larper”
- Xenquility 1:21 AM: "shhh”
- Erika_XP💚 1:21 AM: "I kept it unlisted until a few moments ago because I was so nervous”
- otherLiam 1:21 AM: "i’m dating a hacker god now”
- ARGdov 1:21 AM: "otherwise Id just be some weirdo who betrayed the entire group”
- ADULT_LINK△ 1:21 AM: "im a being of chaos”
- ADULT_LINK△ 1:21 AM: ”:Jefault:”
- ARGdov 1:21 AM: “now Im someone who betrayed the entire group who also gets his dick sucked by other men”
- ARGdov 1:21 AM: "which is just cooler”
- ADULT_LINK△ 1:22 AM: "hah, gay”
- Eevee Reborn 1:22 AM: "Omg, did my jevil theme work?”
- Wolfcat 1:22 AM: "buHAH”
- ARGdov 1:22 AM: ”@Erika_XP💚 well, link it!”
- ARGdov 1:24 AM: “ok”
- ARGdov 1:24 AM: "if we’re done for the evening”
- ARGdov 1:24 AM: "Im going to bid you all good night”
- ADULT_LINK△ 1:24 AM: "nighto dov”
- otherLiam 1:24 AM: "who the fuck knows if we’re done”
- Eevee Reborn 1:24 AM: "Im gonna stay alert, that was late”
- Xenquility 1:24 AM: "I think we’re done”
- ARGdov 1:24 AM: "this nice jewish gay boy needs his sleep”
- Wolfcat 1:24 AM: "im going to fare you a bidew”
- otherLiam 1:24 AM: "might be like that one time and we’ll just suddenly get a call and the creds to johnisdead”
- Xenquility 1:24 AM: "Im not gay or jewish but I also need sleep”
- Eevee Reborn 1:24 AM: "It might not even be over”
- otherLiam 1:24 AM: "me and eevee will hold down the fort i guess”
- ARGdov 1:24 AM: "well, let me know what I miss”
- otherLiam 1:25 AM: "not like i sleep anyway”
- ARGdov 1:25 AM: "https://tenor.com/view/night-goodnight-gif-4301725”
- Eevee Reborn 1:25 AM: "Ok”
- ADULT_LINK△ 1:25 AM: "im going to fare you a bidoof”
- Xenquility 1:25 AM: "All I can say is that was an emotional rollercoaster and a half”
- Eevee Reborn 1:26 AM: "Lmfao”
- pakospooky 1:26 AM: "https://youtu.be/r1w5VBYl6cc”
- otherLiam 1:27 AM: "we noticed”
- pakospooky 1:27 AM: "yeah”
- Wolfcat 1:27 AM: "https://youtu.be/r1w5VBYl6cc”
- pakospooky 1:27 AM: "what is the black guy at the end of the bridge”
- Wolfcat 1:28 AM: "i dunno but i dont trust em”
- Erika_XP💚 1:32 AM: "https://www.youtube.com/watch?v=AAx5Qjt_QC4 I just found some really good vaporwave while trying to search the video up on my phone”
- /Mr. Circle\ 1:32 AM: "hey real quick”
- /Mr. Circle\ 1:32 AM: "what happened to the AO timeline tyler”
- ADULT_LINK△ 1:32 AM: "FUCK YES”
- ADULT_LINK△ 1:32 AM: "THANK YOU ERIKA”
- ADULT_LINK△ 1:32 AM: "DOOD ODOD ODODOO”
- ADULT_LINK△ 1:32 AM: "oDOODODOOOD”
- Wolfcat 1:32 AM: ”:dkgroove:”
- pakospooky 1:32 AM: “this is the end?”
- ADULT_LINK△ 1:32 AM: ”:dream:”
- ADULT_LINK△ 1:32 AM: “:dkdance:”
- /Mr. Circle\ 1:32 AM: "quick please someone answer me”
- /Mr. Circle\ 1:32 AM: "time is of the essence”
- /Mr. Circle\ 1:32 AM: "which is to say”
- ADULT_LINK△ 1:33 AM: "oh?”
- /Mr. Circle\ 1:33 AM: "i don’t feel like taking all night”
- Wolfcat 1:33 AM: "is time the season?”
- Wolfcat 1:33 AM: "but also”
- Wolfcat 1:33 AM: "im not sure if we know”
- /Mr. Circle\ 1:33 AM: "time ain’t no reason”
- /Mr. Circle\ 1:33 AM: ”:ZoomEyes:”
- Eevee Reborn 1:34 AM: “I dont know”
- Wolfcat 1:34 AM: "I guess they didn’t tell you”
- Wolfcat 1:34 AM: "So I guess they didn’t tell you”
- Wolfcat 1:34 AM: "I guess they didn’t tell you”
- ADULT_LINK△ 1:34 AM: "what”
- Wolfcat 1:34 AM: "Guess you don’t know”
- Wolfcat 1:34 AM: "I guess they didn’t tell you”
- Eevee Reborn 1:35 AM: "I guess we weren’t informed”
- pakospooky 1:35 AM: "tyler should fight with Greth”
- Wolfcat 1:35 AM: "I see”
- Wolfcat 1:35 AM: "They didn’t tell you, huh”
- pakospooky 1:35 AM: "and not run away”
- ADULT_LINK△ 1:36 AM: ”:jeffEyes:”
- Erika_XP💚 1:36 AM: “I”
- Erika_XP💚 1:36 AM: "I ACTUASL”
- Wolfcat 1:36 AM: "same”
- Eevee Reborn 1:36 AM: "Are?”
- Erika_XP💚 1:37 AM: "I ACTUALLY JUST FOUND SILENT DORK IN THE COMMENT SECTION OF THIS VIDEO”
- ADULT_LINK△ 1:38 AM: "of nouveau life?”
- /Mr. Circle\ 1:38 AM: "get ready”
- Erika_XP💚 1:38 AM: "https://www.youtube.com/watch?v=AAx5Qjt_QC4&lc=Ugxdm5U-fIByz_hVsV14AaABAg”
- ADULT_LINK△ 1:38 AM: "he used that in the arg before”
- /Mr. Circle\ 1:38 AM: "i am about to blow your minds”
- ADULT_LINK△ 1:38 AM: "thats why i’m so glad you sent it i’ve been trying to remember what the real song was called for a while”
- Wolfcat 1:39 AM: "damn”
- Wolfcat 1:39 AM: "3 months ago”
- ADULT_LINK△ 1:39 AM: "haha damn this fmv is fire”
- ADULT_LINK△ 1:39 AM: "nice job”
- Erika_XP💚 1:39 AM: "Pardon?”
- ADULT_LINK△ 1:40 AM: "ooh you actually tagged it jadusable too”
- ADULT_LINK△ 1:40 AM: ”:thumb:”
- ADULT_LINK△ 1:40 AM: “respecc”
- otherLiam 1:41 AM: "oh boy”
- otherLiam 1:41 AM: "incoming”
- ADULT_LINK△ 1:42 AM: "amazing graphic”
- Eevee Reborn 1:42 AM: "Circle and his charts”
- /Mr. Circle\ 1:42 AM: "excuse me, this is a graph”
- Erika_XP💚 1:43 AM: "Tyler is typing but taking forever I wonder what he is going to say”
- Erika_XP💚 1:43 AM: "also I tagged wot?”
- ADULT_LINK△ 1:43 AM: "in your fmv”
- /Mr. Circle\ 1:43 AM: "but here it is without my dumb shitpost”
- ADULT_LINK△ 1:43 AM: "the tags you added”
- ADULT_LINK△ 1:43 AM: "https://gyazo.com/1b275bc0ca823fd1bf587825d855cf33”
- ADULT_LINK△ 1:43 AM: ”:NinjaLink:”
- ADULT_LINK△ 1:43 AM: “jutsu”
- Erika_XP💚 1:44 AM: "WAIT OH NO DONT LOOK AT THAT”
- ADULT_LINK△ 1:44 AM: "too late”
- ADULT_LINK△ 1:44 AM: "lmao”
- Wolfcat 1:45 AM: "oh”
- otherLiam 1:45 AM: "pfffft”
- ADULT_LINK△ 1:46 AM: "shit she left”
- ADULT_LINK△ 1:46 AM: "oops”
11/17/19 - Chat with Erika
- Xenquility 3:49 PM: “Welcome back!”
- Slinky Stinks△ 3:49 PM: “Ayyy girl!”
- Slinky Stinks△ 3:49 PM: “How you doin!”
- Erika_XP💚 3:50 PM: “I take not even passes as a joke that come not from my Tyler thank you”
- Erika_XP💚 3:50 PM: “(I am joking however) hello ^^”
- ARGdov 3:51 PM: “glad you could finally joine lol”
- Slinky Stinks△ 3:51 PM: “:beerd:”
- Wolfcat 3:53 PM: “Hullo “
- Erika_XP💚 3:53 PM: “@IIIII I dreamt last night you were getting attacked on the sidewalk somewhere. Even if you can’t respond now Tyler I know you will get out of whatever you are in right now. I BELIEVE IN YOU!”
- ARGdov 3:53 PM: “@Erika_XP💚 I hate to drag this into the open but could you tell us where the footage I described to you in PMs is from?”
- DensO Burton 3:53 PM: "Lol”
- Erika_XP💚 3:53 PM: "I thought you were big followers of his dont you know where all his videos are silly?”
11/22/19 - Chat with Erika
- Erika_XP💚: “I think I just saw Tyler post a moment ago but I only saw the notification.”
- Erika_XP💚: "Also @ARGdov hello sorry I had to step away for a moment”
- Erika_XP💚: "well I guess it was for a bit longer than just a moment considering I fell asleep ^^;”
- Xenquility: "Saw something get deleted but dont think it was tyler”
- Erika_XP💚: "Oh well then that is odd. Do others in here find themselves possesed by some sort of dark force?”
- Xenquility: "Nah, sometimes people just post and delete stuff for fun”
- ARGdov: ”@Erika_XP💚 its good. Im busy as well lol”
11/28/19 - Chat with Erika
- Erika_XP💚 3:34 PM: “https://www.youtube.com/watch?v=Twp8XL0xzr0”
- Erika_XP💚 3:34 PM: "mood”
- ARGdov 3:56 PM: "oh shit”
- ARGdov 3:56 PM: "hey Erika”
- Slinky stinks 4:00 PM: "Ay Erika How you doin gurl”
- Wolfcat 5:49 PM: "ey guuuurl”
- mfgreth 6:23 PM: "Look at the sky”
- mfgreth 6:23 PM: "The planets align”
- mfgreth 6:23 PM: "It feels right”
- Erika_XP💚 6:49 PM: "I can’t believe I step away for just a moment and I come back and you are all being sillies xD”
- Erika_XP💚 6:49 PM: "Happy thanks giving by the way everyone ~<3 :turkey:”
11/29/19 - Chat with Erika
- pakospooky 1:55 PM: “the song appear in returning to the fishery, going and 23rd update i think”
- pakospooky 1:55 PM: "is the same song”
- pakospooky 1:55 PM: "Does anyone know how to tell me?”
- Erika_XP💚 7:07 PM: "I believe the song you are looking for is present here Mr Pako”
- Erika_XP💚 7:07 PM: "https://www.youtube.com/watch?v=-iNJqwNwFgA”
- Erika_XP💚 7:07 PM: ”@pakospooky”
- Erika_XP💚 7:07 PM: “I am an expert on Silentdork ~<3”
11/30/19 - Chat with Erika
- Xenquility 9:55 AM: “Yo”
- Xenquility 9:55 AM: "New theory”
- Xenquility 9:55 AM: "That mask we keep seeing isn’t Matt’s mask”
- Xenquility 9:55 AM: "It’s this one, from "First live stream: general talk"”
- Xenquility 9:55 AM: "It makes more sense that the mask on Tyler’s door from Greth Vlogs 5 is this mask”
- Xenquility 9:55 AM: "He found it when walking in the woods near the fishery”
- Xenquility 9:55 AM: "He also says it seems familiar”
- Erika_XP💚 10:31 AM: "By the coloration I would reckon it must be the property of none other than his old friend Kevin. The form I have learned he took on favors these colors above others. Probably for something really silly but meaningful to him =p”
- Xenquility 10:33 AM: "Where did you find that out?”
- Erika_XP💚 10:34 AM: "I was reading”
- Erika_XP💚 10:34 AM: "god my heart is beating really fast”
- Erika_XP💚 10:34 AM: "Not because I am scared lol”
- Erika_XP💚 10:34 AM: "But because I was also going for a jog while I read >w>”
- Xenquility 10:34 AM: "That’s some serious skill”
- Xenquility 10:34 AM: "Ay Erika, you know the "Good Morning” and “Awake” live streams, right?”
- Erika_XP💚 10:37 AM: “Tyler has not been around lately right <w<"”
- Xenquility 10:38 AM: "Not that we know of, but right now we don’t really know what’s happening”
- Erika_XP💚 10:39 AM: "I always know what is going on with my silentdork in my heart ~but I only tell certain people how~”
- Xenquility 10:41 AM: "could you tell us xd”
- Erika_XP💚 10:43 AM: "its always spoopy when I walk home at night”
- Erika_XP💚 10:43 AM: "https://www.youtube.com/watch?v=t6q5_7fVjEg”
- Erika_XP💚 10:43 AM: "Mood”
- Xenquility 10:49 AM: "Excuse me madame but that’s not the original”
- Xenquility 10:49 AM: "Only truly cultured people watch the original”
- Xenquility 10:49 AM: "https://www.youtube.com/watch?v=IiDQwQQsrL8&feature=youtu.be”
- Erika_XP💚 10:49 AM: "Ooooooo sorry I had no idea DX”
- Slinky stinks 10:49 AM: ”:0”
- Slinky stinks 10:49 AM: “The legendary video”
- Erika_XP💚 10:52 AM: "I already showed you guys a secret video a long time ago actually I thnk if thats what you are asking for and explained why I did not want to post it again >m>"”
- Xenquility 10:53 AM: "You did?”
- Erika_XP💚 10:54 AM: "I understand though, I should not act like people are going to think everyword I say is super important or anything >///>"”
- Xenquility 10:54 AM: ”~Actually we do~”
- Xenquility 10:54 AM: “Also, do you mean the wolfcat22 video?”
- Erika_XP💚 11:03 AM: "No the one where I got into a stream he was doing and he said something to me I think maybe when I came in and said hello to him. he turned off the chat though <w<"”
- Xenquility 11:03 AM: "Like the stream from start life?”
- Erika_XP💚 11:05 AM: "I have a little theory about that video because that was not a stream it was a premier :p”
- Xenquility 11:05 AM: "Sorry that’s what I meant lmao”
- pakospooky 11:06 AM: ”:hando:”
- Erika_XP💚 11:06 AM: “I think the screaming monster wanted to kill tyler very bad but could not do it because he missed 11/11”
- Erika_XP💚 11:06 AM: "AAA scary DX”
- Xenquility 11:06 AM: "screaming monster?”
- pakospooky 11:06 AM: "lostinforest”
- Erika_XP💚 11:07 AM: "I am thankfully not in any forest I am just walking on my very long street to home”
- Erika_XP💚 11:07 AM: "that would be really really scary I hate being alone in woodsy places with lots of weird animals”
- pakospooky 11:08 AM: "what monster?”
- Erika_XP💚 11:09 AM: "The one that sounded really mad after the intro where I guess he was trying to act like he was having a fun time but he is clearly just, well, just mean or something I dont know xp”
- Xenquility 11:10 AM: “What video?”
- Erika_XP💚 11:10 AM: "the one that just came out on the night of 11/11 silly”
- pakospooky 11:10 AM: "in the”
- pakospooky 11:10 AM: "title of runes”
- pakospooky 11:10 AM: "in halloween”
- pakospooky 11:10 AM: "i think”
- Erika_XP💚 11:11 AM: "but I think it was late for him I think since I know his time zone and all”
- Xenquility 11:11 AM: "I don’t recall a screaming monster in Start Life”
- pakospooky 11:11 AM: "https://youtu.be/04ZlXgrHK2U”
- pakospooky 11:11 AM: "that”
- Erika_XP💚 11:11 AM: "lol no xD”
- pakospooky 11:12 AM: "somebody screams”
- pakospooky 11:12 AM: "no?”
- Erika_XP💚 11:12 AM: "that is like a howling thingy”
- Erika_XP💚 11:12 AM: "but it does not sound mad to me”
- Xenquility 11:12 AM: "Hey Erika, so the video on 11/11 seems to take place on 4/23/2019 right?”
- Erika_XP💚 11:13 AM: "Is that what you have discovered?”
- Xenquility 11:13 AM: "I think so”
- Xenquility 11:13 AM: "Right before the Tyler and Greth clip plays 4/23/2019 flashes on screen in runes”
- pakospooky 11:13 AM: "https://youtu.be/04ZlXgrHK2U 0:43 someone screams”
- Xenquility 11:13 AM: "That’s also supposed to be the day he crossed the parallelos bridge if I recall correctly”
- Xenquility 11:13 AM: "Hey, something I just noticed”
- Xenquility 11:13 AM: "Greth is holding a sword in Start Life”
- pakospooky 11:15 AM: "yeah”
- pakospooky 11:15 AM: "and the video of esmerald heart too”
- Xenquility 11:16 AM: "Another thing I’ve noticed (Though I doubt this means anything) is that the parallelos symbol flashes on screen when Tyler first touches the sign in Start Life”
- Xenquility 11:16 AM: "The only other time this happens is in "Unusual”, the first time he uses the sign”
- pakospooky 11:17 AM: “yeah”
- pakospooky 11:17 AM: "but the parallelos symbol appear also in the video of g2”
- Xenquility 11:18 AM: "In "Start Life”, he talks about it being a while since the guy broke into his house”
- Xenquility 11:18 AM: “We haven’t known who that is, but I’m guessing it’s referring to SKM breaking into his house in the "First live stream: general talk” video”
- Xenquility 11:18 AM: “So we know for sure that Start Life takes place after that”
- pakospooky 11:19 AM: "yes”
- Xenquility 11:21 AM: "Yo”
- Xenquility 11:21 AM: "One of the IIIIIIs were always talking about "Wanting to end it” and “Bringing it back to null"”
- Xenquility 11:21 AM: "Maybe that’s the one that took over and tried to convince us everything was ending”
- Xenquility 11:31 AM: "Holy damn”
- Xenquility 11:31 AM: "Tags on "Regiminis” have changed”
- Xenquility 11:31 AM: “Old: "Your old friend,malagasy,https://translate.google.com/#mg/en/kevi” “
- Xenquility 11:31 AM: “New: "Your old friend, malagasy, <a href="https://translate.google.com/#mg/en/kevi,">https://translate.google.com/#mg/en/kevi,</a> to latin, to english, meaning of regiminis"”
- Erika_XP💚 11:33 AM: "That is so poetic but Im spooped if this boi is on the move”
- Xenquility 11:34 AM: "kevi from malagasy to latin to english translates to "govenors"”
- Xenquility 11:34 AM: "Or "governing"”
- Erika_XP💚 11:35 AM: "and the latin name also means the same thing I think”
- Xenquility 11:36 AM: "and Regiminis translates to "governance"”
- Erika_XP💚 11:37 AM: "sorry I got a little excited there XD”
- Xenquility 11:37 AM: "I got the message but”
- Xenquility 11:37 AM: "How did you get to that conclusion?”
- Erika_XP💚 11:38 AM: "I love linguistics and poetry, but I am terrible at it in any written exam XD”
- Erika_XP💚 11:38 AM: "to say that kevi is "Govenors” but Regiminis is “Governance” is as if to say he was governing his life but then once he became this he became the “governance” itself instead of being a “govenor"”
- pakospooky 11:40 AM: "https://youtu.be/0o4xIM4LO0k”
- Erika_XP💚 11:40 AM: "but thats just a silly idea that came to my head really fast when I read that”
- Xenquility 11:40 AM: "Actually that makes sense”
- Erika_XP💚 11:41 AM: "if we assume kevi is just "kevin” I guess x3”
- pakospooky 11:42 AM: “gobernance”
- Xenquility 11:43 AM: "It could be safe to assume that means Nocta is currently a governor then”
- otherLiam 11:44 AM: "Hey, Erika. You said you’re an “expert on Silentdork”. Have you been keeping track of all the related channels, as well?”
- pakospooky 11:45 AM: "father: in english”
- Xenquility 11:45 AM: "yeah we’ve known that for a good 4 years”
- pakospooky 11:46 AM: "yeah”
- pakospooky 11:46 AM: "but regiminis and patrem come from latin”
- Erika_XP💚 11:46 AM: "that made me laugh so loud I think I woke some people on the side of the road up XD”
- Erika_XP💚 11:46 AM: "I am silly right now xp”
- otherLiam 11:48 AM: "“On the side of the road”?”
- otherLiam 11:48 AM: "Where are you that you’re waking up people sleeping on the side of the road?”
- Erika_XP💚 11:48 AM: "walking home”
- otherLiam 11:49 AM: "ahh”
- Erika_XP💚 11:50 AM: "My secret <///<”
- Xenquility 11:50 AM: "Thanks for the secret :)”
- otherLiam 11:50 AM: "shhhh”
- Xenquility 11:52 AM: “that sounds creepy”
- Erika_XP💚 11:52 AM: ”~ :heart:”
- Erika_XP💚 11:52 AM: “My heart beats so fast”
- Erika_XP💚 11:52 AM: "when I try to jog and talk at the same time lol”
- Xenquility 11:53 AM: "YO”
- Xenquility 11:53 AM: "New theory”
- Xenquility 11:53 AM: "In "Awake”, Tyler mentions having a dream that Greth was coming that day”
- Xenquility 11:53 AM: “At the end of Awake, Tyler starts reciting the LevANnhUA cipher, saying that "He has to cross a bridge and go through a gate” or something”
- Xenquility 11:53 AM: “Then the video ends”
- Erika_XP💚 11:55 AM: "Sorry I get embarrased when I let myself get too excited like that”
- Erika_XP💚 11:55 AM: "I wanna act mature ^^”
- Xenquility 11:55 AM: "If Tyler was "Brainwashed” or put in a transe like state at the end of Awake, that could explain him forgetting the sign wasn’t working”
- Xenquility 11:55 AM: “His dream about Greth coming over could’ve been Greth from Start Life”
- Erika_XP💚 11:56 AM: "https://www.youtube.com/watch?v=RU1Imks_pSc&t”
- Erika_XP💚 11:56 AM: "he is such a emo boi with this hat tho”
- Xenquility 12:00 AM: "Please do say”
- Xenquility 12:00 AM: "Any theory is a good theory right now”
- Xenquility 12:00 AM: "It could literally be the most out there thing and it’d be okay”
- Xenquility 1:25 PM: "oh hey”
- Xenquility 1:25 PM: "big man is typing”
- Deadhead 1:25 PM: ”@IIIII you cant just abandon us like this bro”
- Deadhead 1:25 PM: “https://cdn.discordapp.com/attachments/570745653374877711/649824712616312852/unknown.png”
- Erika_XP💚Today at 1:48 PM: "This image feels nice somehow O//w//O”
- Xenquility 1:48 PM: "your kinky thoughts will never escape :>”
- Erika_XP💚 1:48 PM: "Like he looks really cool and manly here is all I mean to say you weirdo”
- ARGdov 1:49 PM: "Lol”
- ARGdov 1:49 PM: "Hello Yuki”
- ARGdov 1:49 PM: "Long time no speak. Hope shits been ok”
- Erika_XP💚 1:49 PM: "who is yuki?”
- ARGdov 1:49 PM: "facepalms”
- ARGdov 1:49 PM: "Sorry, I meant you, Erika”
- Xenquility 1:50 PM: "gj dov”
- Slinky stinks 1:50 PM: "Lmao”
- Erika_XP💚 1:50 PM: "Did I make myself look weeby somehow?”
- ARGdov 1:50 PM: "Yuki was…someone weve come across. But shes seemingly gone now, sort of”
- Erika_XP💚 1:50 PM: "is it my pfp?”
- ARGdov 1:50 PM: "No Im just a dumbass”
- Erika_XP💚 1:51 PM: "I was getting ready to change it soon anyways”
- ARGdov 1:51 PM: "Either way- hope you’re doing well”
- ARGdov 1:51 PM: "Lol ok”
- Slinky stinks 1:53 PM: "Isn’t your pfp a Pokemon gym leader erika?”
- ARGdov 1:56 PM: "Oh incidentally, @Xenquility did you finish writing your doc?”
- Xenquility 1:57 PM: "PRetty close”
- Xenquility 1:57 PM: "Scroll up for some juicy theories and shit I found”
- Xenquility 1:57 PM: "One major thing is that the mask we keep seeing probably isn’t Matt's”
- Xenquility 1:57 PM: "It’s probably the red mask Tyler talks about in First live stream: general talk”
- Xenquility 1:57 PM: "Also, came up with a theory about the discrepancies between Goodmorning, Awake, and Start Life’s events”
- ARGdov 1:58 PM: “Oooh”
- Xenquility 1:58 PM: "Good morning and Awake take place right after each other”
- Xenquility 1:58 PM: "in Awake, Tyler mentions having a dream about Greth coming over”
- Xenquility 1:58 PM: "At the end of Awake, Tyler enters a trance like state and recites the cipher from Levannhua (Some shit about everything being okay once he crosses the bridge and passes the gate)”
- Xenquility 1:58 PM: "The dream about Greth coming over was most likely Greth from the events of Start Life”
- Erika_XP💚 2:01 PM: "I wish Tyler would talk about his dreams more xp”
- Xenquility 2:02 PM: "In Good Morning, Tyler mentions that he doesn’t believe the sign works. This contradicts his video in Start Life, where he believes it’s working. I’m assuming the trance like state he was in was someone like Patrem fucking with his memory”
- ARGdov 2:02 PM: "Oh nice? I need to rewatch.”
- Xenquility 2:02 PM: "One oddity though, in Experiments, it’s revealed the sign doesn’t work unless it’s standing up”
- Xenquility 2:02 PM: "However, each use in Start Life is with it laying down”
- ARGdov 2:02 PM: ”…huh”
- ARGdov 2:02 PM: “Could be hes figured out how to use it?”
- ARGdov 2:02 PM: "The signs crazy inconsistent it seems”
- Xenquility 2:03 PM: "Actually, it appears the opposite”
- ARGdov 2:03 PM: "So it may have just acted up”
- Xenquility 2:03 PM: ”(I just noticed this)”
- Xenquility 2:03 PM: “But Tyler goes to pick it up in Start Life'”
- Xenquility 2:03 PM: "That’s when he teleports and falls on the ground, where Greth runs at him”
- Xenquility 2:03 PM: "He didn’t seem to expect it to teleport him”
- Xenquility 2:03 PM: "in the end though I think we can all agree this is all Dense’s fault for playing goron lullaby”
- ARGdov 2:04 PM: "Lol”
- ARGdov 2:04 PM: "Ok so wait”
- Xenquility 2:04 PM: "Erika mentioned the mask somehow relating to Kevin due to its colouration”
- ARGdov 2:05 PM: "We assumed Tyler crossed over after he went into a trance, because he talked about crossing the bridge”
- ARGdov 2:05 PM: "And there was that weird voice call where someone spoke to us from tylers account, who said he had a “ceremony to get to””
- ARGdov 2:05 PM: "We assumed that may have somehow been tyler”
- ARGdov 2:05 PM: "Or another version of him or something”
- ARGdov 2:05 PM: "Although- wait”
- ARGdov 2:05 PM: "If tyler suddenly teleports soon after that he could still have ended up in that paralellos so it does fit”
- Erika_XP💚 2:07 PM: "My old pfp before I had to tweak it a bit to fit more to who I really am at heart”
- Erika_XP💚 2:07 PM: ((The image “erika.jpg” is posted))
- Xenquility 2:07 PM: "I mean the voice call was a good 4 months or so after he "Crossed the bridge"”
- Erika_XP💚 2:07 PM: "here is the one from now which I like a bit more ~<3“
- Erika_XP💚 2:07 PM: ((The image “Erika_more_complette.jpg” is posted))
11/30/19 - Chat with Erika (2)
- pakospooky 3:47 PM: “uh”
- Xenquility 3:47 PM: "Welcome”
- pakospooky 3:47 PM: "hey”
- Erika_XP💚 3:47 PM: "I have been waiting forever for this”
- Erika_XP💚 3:47 PM: "I am at last an actualized player of johnisdead”
- Xenquility 3:48 PM: "uh”
- Genius 3:48 PM: "how did you get in here”
- Xenquility 3:49 PM: ”(I invited her)”
- pakospooky 3:49 PM: “xen invited”
- Genius 3:49 PM: ”(oh)”
- Genius 3:49 PM: “(nvm)”
- Genius 3:49 PM: ”:sweat_smile:”
- Erika_XP💚 3:49 PM: “I invited myself you just took too long to give me the invitation thank you ^^”
- pakospooky 3:49 PM: ”:tyler7:”
- Erika_XP💚 3:50 PM: “Because you have given me this I can now safely give you something in return without it creating too much of an issue”
- Genius 3:50 PM: ”:dad:”
- pakospooky 3:50 PM: “:dad4:”
- Erika_XP💚 3:52 PM: "https://www.youtube.com/watch?v=25BPVB9LYEE”
- pakospooky 3:52 PM: "oh shitt”
- Xenquility 3:52 PM: "woah”
- pakospooky 3:52 PM: "how you did get thattt”
- Erika_XP💚 3:53 PM: "A friend nabbed it in mid production for me xp”
- Erika_XP💚 3:53 PM: "heheheh now I am playing around with big buttons saying this kind of stuff”
- Erika_XP💚 3:53 PM: "this is fun”
- Erika_XP💚 3:53 PM: "GOD this is so liberating”
- Erika_XP💚 3:53 PM: "OK ACTUALLY SCRATCH THAT apparently that one sens big waves still”
- Xenquility 3:56 PM: "Why?”
- Xenquility 3:56 PM: "well”
- Xenquility 3:56 PM: "actually”
- Xenquility 3:56 PM: "cool”
- pakospooky 3:57 PM: "thank you for the video”
- Xenquility 3:57 PM: "Anyways welcome!”
- Erika_XP💚 3:57 PM: "oh”
- Erika_XP💚 3:57 PM: "oh”
- Erika_XP💚 3:57 PM: "oh”
- Xenquility 3:57 PM: "We have cookies!”
- Erika_XP💚 3:57 PM: "ok”
- Erika_XP💚 3:57 PM: "I was losing my mind there ^^;”
- Xenquility 3:57 PM: "No worries”
- Xenquility 3:57 PM: "We all do sometimes”
- pakospooky 3:57 PM: ”:cookie:”
- Xenquility 3:57 PM: “SHHH”
- "About to fuck up” boy 3:58 PM: “HOW”
- Xenquility 3:58 PM: "anyways”
- Xenquility 3:58 PM: "No commenting on the video, I presume?”
- pakospooky 4:00 PM: "you can see all the hidden videos of quiet family?”
- Erika_XP💚 4:00 PM: "Would probably be the safest route for now, I was not expecting to make it so far today =]”
- Erika_XP💚 4:00 PM: "Was losing hope a few hours in really to be fair”
- "About to fuck up” boy 4:01 PM: “Ay welcome”
- "About to fuck up” boy 4:01 PM: “Didn’t see you here”
- Erika_XP💚 4:02 PM: "But my word what a pay off, the powers that be told me you were all just playing pretend in there and that was not where the real game was happening”
- Erika_XP💚 4:02 PM: "I am also good at playing pretend ^^”
- Eevee Reborn 4:03 PM: "Like green do ya?”
- Xenquility 4:04 PM: "My brain is honestly fucked at this point”
- Erika_XP💚 4:04 PM: "Its my favorite colour ~ :heart:”
- "About to fuck up” boy 4:04 PM: “Xen I feel you bro”
- ADULT_LINK 4:04 PM: "greens a good color”
- pakospooky 4:04 PM: "hahah”
- "About to fuck up” boy 4:04 PM: “Green is neat”
- "About to fuck up” boy 4:04 PM: “But orange is the best one”
- Xenquility 4:04 PM: "fuck yes slinky”
- "About to fuck up” boy 4:04 PM: “:jack_o_lantern:”
- pakospooky 4:04 PM: "because green is what you smoke”
- ADULT_LINK 4:04 PM: ”:orange_justice2:”
- “About to fuck up” boy 4:05 PM: “720”
- ADULT_LINK 4:05 PM: ”:720:”
- “About to fuck up” boy 4:05 PM: “:)”
- ADULT_LINK 4:05 PM: ”:BowMan:”
- Erika_XP💚 4:05 PM: “I have none of the devils lettuce myself personally but I am certain tyler does”
- Xenquility 4:05 PM: "By the way thank eevee for all of this she’s the only one who has a brain”
- "About to fuck up” boy 4:05 PM: “Oh shit I just remembered a Spanish meme”
- "About to fuck up” boy 4:06 PM: “That one”
- Eevee Reborn 4:06 PM: "Im gonna puke. It will be green. It will be good.”
- ADULT_LINK 4:06 PM: "my freind gave me a new pipe yesteday”
- ADULT_LINK 4:06 PM: "its nice”
- pakospooky 4:06 PM: "https://tenor.com/view/weed-snoop-dogg-getting-high-gif-5576061”
- pakospooky 4:06 PM: ”@ADULT_LINK”
- Erika_XP💚 4:07 PM: “I love when music does magic stuff like this”
- Erika_XP💚 4:07 PM: “https://www.youtube.com/watch?v=vle44kNHxDg”
- Erika_XP💚 4:07 PM: you just called up this song earlier”
- "About to fuck up” boy 4:07 PM: “Ay erika”
- "About to fuck up” boy 4:07 PM: “Which type of music u like”
- pakospooky 4:07 PM: "wtf is that”
- Erika_XP💚 4:08 PM: "you called it when you were looking for who’s that knowcking silly ^^”
- Erika_XP💚 4:08 PM: "and doug is busy knocking right now on a big green door”
- pakospooky 4:09 PM: "ahç”
- pakospooky 4:09 PM: "thats true”
- Erika_XP💚 4:09 PM: "where at? Hopefully somewhere that does not get opened ^^”
- pakospooky 4:09 PM: "the fucking notsobot”
- pakospooky 4:09 PM: "always trolling me”
- Xenquility 4:09 PM: "If he’s knocking at a big green door it could be the gate”
- Erika_XP💚 4:09 PM: "They do that sometimes when spirits work their way in”
- "About to fuck up” boy 4:09 PM: “On the big green Parallelos”
- "About to fuck up” boy 4:09 PM: “On jah I need a parallelos concept map”
- pakospooky 4:10 PM: "wow”
- "About to fuck up” boy 4:10 PM: “https://youtu.be/Vm7AfpveMJ0”
- pakospooky 4:11 PM: "https://vignette.wikia.nocookie.net/johnisdead/images/4/46/Symbol.png/revision/latest/scale-to-width-down/204?cb=20180920154218”
- Eevee Reborn 4:12 PM: "Three fingers”
- "About to fuck up” boy 4:12 PM: “Whaddup with that”
- Erika_XP💚 4:12 PM: “Now that I am in here I can say something I have never been able to say before. But I just realized”
- Erika_XP💚 4:12 PM: "you would all probably be happy to hear this now”
- "About to fuck up” boy 4:13 PM: “Huh? What’s that?”
- pakospooky 4:13 PM: "yeah three fingers because the img dont catch full the img”
- Erika_XP💚 4:14 PM: "I have a gift that lets me get as close to Tyler as I do that I have had to work very hard to foster and enjoy”
- "About to fuck up” boy 4:14 PM: “Like uh”
- "About to fuck up” boy 4:14 PM: “A necklace or something that reminds you of him?”
- pakospooky 4:14 PM: ”:Tyler5:”
- Xenquility 4:14 PM: “subtle”
- "About to fuck up” boy 4:14 PM: “Or uh a letter?”
- Erika_XP💚 4:15 PM: "No silly I am psychic =p”
- Xenquility 4:15 PM: "woah”
- Xenquility 4:15 PM: "alright what is he thinking right now”
- "About to fuck up” boy 4:15 PM: “:someoneisknockingatmydoor:”
- Erika_XP💚 4:15 PM: "thats parlor trickery and magic refuses to play under such conditions”
- pakospooky 4:15 PM: ”:Tyler4:”
- Xenquility 4:15 PM: “D:”
- Erika_XP💚 4:15 PM: "magic will not run as a rat through a maze”
- "About to fuck up” boy 4:16 PM: “Awoo”
- Xenquility 4:16 PM: "what about a hippo through a jungle?”
- Erika_XP💚 4:16 PM: "ok you made me giggle XD”
- "About to fuck up” boy 4:16 PM: “Ay Erika do you like punk? Or are you more onto green day and MCR”
- Erika_XP💚 4:17 PM: "ok just kidding I love mcr”
- "About to fuck up” boy 4:17 PM: “Oh lol”
- "About to fuck up” boy 4:17 PM: “I like a few Green Day songs but MCR is not my thing”
- Erika_XP💚 4:17 PM: "mcr is amazing and gerard way is cute”
- Xenquility 4:17 PM: "woah”
- "About to fuck up” boy 4:17 PM: “Sicko mode”
- "About to fuck up” boy 4:17 PM: “Damn”
- Xenquility 4:18 PM: "it’s okay”
- pakospooky 4:18 PM: ”:sexymansleeping:”
- “About to fuck up” boy 4:18 PM: “:GWeulixWar:”
- "About to fuck up” boy 4:18 PM: “:GWgoaMonikaSmug:”
- "About to fuck up” boy 4:18 PM: “:GWgoaThinken:”
- "About to fuck up” boy 4:18 PM: “TOO MANY ANIME GURLS”
- Eevee Reborn 4:19 PM: "Ok, now we have to summon a Belmont”
- Erika_XP💚 4:19 PM: "I love gerard way so much he helped me figure out I am psychic actually ^^”
- Erika_XP💚 4:19 PM: "https://www.youtube.com/watch?v=eN4bvQ1-UYA”
- Erika_XP💚 4:19 PM: "seee ~<3”
- "About to fuck up” boy 4:20 PM: “Gerard way?”
- "About to fuck up” boy 4:20 PM: “Sorry but uh who is Gerard way?”
- Xenquility 4:20 PM: "co founder of mcr iirc”
- Xenquility 4:20 PM: "Vocals too I think”
- Erika_XP💚 4:20 PM: "let me go get you one of my favorite pictures of Tyler ^^”
- Xenquility 4:21 PM: ”:Tyler2:”
- Erika_XP💚 4:21 PM: “hee hee ooops ^^”
- Xenquility 4:21 PM: "https://cdn.discordapp.com/attachments/639176086961389614/650446279041875968/a567b4a58c0fea8e38a572bd5b74fab4.jpg”
- "About to fuck up” boy 4:21 PM: “W h o w a a t h a t”
- "About to fuck up” boy 4:21 PM: “Oh”
- Erika_XP💚 4:21 PM: "oh now I might have done it”
- Erika_XP💚 4:21 PM: "Ill be back later”
- "About to fuck up” boy 4:22 PM: “K bai”
- Xenquility 4:22 PM: "Seeya”
- otherLiam 4:38 PM: "holy”
- otherLiam 4:38 PM: "what”
- otherLiam 4:38 PM: "she’s psychic.”
12/1/19 - Chat with Erika
- ((A player asks what the meaning of life is.))
- Erika_XP💚 11:21 PM: “That question is so boring "whatever you want” is also very cliche for an answer”
- Erika_XP💚 11:21 PM: “But it can be fun if you think about it long enough ~ :heart:”
- otherLiam 11:23 PM: "Do you have a better answer?”
- Erika_XP💚 11:24 PM: "lol no unless you want me to just say tyler or something”
- Erika_XP💚 11:24 PM: "would this be funny?”
- Erika_XP💚 11:24 PM: "I always wanted to be a comedian but I found myself more suited for a different role”
- Erika_XP💚 11:24 PM: "Im on my way to work right now by the way”
- Erika_XP💚 11:24 PM: "Was trying to jog but I got tired and decided to stop and read for a bit.”
- Wolfcat 11:26 PM: "how do we install Erika_Vista”
- Erika_XP💚 11:26 PM: "well not stop walking of course that would be silly then I would be late ^^”
12/2/19 - Chat with Erika
- Erika_XP💚 1:32 AM: “I want to test my powers just a bit because if I have not made it clear enough I also have a bit of hidden power. I just had to be careful showing it in my previous position.”
- Erika_XP💚 1:32 AM: "Would anyone like me to read a fortune?”
- Erika_XP💚 1:32 AM: "sorry if I do badly I dont often get the chance to try ^^;”
- Erika_XP💚 1:32 AM: "For anyone but myself anyways, but thats how reading works anyways so thats ok too I guess xp”
- otherLiam 1:33 AM: "Sure, I’m down.”
- otherLiam 1:33 AM: "How’s this work? Do I need to do anything?”
- Erika_XP💚 1:34 AM: "No no not at all just pick a person you might be caring about and Ill see what I can do”
- otherLiam 1:37 AM: "Alright. Well, the obvious first pick would be our mutual friend, Tyler.”
- pakospooky 1:37 AM: "hahahha”
- pakospooky 1:37 AM: "erika.exe”
- Erika_XP💚 1:38 AM: "Im not in the mood for talking about him outloud right now, wakes sleeping giants really ^^;”
- Erika_XP💚 1:38 AM: "Besides my connection with tyler is very personal >///>”
- otherLiam 1:38 AM: "Okay, then, someone else.”
- otherLiam 1:38 AM: "You’re in the main discord too, right? Any chance you could read “BUP”’s fortune?”
- pakospooky 1:39 AM: "what is the connection?”
- Erika_XP💚 1:39 AM: "OOOOOOOOooooooooooooo what a strange figure XD”
- otherLiam 1:39 AM: "Yeah he’s a weird one alright.”
- Erika_XP💚 1:40 AM: "this one might be tricky also but I’ll give it a quick try, he seems to be really far off to the edge of the sphere however, almost in his whole own bubble really ^^”
- ARGdov 1:41 AM: "It may be hard”
- Erika_XP💚 1:41 AM: "I’ll focus, brb”
- ARGdov 1:41 AM: "He may not be human after all”
- otherLiam 1:42 AM: "Good luck, be safe.”
- pakospooky 1:42 AM: "Erika knows that he put the Detour poster?”
- otherLiam 1:43 AM: ”?”
- otherLiam 1:51 AM: “hope nobody minds my pick btw, it was a tossup between bup and skm”
- pakospooky 1:53 AM: "Who set the detour signal?”
- Erika_XP💚 2:09 AM: "Awwww I miss him =”[ “
- Erika_XP💚 2:09 AM: “if its the fellow in the gas mask you are refering to”
- Erika_XP💚 2:09 AM: "also I was going to say I journeyed far on bup just now and cuold not see the forest through the trees on this one sadly”
- Erika_XP💚 2:09 AM: "I know he is of "something very foreign yet very close to home” as one just said”
- otherLiam 2:11 AM: “Well, it was worth a shot. Thanks for trying.”
- otherLiam 2:11 AM: "Wanna give it another go on someone else?”
- Erika_XP💚 2:12 AM: "I still have some power left ask away mate ^^”
- otherLiam 2:13 AM: "I’m still interested in hearing about SKM - we were supposed to hear from him recently and still haven’t.”
- otherLiam 2:13 AM: "I’m a bit worried.”
- Erika_XP💚 2:14 AM: ”“He makes large promises he can’t cash in on"”
- Erika_XP💚 2:14 AM: "Im hearing a lot”
- Erika_XP💚 2:14 AM: "one moment”
- otherLiam 2:14 AM: "Well, that’s not wrong.”
- otherLiam 2:14 AM: "Useful to know he bails on promises with others too, though.”
- Erika_XP💚 2:16 AM: "I’ll NOT have him bad mouthed he is a good man and that much I can feel”
- Erika_XP💚 2:16 AM: "One moment please ^^”
- otherLiam 2:17 AM: "Whoa, sorry, guess that came out wrong. I know he’s a decent dude. Just wants to do more than he can, I think.”
- Erika_XP💚 2:36 AM: "He has been trying to find some way to communicate for some time now I can see. But his appearances in this world become more and more phantom like. I hope he is not fading, I beg of yee oh god that his spirit might carry on!”
- Erika_XP💚 2:36 AM: "Nay say thee of the sphere, walkers of the lines, for imprints fade but with strange eons a soul may find aid, run now oh rosecrucian rose like the rain of the pettles of the ogdoad. Beauty fleeting unto sun lit night, awaken under luellas light. The masked lad shall find fearfully the glad.”
- Erika_XP💚 2:36 AM: ”“He has been withheld by the null thralls once more."”
- Erika_XP💚 2:36 AM: ”“Timelessly the promise is remembered as failed and redeemed."”
- Erika_XP💚 2:36 AM: ”“Forever awaiting the return."”
- Erika_XP💚 2:36 AM: ”“Passing brothers like a torch"”
- Erika_XP💚 2:36 AM: "I had to stop too many voices at once ^^;”
- Erika_XP💚 2:36 AM: "Now my head hurts D"X”
- Xenquility 7:00 AM: "Hey Erika, would you happen to have any clue of what the masked figure in "guidance.mp4” is doing?”
- Erika_XP💚 7:34 AM: “I don’t like that thing and I am sorry I had to be reminded x.x”
- Erika_XP💚 7:34 AM: "Walking home from work now btw, was an easy shift I guess ^^”
- Xenquility 7:36 AM: "Oh, sorry for reminding you. Didn’t realise it was that bad. Is it safe to assume that thing is not SKM?”
- Erika_XP💚 7:36 AM: "It collects trinkets”
- Erika_XP💚 7:36 AM: "Look at how much it carries really and just marvel for a moment”
- Erika_XP💚 7:36 AM: "Disgusting materialistic behavior, not fit for me or you I reckon rightly xp”
- Erika_XP💚 7:36 AM: "I wonder if he stole that mask at some point or gave it away first?”
- Erika_XP💚 7:36 AM: "Sorry I am confusing myself now ^^”
- Erika_XP💚 7:36 AM: "I think I could stand one more question, even though I never liked 4. This would be your 4th question if you asked now right? I’m awful at math with normal numbers <w<;”
- Xenquility 7:43 AM: "Hmm”
- Xenquility 7:43 AM: "One minute”
- Xenquility 7:43 AM: "What can you tell us about the white entity?”
- Erika_XP💚 7:51 AM: ”“The child"”
- Erika_XP💚 7:51 AM: ”“The young"”
- Erika_XP💚 7:51 AM: ”“The still boy"”
- Erika_XP💚 7:51 AM: "I have heard many whispering voices name it. It is an emination. A reflection. A energy sink. Also rather painful to think about ^^”
- Erika_XP💚 7:51 AM: "I have seen him in private without influence and he is rather sweet when un touched. It is disgusting to make him anything other than as he is, only filthy souls desire otherwise.”
- Erika_XP💚 7:51 AM: "Such are the words the whispering noise brings”
- Erika_XP💚 7:51 AM: "Wow that was very scary actually but now I feel excited and like I want to run very fast XD”
- Erika_XP💚 7:51 AM: "Now I feel a lot of energy because its not all negative energy their either with that one, he is good at heart :green_heart: “
- Erika_XP💚 7:51 AM: "I think I can answer one more and round it off to 5 actually”
- Erika_XP💚 7:51 AM: "Much better number for a well rounded time I really think~”
- Xenquility 7:56 AM: "Hmm”
- Xenquility 7:56 AM: ”(This is sort of a preliminary as to what we can ask so if this is going to act as the 5th question dont answer it) Are there any topIcs that you are forbIdden from answerIng? I just don’t want to rIsk anythIng bad happening from questionIng lol”
- Erika_XP💚 8:04 AM: “I just cant be as forward as I would like to yet ^^”
- Erika_XP💚 8:04 AM: "Ask questions, get answers. This feels like such an old and tired concept. But a short conversation is sometimes all I need to light my trail up (and my phone camera light because this street is always so dark for me) >m>;”
- Erika_XP💚 8:04 AM: "And I love proving to people I am serious business =d”
- Erika_XP💚 8:04 AM: "I dont just know a lot about Tyler, I know a LOT about his life and whats going on around him and I am always working on finding out more ^^”
- Xenquility 8:09 AM: "Well, if all hell breaks loose from asking this I’m sorry, but it’s one of the most important things we need to know right now. What can you tell us about the IIIIIIs?”
- Erika_XP💚 8:09 AM: "OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
- Erika_XP💚 8:09 AM: “OOOOOOOOOOOOOO you have asked such a WONDERFUL QUESTION”
- Xenquility 8:09 AM: "Okay cool”
- Xenquility 8:09 AM: "No one died from asking that”
- Erika_XP💚 8:09 AM: "I’LL BE RIGHT BACK I HAVE TO SPRINT”
- Erika_XP💚 8:21 AM: "UGLY YET BEAUTIFUL I RECKON :heart: :heart: :heart: :heart: :heart:”
- Erika_XP💚 8:21 AM: "God its so hard to explain it”
- Erika_XP💚 8:21 AM: "Dissolution but reformation”
- Erika_XP💚 8:21 AM: "Such a dynamic symbol really, very powerful (I know a lot about symbols actually) honestly this is not even making me have to use any power so I would hardly count this as a question”
- Erika_XP💚 8:21 AM: "the lines”
- Erika_XP💚 8:21 AM: "The many lines and the 5 that define”
- Erika_XP💚 8:21 AM: "I guess you could say it is something like one of these but on a smaller and less reality warping level when applied”
- Erika_XP💚 8:21 AM: ((An image of the alchemic “Tree of Life” is posted))
- Erika_XP💚 8:21 AM: "I spoiler this because this is actually really high magic I am not a fan of that can give you really spooky (read not good) results if played with in a silly way <.<;”
- Erika_XP💚 8:21 AM: "but so too are the lines”
- Xenquility 8:24 AM: "Who are the 5 that define the lines?”
- Erika_XP💚 8:26 AM: "No one people define the lines and that is part of what makes them so dangerous. When layed upon one it gives you access to 5 layers of being. However this is a really dumbed down explanation on the many angles that define this really powerful symbol.”
- Erika_XP💚 8:26 AM: "It is a key to understanding the absolute when correctly applied”
- Erika_XP💚 8:26 AM: "But it cannot be looked at with a flat mind”
- Erika_XP💚 8:26 AM: "I am not a super expert so I dont play with it too much ^^”
- Erika_XP💚 8:26 AM: "But I do actually use it when I am doing my psychic readings along with a few other little tricks (but those are my secrets I wont tell~)”
- Xenquility 8:29 AM: "Correct me if I’m wrong, but are you saying that when we interact with one we have access to all 5 layers?”
- Erika_XP💚 8:31 AM: "Well following the little bit of magic theory I have learned both in my reading (and a certain kind of class I sometimes go attend) You are any time you interact with anything at all so long as you are aware that you yourself are not not living ( I am paraphrasing a lot here xp)”
- Erika_XP💚 8:31 AM: "I am guessing though you are actually asking about @IIIII”
- Xenquility 8:33 AM: "Correct”
- Xenquility 8:33 AM: "You speak of five beings, does that make reference to the fifth element?”
- Erika_XP💚 8:33 AM: "I just felt something wierd in my head one moment ^^;”
- Erika_XP💚 8:33 AM: "That was an unpleasant feeling, I might have went too hard on myself earlier with all of the null gazing DX”
- Erika_XP💚 8:33 AM: "I wish I could lay down for a nap my eyes feel very tired now, but I have to keep walking I dont want to stay out here in the dark either =”[“
- Xenquility 8:36 AM: “Yeah, I wouldn’t recommend falling asleep outside”
- Erika_XP💚 8:36 AM: "I want to tell you something really crazy right now >w>”
- Erika_XP💚 8:36 AM: "But I dont know how ok this would be”
- Erika_XP💚 8:36 AM: "The five I's”
- Erika_XP💚 8:36 AM: "the five eyes”
- Erika_XP💚 8:36 AM: "As far as I can see the 5th is not just a who but a what”
- Xenquility 8:38 AM: "That’s uh”
- Xenquility 8:38 AM: "Ominous”
- Erika_XP💚 8:40 AM: "I dont wanna look too close but thats also because it would be really redundant for me to do that and thats silly”
- Erika_XP💚 8:40 AM: ”“If you look in the mirror and dont like what you see, you’ll find out first hand what its like to be me.” I once heard a voice whisper about the song of the 5th”
- Erika_XP💚 8:40 AM: “the 5 who feel they are dying”
- Erika_XP💚 8:40 AM: "Sorry my head is getting all funny and it makes me want to talk like a esoteric goof ball X)”
- Xenquility 8:42 AM: "That was the song playing in "The end"”
- Xenquility 8:42 AM: "Also, esoterics are cool.”
- Xenquility 8:42 AM: "Forgive me for being a luddite when it comes to esoterics, but could the five at all be referencing the concept of the aether?”
- Erika_XP💚 8:43 AM: "Well first I guess you have to ask what Aether is by your reckoning”
- Xenquility 8:45 AM: "I guess the space in which gods lived”
- Xenquility 8:45 AM: "Though (According to my probably-not-so-accurate sources) it’s also represented by the quintessence”
- Xenquility 8:45 AM: "Truthfully I hardly know about any of this so forgive me if I sound stupid”
- Erika_XP💚 8:46 AM: "OOO I love talking about gods and the absolute”
- Erika_XP💚 8:46 AM: "I’ll say most gods are personal beings on different scales that exist spaced out on the inside and outside of time and reform and take shape in many ways for individuals who need them for key things (or when they decide they want to depending on their attitude)”
- Erika_XP💚 8:46 AM: "the only thing that exists in a truly universal sense is the absolute (the only thing you will ever hear me simply call god)”
- Erika_XP💚 8:46 AM: "As far as I am able to directly see yes gods live here around and within the lines.”
- Erika_XP💚 8:46 AM: "Different people use different names a lot also for things so that can makes stuff confusing to, its easiest when you gain the power of eyes for the symbols as I have (for better and worse) then you can see the elements that relate between things instead of getting confused by redundancy”
- Erika_XP💚 8:46 AM: "Like, for example, I know of some people that call this place the "parallelos” I think it is?”
- Xenquility 8:52 AM: “Correct”
- Xenquility 8:52 AM: "Well, they use that term to denote alternate worlds I think”
- Xenquility 8:52 AM: "I could be wrong”
- Erika_XP💚 8:53 AM: "this would be a helpful word to apply however its a limited word that only functions in the context of one system. It can apply but it will not describe fully what it touches upon. Cool looking old wizard men have tried to write their words straight for hundreds of years but their pens just dance and dance to find a nice spot to stop and shake hands.”
- Erika_XP💚 8:53 AM: "Its so beautiful really =”]”
- Erika_XP💚 8:53 AM: “I could just swoon thinking about the evolution of language and magic and how linguistics is truly an art of spellcasting in and of itself ~<3”
- Erika_XP💚 8:53 AM: "but I think I am getting side tracked XD”
- Xenquility 8:55 AM: "Would it actually help our understanding to be studying these things?”
- Erika_XP💚 8:55 AM: "lol yes and no”
- Erika_XP💚 8:55 AM: "This world is very complicated, sometimes such things can give you minor insights to very odd sub realities. If you have the right kind of mindset you can even use such views to get an edge on things that may or may not be happening.”
- Erika_XP💚 8:55 AM: "YOU PROBABLY WONT BECOME PSYCHIC LIKE ME BECAUSE I AM: ” GIFTED THOUGH LOL”
- Xenquility 8:57 AM: “:(“
- Erika_XP💚 8:57 AM: "srry if that sounded mean <.<;”
- "About to fuck up” boy 8:57 AM: “Sup”
- Xenquility 8:57 AM: "Well my brain is sufficiently screwed”
- Erika_XP💚 8:57 AM: "Hello their mr slinky is it?”
- Erika_XP💚 8:57 AM: "OH lol mine too all the time XD”
- Erika_XP💚 8:57 AM: "All this magic talk has me so excited, but be careful its all also very dangerous if you dont be careful when treading such a world as magic. Remember to keep protected your own unique connection to that which you find as god in your heart and life. This is the default life line of the spirit that holds you from tottal corruptions (some completely lose this as I have been deeply painedto see with my own eyes D"x)”
- Erika_XP💚 8:57 AM: "Ill end off with this though, if you want to know of some people that know too much and yet not enough. It is the individuals Tyler called the "Lunar children"”
- Erika_XP💚 8:57 AM: "Bad people mixed with sad people”
- Erika_XP💚 8:57 AM: "very sad D"X”
- Xenquility 9:01 AM: "Speaking of which, any clue how to access their site?”
- Erika_XP💚 9:01 AM: "Andthey make mockeries of good gods”
- Erika_XP💚 9:01 AM: "their faith is farce”
- Erika_XP💚 9:01 AM: ”(but somehow still holds bits and pieces of important wisdom)”
- Erika_XP💚 9:01 AM: “As many do I have a patron who acts as my go between for absolute”
- Erika_XP💚 9:01 AM: "She is of roman origin”
- Erika_XP💚 9:01 AM: "And her linguistics path leads one too insanity XD”
- Erika_XP💚 9:01 AM: ”(or so they say)”
- Erika_XP💚 9:01 AM: “That being said may you have a good night my battery is getting low :heart:”
- Erika_XP💚 9:01 AM: "You all make me happy in this dark street ^^”
- Xenquility 9:05 AM: "Have a good night Erika”
11/22/19 - PM with Erika
- Erika_XP💚 10:15 PM: “I have been a bit scared to ask but did the internet detectives like my tribute I made for silentdork?”
- Erika_XP💚 10:15 PM: “oh wait”
- Erika_XP💚 10:15 PM: “I am such a ditz you were just asking about it before”
- Xenquility 10:17 PM: "Honestly I loved it. Never really listen ed to MCR beforehand but I’m starting to love them”
- Erika_XP💚 10:24 PM: “You wanted to know about where I got the video clips?”
- Xenquility 10:25 PM: "Yeah. None of us have any clue where they’re from.”
- Erika_XP💚 10:26 PM: "I’ll qoute my lil emo bean boi ~<3”
- Erika_XP💚 10:26 PM: "There’s things that I have done you NEVER”
- Erika_XP💚 10:26 PM: "should EVER KNOW”
- Erika_XP💚 10:26 PM: "lol”
- Xenquility 10:26 PM: "lol”
- Xenquility 10:26 PM: "Are we able to know though? I kinda love the clips of greth at the beginning”
- Erika_XP💚 10:27 PM: "I have a friend I think I mentioned a couple times”
- Erika_XP💚 10:27 PM: "He does not like me mentioning him and I honestly understand why now”
- Xenquility 10:28 PM: "How come?”
- Xenquility 10:28 PM: "Oi”
- Erika_XP💚 10:29 PM: "wut”
- Xenquility 10:29 PM: "C:”
- Xenquility 10:29 PM: "Didn’t get the full thing as I’m on my phone but”
- Xenquility 10:29 PM: "Anyways, any chance you could tell us where they got the vids from?”
- Erika_XP💚 10:34 PM: "A friend of mine who helps me get things when I really really want to see them very badly. But I dont think he would like to be introduced to strangers :p”
- Xenquility 10:34 PM: "Any chance of me becoming not a stranger?”
- Xenquility 10:34 PM: "I completely understand not wanting to talk to random people on the internet but at this time I could really go for meeting someone that is actually able to do something other than meme”
- Erika_XP💚 10:39 PM: "Does this mean you hate me because I happen to really love memes =”[“
- Xenquility 10:40 PM: “Oh god no I love memes too”
- Xenquility 10:40 PM: "Just seems that we lack extremely impressive allies right now”
- Xenquility 10:40 PM: ”(Other than you, of course :p)”
- Erika_XP💚 10:42 PM: “I mean I can show you my friends channel but he does not make his videos public and he will be grumpy I think if you comment or something. He is kind of upset right now I think too because his bro is late for something he said he was doing?”
- Erika_XP💚 10:42 PM: "Im not sure if he would have wanted me to even mention the last part either X"D”
- Xenquility 10:43 PM: "Actually that sounds great. I’ll make sure to respect his wishes and not comment or anything”
- Erika_XP💚 10:45 PM: "https://www.youtube.com/channel/UCxl4IYLd0GF5Ea9Xi6n2W7Q/featured”
- Xenquility 10:45 PM: "Oh cool”
- Xenquility 10:45 PM: "Don’t wanna seem pushy but if you’re able to link any of his video’s that’d be great”
- Xenquility 10:45 PM: ”(Don’t worry if that’s out of your friends comfort zone though)”
- Erika_XP💚 10:47 PM: “>.>” UH”
- Erika_XP💚 10:47 PM: “Nah mate dont think that would be the best idea right now, he pays close attention to the views. I think I might lose my cool setup with him if I did something like that. Then I would not be able to get my special tyler videos even if they end up corrupting a bit here and there by the time I download them and sometimes its not even tyler so it makes me take forever when I am trying to get anything in order to make a good music video for tyler.”
- Xenquility 10:50 PM: "Ah okay. No worries then”
- Xenquility 10:50 PM: "I won’t bug you about him anymore, but if there’s anything we could know about him in the future, think you could tell me?”
- Erika_XP💚 10:55 PM: "Im just happy to be in the internet detectives because it makes me feel like I am closer to Tyler”
- Erika_XP💚 10:55 PM: "you can ask me just about anything there.”
- Erika_XP💚 10:55 PM: "But I am not a big smarty pants about all sorts of things like you guys are, I just know a lot about Tyler.”
- Xenquility 10:56 PM: "How "Far away”?”
- Xenquility 10:56 PM: “We’re all pretty huge fans of Tyler (Though I doubt as huge as you are) and would be willing to do quite a lot to learn more about him”
- Erika_XP💚 11:01 PM: "Im about to go for a walk I just woke up and need to stretch my legs, but I’ll be back in a little bit when I clear my head. I got a lot of anxiety right now and I am also scared that maybe Tyler saw my video.”
11/30/19 - PM with Erika
- Xenquility 12:01 PM: “If you’re uncomfortable saying your theory in the discord, think you could say them here?”
- Erika_XP💚 12:01 PM: ((Erika sends and deletes a message about having a dream where Tyler is chasing her while having discolored eyes))
- Xenquility 12:01 PM: "A dream about Tyler chasing you?”
- Xenquility 12:01 PM: "I missed the part about his eyes”
- Xenquility 12:01 PM: "Trust me, don’t disregard your dreams”
- Erika_XP💚 12:01 PM: ((Erika sends and deletes multiple unknown messages))
- Erika_XP💚 12:50 PM: "I will show you one secret thing but you have to make a promise”
- Xenquility 12:51 PM: "A promise?”
- Erika_XP💚 12:52 PM: "do you remember what I need to have in order to speak better?”
- Xenquility 12:53 PM: "I’m not entirely sure”
- Xenquility 12:53 PM: "Could you remind me?”
- Xenquility 12:52 PM: "Is it something I can find on the discord or has it been deleted?”
- Erika_XP💚 12:57 PM: "It was”
- Xenquility 12:58 PM: ”“It was” as in it’s no longer there?”
- Xenquility 12:58 PM: “I’m not exactly sure what you mean”
- Erika_XP💚 1:00 PM: ”<a href="https://www.youtube.com/watch?v=UCCyoocDxBA">https://www.youtube.com/watch?v=UCCyoocDxBA</a>”
- Erika_XP💚 1:00 PM: “emo boi gerard took my words away with his first line >///>
- Erika_XP💚 1:01 PM: "I have always avoided saying anything un important when I can”
- Erika_XP💚 1:01 PM: "its a good habbit”
- Erika_XP💚 1:01 PM: "My mum taught me its the best way not to go looney XD”
- Xenquility 1:03 PM: "I can see where she’s coming from but this conversation seemed pretty important”
- Xenquility 1:03 PM: "You never told me the promise”
- Erika_XP💚 1:04 PM: "I already told you everything you need to know ^^;”
- Erika_XP💚 1:04 PM: “IIIhelpIII”
- Xenquility 1:05 PM: "Shit”
- Xenquility 1:05 PM: "Don’t fucking die”
- Xenquility 1:05 PM: "Do you need the song?”
- Erika_XP💚 1:08 PM: ”“Why cant we just be friends” its not that easy but its half of the fun WHEN YOU THROW THE FIRST PUNCH X3”
- Erika_XP💚 1:08 PM: “I have plenty of good music I am listening to right now actually ^^”
- Erika_XP💚 1:08 PM: "https://cdn.discordapp.com/attachments/639176086961389614/650399984751214606/Screenshot_144.png“
- Xenquility 1:10 PM: ”<a href="https://cdn.discordapp.com/attachments/639176086961389614/650399984751214606/Screenshot_144.png">https://cdn.discordapp.com/attachments/639176086961389614/650399984751214606/Screenshot_144.png</a>”
- Xenquility 1:10 PM: “You good?”
- Erika_XP💚 1:11 PM: "PLEASE DELETE THAT I THINK HE IS LOOKING”
- Erika_XP💚 1:11 PM: "SHHHHHHHH”
- ((IIIII begins counting up in the main discord, and stops when the screenshot is deleted))
- Erika_XP💚 1:24 PM: "I dont think he liked my snog but I dont think he knew what I meant either thankfully ^^”
- Xenquility 1:26 PM: "Oh also I’ve got a question”
- Xenquility 1:26 PM: "Have you editted your tribute video at all?”
- Erika_XP💚 1:31 PM: "OWO I have been working REALLY hard on a new one”
- Erika_XP💚 1:31 PM: "I have been listening to a lot of new music lately that feels like it talks so much about Tyler and his friends and his life”
- Xenquility 1:33 PM: "Do you know anything about that white figure we kept seeing?”
- Erika_XP💚 1:39 PM: "I remember you asking me something else but then i had a spook moment and i had to run a lil”
- Erika_XP💚 1:39 PM: "https://cdn.discordapp.com/attachments/639176086961389614/650399984751214606/Screenshot_144.png”
- Erika_XP💚 1:58 PM: "ok this is the most clear I think I can be with you here you. I have to be careful not to show the wrong colours.”
- Erika_XP💚 1:58 PM: ”<a href="https://youtu.be/Twp8XL0xzr0?t=71">https://youtu.be/Twp8XL0xzr0?t=71</a>”
- Erika_XP💚 1:58 PM: “When was the time? Why not search it?”
- Erika_XP💚 1:58 PM: "111”
- Erika_XP💚 3:33 PM: "https://youtu.be/A7P40vNkVr4?t=191”
- Erika_XP💚 3:33 PM: "remember what we talked about before?”
- Erika_XP💚 3:33 PM: "Sorry I was spacing out I am still pretty far away from home and I thnk its probably because I got myself turned around for a sec while jogging, ooops ^^;”
- Xenquility 3:36 PM: "I don’t recall the exact context of that question actually”
- Erika_XP💚Last Saturday at 3:37 PM: "thats ok I have to disapear for a bit, I think you will figure it out”
- Xenquility 3:37 PM: "Wait”
- Xenquility 3:37 PM: "Don’t leave for a minute”
- Xenquility 3:37 PM: "We have something”
- Xenquility 3:37 PM: "For you specifically”
- Erika_XP💚 3:37 PM: "hm?”
- Erika_XP💚 3:37 PM: "Oh boy a present of some kind? >w>”
- Xenquility 3:38 PM: "Indeed
- Xenquility 3:38 PM: ((The player Xenquility submits the New Wave Bossa Nova))
- Xenquility 3:38 PM: "Enjoy
- Xenquility 3:38 PM: "Hello?
- Erika_XP💚 3:43 PM: "I will now say rather plainly, would you kindly find for me a place I can disclose things without the prying eyes of one whom is possesed.”
12/4/19 - Chat with Erika
- Erika_XP💚: “I asked the powers that be to tell me of the character of Mr Dov Xd”
- Erika_XP💚: “https://youtu.be/urwNHZICOeE?t=54”
- Xenquility: "oh my god”
- Xenquility: "it really is”
- Erika_XP💚: "His essence in nature present in all its glory XD”
- Erika_XP💚: "Brb again for great lengths of time sadly though as I am walking home right now and need to just focus on that and my editing ^^”
12/6/19 - Chat with The Producer
- Wolfcat: "erika stuff is now in the timeline”
- ARGdov: “awesome”
- The Producer: "literally who”
- Xenquility: "whomst”
- Xenquility: "also hey prod”
- The Producer: "hello”
- Xenquility: "how's it feel to be called prod”
- Xenquility: ""Prod the Rod"”
- The Producer: "sounds kinda dirty”
- Xenquility: "any chance you could give us some more yummy spooky timeline dates”
- The Producer: "sure”
- The Producer: "how about this”
- The Producer: ((A long series of Discord emojis alternating between eggplants and “Grimacing Faces” are posted))
- Xenquility: "ooo”
- Xenquility: "retarded binary style?”
- Xenquility: "Yeah I assumed that after a while”
- The Producer: "but I guess it was still helpful to relfect anyways”
- Xenquility: "I'm guessing it was the last part?”
- The Producer: "yes”
- Xenquility: "Any chance we were close with our theorizing that night?”
- The Producer: "uh”
- The Producer: "im not sure”
- The Producer: “what were your theories”
- Xenquility: "(Also binary translates to "march 17, 2:00")”
- Xenquility: "Anyways uh”
- Xenquility: "The one we think for sure is that IIIII (The fifth) is definitely some sort of thing, not a person”
- The Producer: "why do you think that”
- Xenquility: "Well for one "literally who" said it”
- The Producer: "LW 1 2 or 3”
- The Producer: "im kidding”
- Xenquility: "and some message a while ago mentioned "for the freedom of (redacted in case you are going to fucking sell us out) Onward into IIIII"”
- The Producer: "well”
- The Producer: "i guess lllll could also be considered a thing”
- The Producer: "even I dont have a full grasp on their esoteric terminology”
- Xenquility: "Uh”
- Xenquility: "A parallelos or something?”
- The Producer: "maybe”
- The Producer: "perhaps just another rung on the ladder”
- The Producer: "not really my department”
- The Producer: "but I'm thinking about studying it”
- The Producer: "also not really my place to say”
- Xenquility: "when you say studying”
- Xenquility: "do you mean the Kabbalah or some other obscure thing we don't know about”
- The Producer: "not literally studying”
- The Producer: "metaphysically studying”
- Xenquility: "what in the name of fuck does that even mean”
- Xenquility: "By the way here's the timestamp info”
- The Producer: "¯\_(ツ)_/¯”
- The Producer: "im just the producer”
- The Producer: "but I have recently learned I do have the power to kill”
- The Producer: "to some extent”
- Xenquility: "uh”
- Xenquility: "How did you "learn" that?”
- The Producer: "Don't ask questions you already know the answer to.”
- Xenquility: "well that sounds nice”
- Xenquility: "alright who has died in the past few days”
- The Producer: "more like the past few years”
- Xenquility: "prod you little shit”
- The Producer: "hey”
- The Producer: "im just jokin”
- Xenquility: "are you though”
- The Producer: "kinda”
- Xenquility: "I mean”
- The Producer: "its not like i literally put a gun to his head or anything”
- Xenquility: "is there some sort of sign that will tell us it was you”
- Xenquility: "also nice job stealing quotes from your boss”
- The Producer: "sure”
- Xenquility: "k ima go nap then spend the rest of my night trying to figure out who you murdered”
- Xenquility: "thank you for the info”
- Xenquility: "to be honest figuring this stuff out is one of the few things that truly interests me these days”
- Xenquility: "thank you for the productions”
- The Producer: "no problem”
- The Producer: "I wouldnt really call myself a "murderer" given the circumstances”
- The Producer: "his death was already decided long ago”
- The Producer: "I just sifted the muddled waters”
- Xenquility: "so is this another situation where someone from the future killed someone in the past due to something that happened in the future?”
- Xenquility: "or a situation where someone from the future killed someone in the past due to something that happened in the past?”
- The Producer: "this was a situation where someone was always meant to die but I decided why not cut em off a little bit sooner”
- The Producer: "its better this way”
- Xenquility: "I doubt I'll get an answer but someone good or someone bad? (Relatively speaking to the goals of the IDs)”
- The Producer: "he seemed pretty good to me”
- The Producer: "its a shame it had to happen to him”
- Xenquility: "I mean I doubt this is correct as I've done literally zero research and am just pulling this out of my ass to rule it out but”
- Xenquility: "Was it Jeremy?”
- The Producer: "maybe”
- Xenquility: "should've seen that coming”
- The Producer: "do you really wanna know who it was”
- Xenquility: "yes but am I actually going to get the answer?”
- The Producer: "it was yuukichan again”
- The Producer: "killed her twice”
- Xenquility: "that joke would've been a lot funnier if you hadn't revealed it was a man you killed about three sentences ago”
- Xenquility: "unless they were actually a man this whole time”
- Xenquility: "DUN DUN DUN”
- The Producer: "maybe in another timeline”
- The Producer: "DUN DUN”
- The Producer: "anything is possible”
12/9/19 - Chat with The Producer and Erika
- Wolfcat: “https://www.youtube.com/watch?v=l_u18_BKczg”
- Wolfcat: “The average Johnisdead player”
- The Producer: "inaccurate”
- The Producer: "this is implying any brain activity takes place”
- otherLiam: "i mean, consider the facts:”
- otherLiam: “<a href="https://cdn.discordapp.com/attachments/453323274496245764/653655088476454933/image0.jpg">https://cdn.discordapp.com/attachments/453323274496245764/653655088476454933/image0.jpg</a>”
- otherLiam: “so really we’re doing it right”
- The Producer: "true”
- The Producer: "which is why i come here to smooth my brain out every now and then”
- ARGdov: "pfff”
- ARGdov: “I mean”
- otherLiam: "lemme get the sander”
- ARGdov: "some of us are trying to figure things out”
- ARGdov: "either way, hey Producer”
- ARGdov: "whats up”
- otherLiam: "internet smoothbrains here”
- The Producer: "im aware of this”
- The Producer: "which is why im here to act as your link”
- The Producer: "your steak in the ground”
- The Producer: "an unyeilding bastion of sense in these trying times”
- The Producer: "as everything i say makes sense”
- The Producer: "ill tell you this much - you are all in an very unfavorable position”
- The Producer: "things are very chaotic and fluid”
- ARGdov: "wait”
- otherLiam: "we’ve noticed”
- ARGdov: "you’re are link”
- ARGdov: ”*our”
- The Producer: “we’re all link”
- The Producer: "aren’t wek”
- The Producer: "and also we”
- otherLiam: "i dont think he means like that, Dov.”
- ARGdov: "as in the way Tyler was our link or no”
- ARGdov: "ok I just wanna be sure”
- The Producer: "non”
- ARGdov: "ok”
- ARGdov: “in any case”
- otherLiam: "Why help us?”
- ARGdov: "so, we’re in an unfavorable position”
- ARGdov: "is there anything we can do to fix that?”
- ARGdov: "you dont need to say what we should do”
- ARGdov: "but wether we CAN do something”
- ARGdov: ”(also knowing our position would be nice but I figure thats asking for the moon)”
- otherLiam: “we dont want the moon”
- otherLiam: "the moon is Bad”
- ARGdov: "lol true”
- ARGdov: "pun not intended”
- ARGdov: "welp, care to enlighten us, if you can?”
- The Producer: "im helping you because i pity you”
- The Producer: "and by unfavorable position I mean just everything that is happening”
- otherLiam: "hard oof”
- The Producer: "these are no longer linear mechanics we are dealing with”
- ARGdov: "I mean, time travels nothing new”
- ARGdov: "and well, yes”
- The Producer: "i cannot go into much detail”
- ARGdov: "I figured the unfavorable position related to "everything that is happening"”
- The Producer: "i cannot control context, only content”
- ARGdov: "right”
- ARGdov: "so is there anything we can do to alter our position?”
- The Producer: "well alright thats not 100% true I do have some influence but not as much as others”
- ARGdov: "I feel like telling us were fucked isnt really helpful”
- ARGdov: ”(also any idea whats going on with SKM? He vanished)”
- otherLiam: “We’re usually fucked.”
- otherLiam: "Like our default state is on the brink of disaster.”
- The Producer: "I can’t give you any straight answers but perhaps I can train you”
- The Producer: "prep your thinking”
- ARGdov: "Yeah were fucked all right “
- ARGdov: "and all for spite”
- ARGdov: "we can kiss our sorry ass goodbye”
- The Producer: "I’ll have to think this over though”
- ARGdov: "oh?”
- ARGdov: "alright…well, thank you”
- otherLiam: "no musicals”
- The Producer: "let’s get down to business”
- ARGdov: "what makes you think thats a musical? :v”
- ARGdov: "and yeah, ok”
- ARGdov: "no time for Spring Awakening, for once”
- ARGdov: "to defeat the huns?”
- otherLiam: "He’s gonna “produce” us some functioning brains”
- ARGdov: "sweet”
- The Producer: "im not a miracle worker”
- otherLiam: "lol”
- otherLiam: “i mean im pretty sure you actually are, given your job is to make shit for crazy magical entities”
- ARGdov: "man remember when most of the people we met had proper physical bodies that they were born with”
- ARGdov: "I sure do”
- ARGdov: "good times”
- otherLiam: "no”
- otherLiam: "im an id zoomer”
- otherLiam: "by the time i came in we were already mostly dealing with ghosts”
- ARGdov: "yup”
- The Producer: "I assure you I am very fleshy”
- ARGdov: "which I suppose is a sign of how shit we are at this lol”
- ARGdov: "well, ok”
- ARGdov: "fine”
- ARGdov: "man remember when most of the peopel we met had proper physical bodies and didnt have freakish magic powers”
- The Producer: "quite fleshy, in fact”
- otherLiam: "You said you only produce things that are interesting to you, right?”
- The Producer: "yes”
- ARGdov: "wait is the producer Janet”
- ARGdov: "from the good place”
- otherLiam: "And given that you pity us, you must think we dont have much of a chance.”
- ARGdov: ”(im sorry, I dont meant to keep shitposting)”
- Erika_XP💚: “"man remember when most of the peopel we met had proper physical bodies"”
- Erika_XP💚: "Are you making a commentary on the evolution of european man now good sir?”
- ARGdov: "uh no”
- otherLiam: "Would trying to produce something that would give us a fighting chance be an interesting enough problem for you?”
- ARGdov: "Im talking about the fact when this started we were in contact with mostly regular people who mostly didnt have supernatural powers”
- The Producer: "maybe”
- The Producer: "you will always have a fighting chance”
- Erika_XP💚: "we often say thngs we dont want to even when we try to say nothing at all, this is the pain of seeing things with the powers for I know them in every angle by which they can be seen”
- ARGdov: "european men have proper af physical bodies”
- ARGdov: "in fact, I was in europe this past summer, european bodies are looking fit af I can assure you”
- ARGdov: "and really?”
- ARGdov: "what do you see now”
- Erika_XP💚: "Oh I am interrupting something I think, that is alright I need to continue my walk and get my own business done so pardon me XD”
- otherLiam: "Sure, but right now we’re kinda fighting blind against a lot of factions way more knowledgeable and powerful than us.”
- ARGdov: "yeah”
- Erika_XP💚: "head has felt rather odd for the last few days anyways ^^”
- Erika_XP💚: "allow me now to go try and clear it”
- The Producer: "a good idea for all to do”
- The Producer: "and also compartmentalize”
- The Producer: "what are all of the factions you are fighting against?”
- ARGdov: "well, its hard to say”
- ARGdov: "theres alternate dimension regiminis (whos name currently escapes me) “
- ARGdov: "and theres the IIIII entities, who may be connected to them”
- otherLiam: "The Lunar Children are making noise, Nocta’s AO crew are still out there, and now BUP’s around too.”
- ARGdov: "and then there’s you lot”
- otherLiam: "And the IIIII’s, too, yeah.”
- otherLiam: "The LC are behind a password so we dont even know what they’re doing, Nocta’s hiding and we’re waiting on other people to get into his hiding place, and we have no idea what BUP or the IIIII’s are.”
- otherLiam: "So yeah. Fighting blind.”
- ARGdov: "its possible, who evers got the LC servers isnt technically LC”
- ARGdov: "because last we checked most of them had kicked the bucket”
- The Producer: "it certainly sounded like they all disappeared in 2016”
- The Producer: "well”
- The Producer: "maybe not all”
- Xenquility: "Oh hey prod”
- The Producer: "yea”
- ARGdov: "a good chunk”
- ARGdov: "the people at the lunar spire anyways”
- ARGdov: "and someone else eventually found the LC servers in the fishery”
- otherLiam: "And now that guy is awol”
- otherLiam: "as is skm”
- The Producer: "right”
- The Producer: "Jose”
- ARGdov: ”?”
- The Producer: “archive guy”
- The Producer: "he got drezzed outta commission for a while”
- otherLiam: "Who did that?”
- The Producer: "more like "who didn’t do that"”
- The Producer: "i mean he fell out of relevancy”
- The Producer: "i didnt mean it literally”
- The Producer: "or really whats the difference tbh”
- otherLiam: "I mean, us not paying attention to him shouldn’t cause him to suddenly not exist. His email’s been deactivated and both the sites he supposedly owns are now locked down.”
- The Producer: "true, maybe not you guys paying attention to him did it”
- The Producer: "but”
- The Producer: "well, nevermind”
- The Producer: "as for the lllll's”
- The Producer: "like i said, the lllll is kinda ourguy”
- The Producer: "but at the same time Im not sure exactly how to define it”
- The Producer: "the others even less so”
- The Producer: "this is something I must look into”
- The Producer: "i suddenly feel like all this is accomplishing is confusing you further”
- The Producer: "remember the good old days when the struggle was as simple as one crazed man just trying to #riseup and gain p o w e r”
- The Producer: "though to be fair that description could fit multiple people”
- The Producer: "most of them have the same goal”
- The Producer: "but each has a different way they go about it”
- The Producer: "a method to the madness of each individual”
- ARGdov: "I mean, one man attempting to #riseup also invovled some complicated shit
- but not like this”
- ARGdov: "and true I suppose”
- The Producer: "and now some truly forbidden truths have been uncovered by some very dangerous individuals”
- The Producer: "and they seek the True Ascension”
- The Producer: "but that is getting into some very dangerous territory”
- The Producer: "this twisted path will become clear in due time”
- ARGdov: "by True Ascension do yu mean Transcendence”
- ARGdov: "is there anything we an do until then?”
- ARGdov: "and will it be too late by that point”
- Jos: "Hello”
- The Producer: "you all will have your chance to #riseup”
- The Producer: "but not yet”
- The Producer: "in the meantime”
- The Producer: "compartmentalize”
- The Producer: "layer your thinking”
- The Producer: "you can only make it to the end of the path one step at a time”
- The Producer: "and now im gonna get back to work”
- ARGdov: "compartmentalize and layer our thinking”
- ARGdov: ”…ok”
- ARGdov: “welp, enjoy plotting our eminent failure I uess”
12/23/19 - Chat with Erika
- Erika_XP💚 11:59 PM: “goodnight saturnus”
- Xenquility 11:59 PM: "Oh hey erika”
- otherLiam 12:00 AM: "Saturnus?”
- Xenquility 12:00 AM: "Is Saturnus your patron?”
- Erika_XP💚 12:00 AM: "oh no that would be far too advanced and scary XD”
- Erika_XP💚 12:00 AM: "really very very scary forget I even mentioned that name I just had to be sure the worst of the energy was sent off in his final minute of the year by which he positions himself on the throne”
- Erika_XP💚 12:00 AM: "I have learned far too much waiting around by those buildings where I listen to the voices when they are present”
- Xenquility 12:03 AM: "That sounds rather ominous”
- Xenquility 12:03 AM: "What buildings?”
- Erika_XP💚 12:04 AM: "on the opposite end of where I work but I ought not to dox myself xp”
- Xenquility 12:05 AM: "Sorry if this name is the equivalent of satan spawn or something but would you happen to know anything about this new wintertidedreams/harvestmemories guy?”
- Xenquility 12:05 AM: "On a related note other than the first join date of dec 12 the joining and posting of WintertideDreams fits within the festival of Saturnalia”
- Erika_XP💚 12:18 AM: "A saturnian manifestation I can sense, duality of joy and sorrow. A trickster guide manifest. The laughter of the old man, his stone faced tears in solemn silence.”
- Erika_XP💚 12:18 AM: "Thinking about this makes my head hurt really bad all over the left side ^^;”
- Erika_XP💚 12:18 AM: "or maybe its the right?”
- Erika_XP💚 12:18 AM: "It sort of swings back and forth idk Xd”
- Xenquility 12:20 AM: "alright on a lighter note”
- Xenquility 12:20 AM: "How’s your tribute video?”
- Xenquility 12:20 AM: "I don’t mean to seem like im rushing just trying to change to a lighter subject”
- Erika_XP💚 12:20 AM: ((Erika posts a message about “reality distorting” but quickly deletes it))
- Xenquility 12:20 AM: "uh”
- Xenquility 12:20 AM: "something about reality warping?”
- Erika_XP💚 12:22 AM: "Its been a big undertaking but I now know Tyler must really love them I can say that very safely.”
- Xenquility 12:23 AM: "So he’s doing well?”
- Erika_XP💚 12:22 AM: "Now I am getting to see him a bit more often, soon enough I can reach and” ((This message was later deleted))
- Erika_XP💚 12:24 AM: "I dont know D"X”
- Xenquility 12:26 AM: "is it dangerous to be mentioning that "Thing”? The saturnian manifestation”
- Erika_XP💚 12:27 AM: “Well magic gains just from talk of it I think but you must sometimes speak before you can watch”
- Erika_XP💚 12:27 AM: "Atleast thats a line I once heard”
- Xenquility 12:29 AM: "now that Saturn has been "Sent off” will the manifestation follow?”
- Xenquility 12:29 AM: “Or is it still a concern?”
- Erika_XP💚 12:29 AM: "https://www.youtube.com/playlist?list=LLNs8FfkNOu9UYv54uzinyHw”
- Erika_XP💚 12:29 AM: "What do you think of my music tastes >w>”
- Xenquility 12:30 AM: "I saw those earlier lol”
- Xenquility 12:30 AM: "Lost dreams is pretty cool”
- Xenquility 12:30 AM: "Any particular song you like the best?”
- Erika_XP💚 12:34 AM: "would it be silly if I said almost everything in the playlist has some small angle of meaning in my mind and really its hard for me to pick favorites?”
- Xenquility 12:35 AM: "Ah that makes sense”
- Xenquility 12:35 AM: "I’d say it’s hard not to find meaning in things these days”
- Xenquility 12:35 AM: "My main problem is being able to tell what’s truly important if anything”
- Wolfcat 12:40 AM: "What does the Pumpkin witch album mean to you”
- Erika_XP💚 12:41 AM: "I really like pumpkins and enjoy the spoopy traditions around them Xd”
- Erika_XP💚 12:41 AM: "even if some do not”
- Erika_XP💚 12:41 AM: "I always hated the band smashing pumpkins though”
- Erika_XP💚 12:41 AM: "just to be clear”
- Xenquility 12:42 AM: "wow”
- Xenquility 12:42 AM: "okay”
- Xenquility 12:42 AM: "I’ve got a question”
- Xenquility 12:42 AM: "Would we be able to find out the identities of the five that define IIIII?”
- Erika_XP💚 12:44 AM: "they are symbolic beings, or rather archtypes”
- Erika_XP💚 12:44 AM: "I know that much”
- Xenquility 12:45 AM: "So not specific people?”
- Erika_XP💚 12:45 AM: "they can be depending on the time I think”
- Erika_XP💚 12:45 AM: "I dont really know how to explain it, I just know I meditated on them in a book I read once (I think but its hard to remember)”
- Erika_XP💚 12:45 AM: "I just understand it I guess xd”
- Erika_XP💚 12:45 AM: "I have a screeching head ache one moment all ^^;”
- Wolfcat 12:48 AM: "of course i did”
- Xenquility 12:48 AM: "Man”
- Xenquility 12:48 AM: "I feel like some forces really don’t want us to understand these guys”
- Xenquility 12:48 AM: "At this point, should we bother trying to understand the IIIIIs? Or is it just a waste of time at the moment?”
- Erika_XP💚 12:56 AM: "The more you meditate on something the better you will understand it, but I have learned to be careful. They are what you eat they say”
- Erika_XP💚 12:56 AM: "Which is to say you become that which you meditate upon XD”
- Xenquility 12:57 AM: "they are what you eat”
- Xenquility 12:57 AM: "So we’ll become IIIII if we think about it xd”
- Erika_XP💚 12:57 AM: "oh wait sorry I worded that poorly, I have had a bit of the drink Ill admit ^^;”
- Erika_XP💚 12:57 AM: "meant to say you ARE what you eat xd”
- Xenquility 12:58 AM: "does that mean if we meditate about becoming an interdimensional power lord we’ll become one?”
- Xenquility 12:58 AM: "because that seems like a really easy solution lmao”
- Erika_XP💚 12:58 AM: "Its a bit more complicated than that”
- Xenquility 12:58 AM: "aw”
- Erika_XP💚 12:59 AM: "You had better have a very well planned idea of what that is or you will become the illusion of this”
- Xenquility 12:59 AM: "Could i become megamind”
- Erika_XP💚 1:01 AM: "In a way if you really really wanted to but it would be really silly and you would never have a litteral transformation of any form”
- Xenquility 1:01 AM: "Ah damn”
- Xenquility 1:01 AM: "wait”
- Xenquility 1:01 AM: "are you trying to become tyler”
- Erika_XP💚 1:02 AM: "But if thats fun for you I suppose you could but I have seen horrible examples of people who play with that sort of magic and let it take them from kings to paupers”
- Erika_XP💚 1:02 AM: "if they stay too silly too powerfully for too long that is”
- Erika_XP💚 1:02 AM: "Now I am just rambling on my very limited free time though Xp”
- Erika_XP💚 1:02 AM: "There is so much I could tell you really but I am a bit frustrated”
- Xenquility 1:03 AM: "What’s wrong?”
- Erika_XP💚 1:04 AM: "I should not complain, its no ones fault but mine for not working to make it more clear but I like anything that gets me closer to Tyler XD”
- Xenquility 1:05 AM: ”(I would still like a confirmation that you’re not trying to become tyler)”
- Erika_XP💚 1:05 AM: “that would be weird >////>;”
- Erika_XP💚 1:05 AM: "There are already enough people who probably wish they were Tyler though”
- Erika_XP💚 1:05 AM: "I just wish I could hug him one time really”
- Xenquility 1:06 AM: "dont we all”
- Xenquility 1:06 AM: "that greth guy is pretty hunky too”
- Xenquility 1:06 AM: "wish he wasnt possessed”
- Xenquility 1:06 AM: "or back in time”
- Erika_XP💚 1:08 AM: "I really think he is nice and would not mind having a conversation with him”
- Erika_XP💚 1:08 AM: "but I’ll admit I added him in my first video because I wanted to do one about tyler and did not know who he was till videos of him started showing up and I was too embarrased to make it just about tyler anyways so yeah not that I think he is a bad guy I just idk Illshutup now”
- Erika_XP💚 1:08 AM: "lol want me to show you something I never point out to people but you guys are really obsessed with this one numerology thing right?”
- Xenquility 1:10 AM: "Sure”
- Erika_XP💚 1:10 AM: "ok I said a secret in the description of my video”
- Erika_XP💚 1:10 AM: "I was gonna delete that before but then everyone saw it >>;”
- Xenquility 1:12 AM: "In the description?”
- Erika_XP💚 1:14 AM: "I never told you what I do for a living?”
- Xenquility 1:14 AM: "No”
- Erika_XP💚 1:21 AM: "Well because I am psychic I can tell you with certainty Tyler is a clerk of some sort”
- Erika_XP💚 1:21 AM: "I guess the most honest thing I can say is I like to hunt vampires above all else”
- Xenquility 1:22 AM: "wait what the fuck”
- Erika_XP💚 1:23 AM: "mead is a really tasty thing”
- Xenquility 1:23 AM: "okay so quick question”
- Xenquility 1:23 AM: "what century do you live in”
- otherLiam 1:23 AM: "Xen, you mean you don’t know about vampires?”
- Erika_XP💚 1:23 AM: "12/24/2019 is what the date says right here at the corner”
- Xenquility 1:24 AM: "I mean I think I do“
- otherLiam 1:24 AM: "and yeah dude mead is delish”
- Erika_XP💚 1:24 AM: "but sometimes I put away the time because it gives me anxiety ^^”
- Xenquility 1:25 AM: "oh erika got a question”
- Xenquility 1:25 AM: "what’s with the new profile picture and background”
- Erika_XP💚 1:27 AM: "Its my avi and a picture that reminds me of how I look without me having to take a picture of myself (that would weird and embarrassing on the internet) ^^;”
- Xenquility 1:27 AM: "ah okay”
- otherLiam 1:28 AM: "So, Erika. Is being a psychic something one can learn? Or are you just born that way?”
- Erika_XP💚 1:28 AM: "It happens when you want it too hard enough sometimes I think but some are born that way and then dont know what to do about it I guess”
- Xenquility 1:29 AM: "So theoretically”
- Xenquility 1:29 AM: "Could we become psychic”
- Erika_XP💚 1:29 AM: "please dont try that hard XD”
- Xenquility 1:29 AM: "Aw”
- Erika_XP💚 1:31 AM: "Vampires tell people they can have that power and then leave them to figure out what to do with it all on their own when they are very confused, even if vampires pretend they dont know what the hell they are doing that is fucking awful to say the least”
- Erika_XP💚 1:31 AM: "sorry I am feeling extra goofy tonight Xd”
- Erika_XP💚 1:31 AM: "OK OK do you want me to show you the secret I mentioned”
- Erika_XP💚 1:31 AM: "I’ll warn you its a long rabbit hole and I am not going to show off too much”
- Xenquility 1:34 AM: "Sure”
- Erika_XP💚 1:34 AM: ”<a href="https://www.youtube.com/watch?v=eN4bvQ1-UYA">https://www.youtube.com/watch?v=eN4bvQ1-UYA</a>”
- Erika_XP💚 1:34 AM: “oops wrong video”
- Erika_XP💚 1:34 AM: "sorry XD”
- Erika_XP💚 1:34 AM: "but its a big part of how I come to know Tyler better but thats a big big secret” ((This message was later deleted))
- Xenquility 1:34 AM: "No worries”
- Erika_XP💚 1:35 AM: “https://www.youtube.com/watch?v=SMTKbZKnXzU&list=LLNs8FfkNOu9UYv54uzinyHw”
- Erika_XP💚 1:35 AM: "woops wrong again omg XD”
- Xenquility 1:35 AM: "stalker”
- Xenquility 1:35 AM: "gg”
- Erika_XP💚 1:36 AM: "ok this is almost impossible to explain”
- Erika_XP💚 1:36 AM: "but my psychic power runs through connections I can make because I am gifted with the sight of those connections”
- Erika_XP💚 1:36 AM: "ok my first liked video”
- Erika_XP💚 1:36 AM: "its like that for a reason XD”
- Xenquility 1:40 AM: "Ah”
- Erika_XP💚 1:41 AM: "He was always going to be known of in certain places because a "likewise energy” called him there”
- Erika_XP💚 1:41 AM: “pay attention for one of your favorite numbers”
- Erika_XP💚 1:41 AM: "https://youtu.be/Ud2eziOjjTo?t=257”
- Xenquility 1:42 AM: "oh shit I watched this earlier today”
- Xenquility 1:42 AM: "damn good concert”
- Erika_XP💚 1:43 AM: "Its not as good as you think I have seen waaaaaayyyyyyyy too much ^^;”
- Erika_XP💚 1:43 AM: "yeah I love it too”
- Xenquility 1:44 AM: "anyways is it supposed to send me to 4:17 or was that just my auto timestamp thing youtube does”
- otherLiam 1:45 AM: "no its timestamped.”
- otherLiam 1:45 AM: "in the url”
- otherLiam 1:45 AM: "see at the end there, t=257.”
- Xenquility 1:45 AM: "oh cool”
- otherLiam 1:46 AM: "thats 257 seconds, or 4 minutes and 17 seconda.”
- Erika_XP💚 1:46 AM: "in 6 seconds from that point a certain explosion occured”
- Xenquility 1:46 AM: "Switches to Dead!”
- Erika_XP💚 1:46 AM: ”“The Wells are far deeper than the Ways I walk be long"”
- Erika_XP💚 1:46 AM: ”- an old proverb I once heard idk where tho lol”
- Xenquility 1:47 AM: “LOL”
- Xenquility 1:47 AM: "Switches to "Dead!” at 4:23”
- Xenquility 1:47 AM: “The IIIII’s believe they’re currently dying”
- Xenquility 1:47 AM: "Their song is "The End"”
- Xenquility 1:47 AM: "But on 4/23 it switches to "Dead!"”
- otherLiam 1:47 AM: "hmm.”
- Xenquility 1:47 AM: "subtle”
- Erika_XP💚 1:48 AM: "5 guys burgers and fries is a fantastic resturaunt but its a shame the one I am passing by looks like its closing”
- otherLiam 1:49 AM: ”…wait.”
- otherLiam 1:49 AM: “are you saying there’s more IIIII’s out there?”
- Xenquility 1:49 AM: "wait what?”
- otherLiam 1:49 AM: "5 Guys.”
- otherLiam 1:49 AM: "IIIII Guys.”
- Xenquility 1:50 AM: "hi wolf”
- Xenquility 1:50 AM: "also that could either just be referencing the normal IIIII”
- Xenquility 1:50 AM: "and the fact they’re dying”
- Xenquility 1:50 AM: ”(or “closing) or it’s literally a reference to five guys”
- otherLiam 1:50 AM: ”(also hell yeah 5 guys top tier burgers)”
- Xenquility 1:50 AM: “definitely best fast food-esque burger”
- Genius 1:50 AM: "Dead as in deadhead”
- Xenquility 1:50 AM: "oh deadhead”
- Genius 1:50 AM: "Probably nah”
- Xenquility 1:50 AM: "I have a question”
- Xenquility 1:50 AM: "are you spanish”
- Genius 1:51 AM: "No”
- Xenquility 1:51 AM: "k”
- Erika_XP💚 1:51 AM: "someone once told me something really funny about vampires that I always have to laugh very hard about when I realize it”
- otherLiam 1:52 AM: "When you say “vampires””
- Erika_XP💚 1:52 AM: "they have no reflections”
- Xenquility 1:52 AM: ”“When you look in the mirror and don’t like what you see"”
- Erika_XP💚 1:52 AM: ”“BECAUSE THEY ARE FCUKING POSERS"”
- otherLiam 1:52 AM: "lol”
- Erika_XP💚 1:52 AM: "That was in a dream maybe but I am not sure”
- Erika_XP💚 1:52 AM: "fuck it I am gonna just break everythign tonight I am feeling silly and tired too XD”
- Erika_XP💚 1:53 AM: "but I wont walk off road left or right”
- Xenquility 1:54 AM: "Break everything?”
- Wolfcat 1:54 AM: "That would be unwise”
- otherLiam 1:54 AM: "nah fuck it break stuff”
- otherLiam 1:54 AM: "what could possibly go wrong”
- Xenquility 1:54 AM: "erika I dont want to see you getting locked in the slammer”
- Xenquility 1:54 AM: "don’t do it”
- Xenquility 1:54 AM: "it’s the mead talking not you”
- otherLiam 1:54 AM: "mead is good”
- Wolfcat 1:55 AM: "break it”
- Wolfcat 1:55 AM: "https://www.youtube.com/watch?v=YA1JmDE_1QM”
- otherLiam 1:55 AM: "i wish i had mead”
- Xenquility 1:55 AM: "wenches are better”
- otherLiam 1:55 AM: "https://m.youtube.com/watch?v=ZpUYjpKg9KY”
- otherLiam 1:55 AM: “i already have those”
- Xenquility 1:55 AM: "https://www.youtube.com/watch?v=AjPau5QYtYs”
- Xenquility 1:55 AM: "do the safety dance”
- Xenquility 1:55 AM: "don’t break stuff”
- Erika_XP💚 1:57 AM: "ok I should not show this lol”
- Xenquility 1:57 AM: "whatever it is”
- Xenquility 1:57 AM: "show it”
- Erika_XP💚 1:57 AM: "he wanted to delete this after so bad but it was too late because it was already on dvd”
- Xenquility 1:57 AM: "is it damon albarn getting mad on stage”
- otherLiam 1:58 AM: "yo we out here on the old data storage”
- Erika_XP💚 1:58 AM: "it ruined his whole ritual LOL”
- Erika_XP💚 1:58 AM: "well not completely but it messed it up enough I guess”
- Erika_XP💚 1:58 AM: "https://youtu.be/Ud2eziOjjTo?t=309”
- Erika_XP💚 1:58 AM: "play this in slow motion”
- Erika_XP💚 1:58 AM: "and be careful who you try to talk to about this please ^^;”
- Wolfcat 2:00 AM: "nice recovery tho tbh”
- Erika_XP💚 2:01 AM: "too many naughty things on his way to mexico, not enough energy, had to use a backing track its understandable considering this was supposed to be the big one. I think other people have made very similar mistakes actually but I wont name names XD”
- Xenquility 2:01 AM: "oh damn”
- Xenquility 2:01 AM: "that’s brutal”
- Erika_XP💚 2:03 AM: "have I ever showed you my favorite picture of Tyler btw?”
- Xenquility 2:04 AM: "I think you tried and then proceeded to post a picture of gerard way”
- Erika_XP💚 2:04 AM: "LOOOOOOL”
- Erika_XP💚 2:04 AM: "I just remembered one of my favorite old songs by him”
- Erika_XP💚 2:04 AM: "https://www.youtube.com/watch?v=c0Z6HyYSYwA”
- Xenquility 2:08 AM: "drowning lessons”
- Xenquility 2:08 AM: "subtle”
- Erika_XP💚 2:09 AM: "I am showing you a certain kind of magic that has to be followed and can only be controlled at the right times”
- Xenquility 2:10 AM: "external song magic?”
- Erika_XP💚 2:10 AM: "I man with a name that sounded like sink mentioned it once I think”
- Xenquility 2:10 AM: "slink xd”
- Erika_XP💚 2:10 AM: "lol no”
- Xenquility 2:11 AM: "wait lol no to slink or to external song magic”
- Xenquility 2:11 AM: "or both”
- Erika_XP💚 2:12 AM: "its even one of your favorite numbers to as well”
- Xenquility 2:12 AM: "man”
- Xenquility 2:12 AM: "I feel like that whole 423 thing is important”
- Erika_XP💚 2:12 AM: "aw drink all gone DX”
- Xenquility 2:12 AM: "or is this more numerology magic”
- Erika_XP💚 2:13 AM: "look I am cranky a little so forgive me if I end up saying too much ^^;
- Erika_XP💚 2:13 AM: "I get sick of people who lie
- Erika_XP💚 2:13 AM: "you have no idea how much I can see just by looking down any one path
- Erika_XP💚 2:13 AM: "I just choose the funny ones to make myself laugh a bit
- Erika_XP💚 2:13 AM: "https://www.youtube.com/watch?v=Gyu_hqpxj8M
- Erika_XP💚 2:13 AM: "I tried following some older stuff but that got boring I actually dont like that much classic rock but it all ends up going the same way no matter where I am looking
- Erika_XP💚 2:13 AM: "I do like old poetry though
- Erika_XP💚 2:13 AM: "but he always gets dark with that too ^^;
- Erika_XP💚 2:13 AM: “wait a minute
- Erika_XP💚 2:13 AM: ”Today at 2:03 AM: "have I ever showed you my favorite picture of Tyler btw?””
- Erika_XP💚 2:13 AM: “XenquilityToday at 2:04 AM: "I think you tried and then proceeded to post a picture of gerard way””
- Erika_XP💚 2:13 AM: “what do you mean by this?
- Xenquility 2:20 AM: "uh”
- Xenquility 2:20 AM: "one time you accidentally posted a picture of gerard way instead of tyler”
- Xenquility 2:20 AM: "then said you had to go”
- Xenquility 2:20 AM: "I fear saying more than that”
- Erika_XP💚 2:23 AM: "woops old picture”
- Xenquility 2:23 AM: "mph”
- Xenquility 2:23 AM: "sexy beast”
- Xenquility 2:23 AM: ”:)”
- Erika_XP💚 2:24 AM: “wait no I only post pictures of Tyler when I say I want to post a picture of tyler you must be mistaken”
- Xenquility 2:27 AM: "hm”
- Xenquility 2:27 AM: "id rather not risk any more spooky things”
- Xenquility 2:27 AM: "so maybe”
- Erika_XP💚 2:28 AM: "Its amazing how many spooky things could honestly happen in this moment I feel, there is so much that I can sense is waiting to happen the moment it gets the chance”
- Xenquility 2:28 AM: "that sounds absolutely terrifying”
- Xenquility 2:28 AM: "any clue when that moment may be?”
- Erika_XP💚 2:30 AM: "very soon maybe”
- Erika_XP💚 2:30 AM: "or far from now but probably soon I would reckon”
- Erika_XP💚 2:30 AM: "more than likely soon”
- Erika_XP💚 2:30 AM: Well let me push some buttons and find out XD” ((This message was later deleted))
- Xenquility 2:31 AM: "Two days soon or four months soon?”
- Erika_XP💚 2:31 AM: "did you know mcr has 5 people in their band, I always forget about the drummer guy lol”
- Xenquility 2:31 AM: "5”
- Xenquility 2:31 AM: "cool”
- Xenquility 2:31 AM: "Anyways, I think I’m going to head off for the night”
- Xenquility 2:31 AM: "2:30 am for me xd”
- Erika_XP💚 2:34 AM: "WAIT JUST A MOMENT I JUST NOTICED SOMETHING”
- Xenquility 2:34 AM: ”?”
- Erika_XP💚 2:34 AM: “I HAVE A BONE TO PICK”
- Xenquility 2:34 AM: "With?”
- Erika_XP💚 2:35 AM: "Why the hell am I”
- Erika_XP💚 2:35 AM: "actually never mind thats ok but really funny”
- Erika_XP💚 2:35 AM: "I dont care what you have to say though I am actually a real person” ((This message was later deleted))
- Xenquility 2:36 AM: "what’s going on?”
- Erika_XP💚 2:38 AM: "I”
- Erika_XP💚 2:38 AM: "need to lay down”
- Xenquility 2:38 AM: "Headaches again?”
12/25/19 - Chat with The Producer
- The Producer 3:58 PM: “Merry Christmas, Internet Coomtectives.”
- 🎄SlinkMas Tree🎄 3:59 PM: "Merry Christmas spookbois”
- ARGdov 3:59 PM: "Happy holidays to you too”
- ARGdov 3:59 PM: "Whatever holiday you may celebrate”
- 🎄SlinkMas Tree🎄 3:59 PM: "Oh shit right”
- ARGdov 4:00 PM: ”?”
- 🎄SlinkMas Tree🎄 4:01 PM: “We don’t know what holiday the Spooks celebrate”
- The Producer 4:01 PM: "I personally celebrate Christmas”
- The Producer 4:01 PM: "Not really sure about the others”
- Xenquility 4:04 PM: "excuse me”
- Xenquility 4:04 PM: "we are now the argdovtectives”
- The Producer 4:05 PM: "Same thing”
- Xenquility 4:05 PM: "are you calling dov a coomer”
- The Producer 4:05 PM: "perhaps in spirit”
- Xenquility 4:05 PM: "someone pin that please”
- 🎄SlinkMas Tree🎄 4:05 PM: "Yo prod”
- 🎄SlinkMas Tree🎄 4:05 PM: "I need you”
- The Producer 4:05 PM: "whoa there”
- 🎄SlinkMas Tree🎄 4:05 PM: "To solve the most hard question”
- The Producer 4:06 PM: "oh”
- The Producer 4:06 PM: "what is it”
- 🎄SlinkMas Tree🎄 4:06 PM: "Is die hard a Christmas movie”
- The Producer 4:06 PM: "dunno”
- The Producer 4:06 PM: "never seen it”
- The Producer 4:06 PM: "but based on what ive heard”
- The Producer 4:06 PM: "should anything that contains christmas imagery be considered a christmas movie?”
- Xenquility 4:06 PM: "no”
- 🎄SlinkMas Tree🎄 4:07 PM: "Kinda”
- Xenquility 4:07 PM: "die hard lacks any inherent christmas themes”
- Xenquility 4:07 PM: "other than taking place on christmas eve”
- The Producer 4:07 PM: "just because something contains the essence of something else does not mean it is necessarily categorized as that thing”
- Xenquility 4:07 PM: "it’s an action movie that happens to take place before christmas”
- The Producer 4:07 PM: "instead it is sort of a new thing altogether”
- 🎄SlinkMas Tree🎄 4:08 PM: ”:GWloopyGok:”
- The Producer 4:08 PM: “an amalgamation of sorts”
- 🎄SlinkMas Tree🎄 4:08 PM: "That solved my doubts”
- 🎄SlinkMas Tree🎄 4:08 PM: "Thanks”
- 🎄SlinkMas Tree🎄 4:08 PM: "Also prod”
- 🎄SlinkMas Tree🎄 4:08 PM: "Do you know if your offices are in a place named: wayward horizon?”
- Xenquility 4:08 PM: ((The player Xenquility posts something about IIIII being an amalgamation))
- The Producer 4:09 PM: "IIIII”
- 🎄SlinkMas Tree🎄 4:09 PM: "Just askin'”
- The Producer 4:09 PM: "IIII”
- The Producer 4:09 PM: "III”
- 🎄SlinkMas Tree🎄 4:09 PM: "Did I fuck up”
- The Producer 4:09 PM: "im kidding”
- Xenquility 4:09 PM: "fuck you”
- 🎄SlinkMas Tree🎄 4:09 PM: "Got legit scared”
- The Producer 4:09 PM: "we dont have actual offices”
- 🎄SlinkMas Tree🎄 4:09 PM: "Aw”
- The Producer 4:09 PM: "but im aware of wayward horizon”
- The Producer 4:09 PM: "i visited it myself once”
- 🎄SlinkMas Tree🎄 4:09 PM: "You did?”
- Xenquility 4:10 PM: "im jealous”
- Xenquility 4:10 PM: "ive always wanted to vacation there”
- 🎄SlinkMas Tree🎄 4:10 PM: "Same dude”
- The Producer 4:10 PM: "nah its kinda shitty”
- The Producer 4:10 PM: "just a couple of crying screaming kids and some dude on an ego trip or something”
- 🎄SlinkMas Tree🎄 4:10 PM: "A couple like, two?”
- Xenquility 4:10 PM: "so it’s like your team”
- The Producer 4:10 PM: "instead of visiting it, you should forge your own horizon”
- 🎄SlinkMas Tree🎄 4:10 PM: "Oh”
- 🎄SlinkMas Tree🎄 4:10 PM: ” I GET IT”
- Xenquility 4:10 PM: “oh wow creative”
- Xenquility 4:10 PM: ”“Our horizon"”
- 🎄SlinkMas Tree🎄 4:10 PM: "OUR HORIZON”
- Xenquility 4:11 PM: "yeah fuck off”
- 🎄SlinkMas Tree🎄 4:11 PM: ”:lewd: :lewd:”
- The Producer 4:11 PM: “feeling epic yet?”
- Xenquility 4:11 PM: "no”
- 🎄SlinkMas Tree🎄 4:11 PM: "Super epic”
- The Producer 4:11 PM: "the duality of man”
- Xenquility 4:11 PM: "astralobservatory.net/ourhorizon”
- 🎄SlinkMas Tree🎄 4:11 PM: "Turns out to be an update”
- Xenquility 4:12 PM: "anyways”
- Xenquility 4:12 PM: "do you know”
- 🎄SlinkMas Tree🎄 4:12 PM: "Prod do u have like a phisical body or are you just a soul travelling around the interweb”
- Xenquility 4:12 PM: "some fucking dumbass thought they could steal your profile picture and get away with it”
- The Producer 4:12 PM: "like i said, im super fleshy”
- Xenquility 4:12 PM: "and Im coming to you in hopes of suing”
- Xenquility 4:12 PM: "and by that I mean”
- Xenquility 4:12 PM: "what do you know about that guy”
- ARGdov 4:12 PM: "were you dropping hints earleir”
- The Producer 4:13 PM: "cant say”
- Xenquility 4:13 PM: "hard to subpena someone without details”
- ARGdov 4:13 PM: ”“instead it is sort of a new thing altogether” “
- ARGdov 4:13 PM: “"an amalgamation of sorts"”
- 🎄SlinkMas Tree🎄 4:13 PM: "WinterTide dreams”
- ARGdov 4:13 PM: "thats a yes then”
- 🎄SlinkMas Tree🎄 4:13 PM: "That’s the name”
- The Producer 4:13 PM: "IIIII”
- The Producer 4:13 PM: "IIII”
- The Producer 4:13 PM: "III.5”
- 🎄SlinkMas Tree🎄 4:13 PM: "Lmao”
- The Producer 4:13 PM: "III”
- 🎄SlinkMas Tree🎄 4:13 PM: "II”
- Xenquility 4:13 PM: "do it”
- Xenquility 4:13 PM: "you wont”
- The Producer 4:13 PM: "more like WintertideMemes”
- 🎄SlinkMas Tree🎄 4:14 PM: "So you know her?”
- The Producer 4:14 PM: ”“her"”
- Xenquility 4:14 PM: "you sexist pig”
- ARGdov 4:14 PM: "who are we talking about now”
- Xenquility 4:14 PM: "wintertidedick”
- 🎄SlinkMas Tree🎄 4:14 PM: "Is it a dude?”
- Xenquility 4:14 PM: "harvestmemeories”
- 🎄SlinkMas Tree🎄 4:14 PM: "Aw”
- The Producer 4:14 PM: "wintertidedreams has a dick”
- 🎄SlinkMas Tree🎄 4:14 PM: "Fuck”
- The Producer 4:14 PM: "confirmed”
- Xenquility 4:14 PM: "yo dov go him them up”
- Xenquility 4:14 PM: "seduce information out of them”
- ARGdov 4:14 PM: "you think I have that skill lmao”
- The Producer 4:15 PM: "good luck”
- The Producer 4:15 PM: "lol”
- ARGdov 4:15 PM: "nah my greatest skill of seduction is to get drunk and walk up to people and tell them theyre hot”
- 🎄SlinkMas Tree🎄 4:15 PM: "Does he know winter is a female name?”
- The Producer 4:15 PM: "Do you know that winter is a month”
- ARGdov 4:15 PM: "this does not work that often as you can probably imagine”
- The Producer 4:15 PM: "i mean a season”
- ARGdov 4:15 PM: "winter is a season”
- Xenquility 4:15 PM: "yeah cause producer is totally his name”
- ARGdov 4:15 PM: "its not necesarily gendered”
- Xenquility 4:15 PM: "all these guys go by their real name”
- Xenquility 4:15 PM: "A MONTH”
- Xenquility 4:15 PM: "gg”
- ARGdov 4:15 PM: "ah”
- 🎄SlinkMas Tree🎄 4:15 PM: "See dumbasses”
- ARGdov 4:15 PM: "yeah ok its sorta gendered but its not inherently so”
- Xenquility 4:16 PM: "im pretty sure their actual name isnt winter”
- ARGdov 4:16 PM: "its probably just because Summer is a womens name so we just assume winter is too”
- 🎄SlinkMas Tree🎄 4:16 PM: "As always, I outsmarted your asses”
- Xenquility 4:16 PM: "just like producer probably isn’t called producer”
- ARGdov 4:16 PM: "in this essay I wi-”
- The Producer 4:16 PM: "I can say that Wintertide and Harvest are two sides of a coin”
- The Producer 4:16 PM: "if a coin had”
- The Producer 4:16 PM: "like”
- The Producer 4:16 PM: "maybe more than two sides”
- The Producer 4:16 PM: "and was also very thick”
- Xenquility 4:16 PM: "are they like”
- 🎄SlinkMas Tree🎄 4:16 PM: "Both acted edgy on us”
- ARGdov 4:16 PM: "so its more lke a D6”
- Xenquility 4:16 PM: "all the cunts from wayward or something”
- The Producer 4:16 PM: "they are all cunts from within”
- ARGdov 4:16 PM: "lol there was only like 3 or 4 people in wayward”
- ARGdov 4:16 PM: "within”
- ARGdov 4:16 PM: "hmm”
- 🎄SlinkMas Tree🎄 4:17 PM: "Dubris?”
- 🎄SlinkMas Tree🎄 4:17 PM: "Hubris?”
- 🎄SlinkMas Tree🎄 4:17 PM: "Tribris?”
- Xenquility 4:17 PM: "how many people are characters from hubris”
- Xenquility 4:17 PM: "lets count”
- The Producer 4:17 PM: "Tribris is a dead meme”
- ARGdov 4:17 PM: "indeed”
- 🎄SlinkMas Tree🎄 4:17 PM: "As a tribris member I feel ofended”
- ARGdov 4:17 PM: "ok, so, sorry”
- ARGdov 4:17 PM: "ive been like hella busy”
- Xenquility 4:17 PM: "uno = chris”
- Xenquility 4:17 PM: "dos = Spencer”
- Xenquility 4:17 PM: "tres = egotripassholeguymaybekelbris?maybetenebris?whothefuckknows”
- Xenquility 4:17 PM: "who else”
- ARGdov 4:17 PM: "what exactly have these people done when they acted edgy?”
- Jos 4:17 PM: "as a quadbris, i find this funny”
- Xenquility 4:17 PM: "they just post gifs”
- 🎄SlinkMas Tree🎄 4:17 PM: "You know”
- Xenquility 4:17 PM: "and ciphered messages”
- ARGdov 4:17 PM: "ah”
- 🎄SlinkMas Tree🎄 4:17 PM: "Acted like III”
- Jos 4:18 PM: "pentabris”
- ARGdov 4:18 PM: "any of them solved?”
- Xenquility 4:18 PM: "One posted a video of oldbris”
- Jos 4:18 PM: "sexbris”
- ARGdov 4:18 PM: "huh”
- 🎄SlinkMas Tree🎄 4:18 PM: "SEXBRIS”
- Xenquility 4:18 PM: "Yeah all are solved but wolf hasn’t updated the wiki”
- 🎄SlinkMas Tree🎄 4:18 PM: "FBI”
- ARGdov 4:18 PM: "so they may be someone who was from there”
- The Producer 4:18 PM: "you guys still gotta esrever”
- ARGdov 4:18 PM: "ugh so Im behind with no way to catch up lovely”
- ARGdov 4:18 PM: "reverse?”
- Xenquility 4:18 PM: "reverse what though”
- Xenquility 4:18 PM: "as in”
- Xenquility 4:18 PM: "from whence must be reverse”
- 🎄SlinkMas Tree🎄 4:18 PM: "You mfers need to esaeler”
- The Producer 4:18 PM: "you must reverse the thing that was reversed”
- 🎄SlinkMas Tree🎄 4:18 PM: "So we straight it up”
- The Producer 4:19 PM: "reverse reversism”
- The Producer 4:19 PM: "I will always advise one to straight it up”
- 🎄SlinkMas Tree🎄 4:19 PM: ”:GWloopyGok:”
- The Producer 4:19 PM: “im kidding”
- 🎄SlinkMas Tree🎄 4:19 PM: "So, can we confirm that the two gif posting boys are bupbois?”
- The Producer 4:20 PM: "technically yes”
- 🎄SlinkMas Tree🎄 4:20 PM: "Nice”
- The Producer 4:20 PM: "but what IS a bupboi”
- 🎄SlinkMas Tree🎄 4:20 PM: "Work for bup”
- ARGdov 4:20 PM: “yee”
- 🎄SlinkMas Tree🎄 4:20 PM: "Or for eoeoeoeo”
- The Producer 4:20 PM: "bup'n'co”
- 🎄SlinkMas Tree🎄 4:20 PM: "Excuse me”
- 🎄SlinkMas Tree🎄 4:20 PM: "Bupbois.inc”
- Xenquility 4:20 PM: "I like bup'”
- Xenquility 4:20 PM: "n'co”
- The Producer 4:21 PM: "hopefully bup will return soon”
- The Producer 4:21 PM: "they have been away for a while”
- Xenquility 4:21 PM: "okay so I have one concern”
- ARGdov 4:21 PM: "bub n co sounds like a PBS kids show”
- The Producer 4:21 PM: "only one?”
- Xenquility 4:21 PM: "or a question”
- Xenquility 4:21 PM: "I should say”
- 🎄SlinkMas Tree🎄 4:22 PM: "And are all the bupbois chill like you but act like that OR are they just IIII-like bc they were born that way”
- Xenquility 4:22 PM: "does reverse refer to an unsolved cipher, or could it be referring to something else”
- The Producer 4:22 PM: "it refers to something else”
- Xenquility 4:22 PM: "could it refer to a video”
- ARGdov 4:22 PM: "damn”
- ARGdov 4:22 PM: "hmmm”
- The Producer 4:22 PM: "something that emo harvest boy posted”
- Xenquility 4:22 PM: "could it refer to the hubris video”
- 🎄SlinkMas Tree🎄 4:23 PM: "ThoughT the same”
- The Producer 4:23 PM: "no”
- Xenquility 4:23 PM: "hm”
- The Producer 4:23 PM: "ThouguohT”
- The Producer 4:23 PM: "thats not a hint im just making fun of slinky”
- Xenquility 4:24 PM: "so if its not a cipher”
- The Producer 4:24 PM: "though even if you reversed the correct thing, i doubt it would mean much to you”
- Xenquility 4:24 PM: "and not the video”
- Xenquility 4:24 PM: "oh great”
- 🎄SlinkMas Tree🎄 4:24 PM: "Did you know the Pokemon girafarig is a palindrome of the Spanish word "Girafa” which means jiraffe”
- The Producer 4:24 PM: “but it probably would mean something essential to harvest”
- The Producer 4:24 PM: "some unspoken deep-seated things from their past”
- Xenquility 4:24 PM: "I GOT IT”
- Xenquility 4:24 PM: ”“toober"”
- Xenquility 4:24 PM: "he was a youtuber”
- Xenquility 4:24 PM: "easy”
- 🎄SlinkMas Tree🎄 4:25 PM: "Reboot”
- The Producer 4:25 PM: "you did it”
- Xenquility 4:25 PM: "fuck yes”
- Xenquility 4:25 PM: "we won”
- 🎄SlinkMas Tree🎄 4:25 PM: "Gg”
- The Producer 4:25 PM: "i must depart for christmas festivities”
- The Producer 4:25 PM: "and by that i mean sitting alone in front of the computer”
- The Producer 4:25 PM: "farewell”
- The Producer 4:25 PM: "until we meat again”
Pages
This section contains all of the pages that were hosted on the Internet Detectives Tumblr.
Internet Detectives Tumblr Pages
Johnisdead Timeline
((This page simply contained every blog post that was published on the Internet Detectives Tumblr that was tagged "JohnIsDeadTimeline".
Yshdt Timeline
((This link simply redirected players to a Google Doc that archived the events of the YSHDT Arc.
https://docs.google.com/document/d/1Af7tdiGQh4Vi-eTOxjKi9HlWcfidNFhQfEFC5iI8LsU/edit
ARG Links
https://internetdetectives.tumblr.com/links
ARG Links
Johnisdead Links:
- johnisdead.com
- lunarchildren.com
- whatisben.com
- Tyler’s Youtube
- Vincent Adam’s Youtube
- lostmemory423 Youtube
YSHDT Links:
Resources:
/Shrine\
https://internetdetectives.tumblr.com/shrine
/Shrine
Let us all worship the purpleness of /Patrem\
Love Letters to /Patrem\ :
- Roses are Red
Violets are Blue
You’re a hideous ghoul
and we’re terrified of you.
-wickedlady4180 - Dat voice, so sexy.
Dat butt, so smooth.
Dat attitude, so dickish.
Dat responce, so r00d.
-wickedlady4180 - PLEASE DON’T KILL US PLEASE
‘CAUSE WE REALLY DON’T WANNA DIE
AND IF YOU DO NOT KILL US WE WILL
BAKE YOU LOTS OF PIES
- Circlehunter - Papa.
Just killed a man.
Sent him running to his death.
Someone threw a rock,
and now he’s dead.
Hello, purple daddy.
I hope you’re glad.
You told me not to change time,
but screw that shit!
PAPA! OOOOHHHHHH.
-wickedlady4180
/Patrem’s the best father an Internet Detective could have. He transcends time and space, he is immortal, and when he gets angry… people die.
FAQ
https://internetdetectives.tumblr.com/faq
FAQ
Do you have questions?
Perfect! We’ve got some answers.
If you have any questions not in this FAQ, please feel free to message us.
Q: “Who the hell are the Internet Detectives?”
A: The Internet Detectives is a Skype group that was created during the month of January 2015. Their purpose is to solve ARGs, draw shitty comics, and partake in other pointless shenanigans. (Wiki)
Q: “How can I become an Internet Detective?”
A: First you have to sing our Anthem, and pledge fealty to the group. Then you message us with your Skype name, so we can add you to the group. Then you will be subjected to the trials of initiation. The Trial of Flame: This is where we troll you with links to Vaporwave songs, stupid Tumblr images, and accuse you of being a spy. The Trial of Tears: This where you watch us fail at humanity. The Final Trial = Fight or Flight: This is where you decide whether you will run far away from us, or remain one of us … o n e o f u s.
Q: “Is this real life?”
A: No, unfortunately this is not real life, this is an ARG. However, John is most certainly dead. He will be missed. RIP.
Q: “Should I read the Timelines?”
A: Yes. In fact, it’s probably the most important thing to do before attempting to play the ARG. There is a ton of information, lore, and characters to learn. We strongly urge you to read both YSHDT and The Dead Arc timelines.
Q: “Why are there two Arc Timelines?”
A: Yshdt and The Dead Arc are both considered one ARG: John is Dead. However, while the ARG as a whole was conceptualized by the current group of GM’s, the Douglas & Mason storyline of the Yshdt Arc was created by “Dawn of a New Day”. As such, the Yshdt Arc will be considered a stand-alone introduction to the current Dead Arc, and have its own timeline of events.
Q: “Will Yshdt ever conclude?”
A: Unfortunately Yshdt is on indefinite hiatus.
Q: “Is this related to BENDROWNED?”
A: Yes. This ARG is related to, and heavily influenced by The Haunted Cartridge & The Moon Children Arc of Jadusable’s infamous Creepy Pasta “BENDROWNED”. However, this ARG is in no way affiliated with Jadusable, or any of his works.
Q: “How many characters are there in this ARG?”
A: The list of characters related to this ARG can be found HERE.
Q: “Who are the Moon Children & Lunar Children?”
A: In this ARG, we begin to learn more information about the Moon Children, prior to the earliest mentions in the Jadusable lore. The Moon Children are a long standing group of cultists that worship the Moon Goddess ‘Luna’. It’s learned that in the early 1980’s the cult had a division within its ranks and was split apart into groups: The Lunar Children and The Moon Children. It is the Lunar Children, led by the FATHER /Patrem\, who are the driving force behind the terrible fates of Tyler, John, Jayckup, and Kevin.
(A link to the Jadusable wiki and the original description of the Moon Children can be found HERE.)
Fuckers
https://internetdetectives.tumblr.com/Meet-The-IDs
The Internet Detectives
Tyler
- Currently a main character in the Dead Arc. He lost his memory, and thus doesn’t remember being our resident Vaporwave addict. His amnesia is enforced by /Patrem\ so enlightening him is futile, as he’ll just think we’re insane and obviously lying.
- Currently a main character in the Dead Arc. Dis’ nigga straight up ded.
- Currently a main character in the Dead Arc. Is the acid hitting you yet?
- Creator of YSHDT (aka - The Man), also played the character “Helper”. Is too cool for us now, and only comes around to call us nerds and fags.
CircleHunter / Captain Desdinova / Wyatt
- Long time ID member, owner of the Jadusable wiki. Also played the Character “Grey Man” in the YSHDT arc. Refuses to wear clothes on cam, showing us his glorious pectorals at every opportunity.
- Possibly the smartest person here.
- A member of #TeamFlan, Biggest plátano lover in ID. ( ͡° ͜ʖ ͡°)
- He’s not gay, he’s British.
- TeamFlan member, has found many clues in game, and is credited in the timeline several times.
- The Keeper of the Scrolls of Time. Is loyal to /Patrem\, so therefore is a BITCH and a TRAITOR.
- Joined WH at the begining of the ARG. Started the wiki, and maintains the dropbox.
- Is noted for posting in short bursts of randomness. Completely believes he’s Link, but he’s actually a Lonk.
- Creator of Weenie Licked, the infamous ARG on Within Hubris. He’s an overrated piece of garbage…. still good though.
- The Boss of #TeamFlan. Refuses to get in call with the group, “too shy” possibly sounds like Dr. Girlfriend.
- W̶̕͜͠A̶̷N̴̡̕͠͞Ḑ͢Ę̸R͟͏I͠͝N̷͏̵͜G͢H̢͝͞Ứ̵͞R̶̶͡T̨͢I̸͘͞N̶̛͝G̨F̕͝Ì̶̡G̸̢̛̕H̷̡̀͠T̶̴̢̀I̵̛Ń̢G̀͘͠C̨̀͜R͏̷͟Y̶͠͏̕I̷̶͡N͏̸̨̛͡G̡̢̛͞K̶̡̕I͏L̸̴̛͞Ĺ̨̕I̕͜N͜G̷͘͝Ḿ̷̵̡͜O͏̷͞Ư̷̡̕͠R̸̡͞͏N̨Í̸̷͝N̸͢G͢͡M̴͘͠͏A̸̧Ņ͜͝I̸̧P͝Ư͡L̷̸ÀT̶̷̴̵Í̕͘͠N̶̸͘Ǵ̡̢͘͢Á̧͝G̵̶̨̕E̷̢̢͟͟L̨̨̕͝E̶̶͘͠S̵̶̕͞S͠S̀͏̶͝H̨̢̢͝Á̷Ḑ͝Ơ͡͝W̕
Seeker von Yuki II / TheSeekerofLight
- What is this I don’t even…
- One of God’s chosen. A cool broskino, keeps the Sabbath so we get to talk about him all day on Saturday, like about how we still can’t believe he showed Doug the bomb plans!
- Triggered the YSHDT game by playing Oath to Order as a joke.
- Tried to kill Mason and Doug, tricked us all. Untustable.
- The rarest and most elusive of the ID’s. Solved the infamous cipher given to us by Helper.
- Lives on the other side of the world, usually comes around when we’re all asleep.
- A picture tells a thousand words…
- The only ID member to get younger with each minute that passes.
- Fuks your scripts with a huge cac, and doesn’t afraid of anything!
- Proved their worth on the field of honor; solved BinReset.jpg.
- You’re here, you’re queer. Deal with it!
Images
Various images used for the Internet Detectives Tumblr.